CLUSTAL format seed alignment for MF_01342

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL16_GEOMG      -MLMPKRVKYRKQMKG---RMT---GAAMRGATLSYGDFGLQATECGWVDSRQIEAARIA
RL16_GEOSL      -MLMPKRVKHRKQMKG---RMK---GDAQRGASLAFGEFGLQATECGWVDSRQIEAARIA
RL16_PELCD      -MLMPKKVKHRKQFKG---RMK---GVAYRGSDLNFGDYGLKAVECGWLSSRQIESARRA
RL16_SYNAS      -MLMPKRVKYRKLQRG---RRT---GTATRGSKISFGEYGLQAEECGWITARQIEAARIA
RL16_BDEBA      -MLSPKRVKWRKQFVG---RAT---GFAVRGANLDFGDYGLQAVEEGRLTARQLEAGRIA
RL16_MYXXD      -MLQPARTKYRKMHKG---RMP---GSAHRGSDMTYGEYGLMSLQPGWITSRQIEAARIA
RL16_ECOLI      -MLQPKRTKFRKMHKG---RNR---GLAQ-GTDVSFGSFGLKAVGRGRLTARQIEAARRA
RL16_YERPS      -MLQPKRTKFRKMHKG---RNR---GLAQ-GTDVSFGEFGLKACGRCRLTARQIEAARRA
RL16_HAEI8      -MLQPKRTKFRKVHKG---RNR---GIAS-GTEVSFGTYGLKAVGRCRLTARQIEAARRA
RL16_PHOPR      -MLQPKRTKFRKTFKG---RNR---GLAN-GTDVSFGTFGLKAVGRGRLTARQIEAARRA
RL16_SHEON      -MLQPKRMKFRKMFKG---RNR---GLAN-GTEVSFGTFGLKAVGRGRLTARQIESARRA
RL16_VIBPA      -MLQPKRTKFRKVQTG---RNR---GLAK-GTDVSFGEFGLKAVGRGRLTARQIEAARRA
RL16_BUCAK      -MLQPKRTKFRKRHKG---RNR---GLAN-GTDVHFGTFGIKAVDRGQMTARQIEAARRT
RL16_BAUCH      -MLQPKRTKFRKMQKG---RNR---GLAL-DTNVNFGTFGLKAVDRGRLTARQIEAARRT
RL16_BLOFL      -MLQPKRTKFRKMHKG---RNR---GIVV-NDKINFGTFALKSVDRGRLKSCQIESARRA
RL16_BLOPB      MLLQPKRTKFRKMHKG---RNR---GTKV-NDNISFGQFALKAISRGRLKSCQIEAARRA
RL16_BUCAI      -MLQPKRTKFRKMHKG---RNR---GLAS-GTDINFGTFGLQAIDRGRLTARQIESARRA
RL16_BUCAP      -MLQPKRTKFRKMHKG---RNR---GLAF-GANVSFGLFGLKAIDRGRLTARQIESARRA
RL16_BUCBP      -MLQPKNTKFRKMHKG---KNR---GLAI-GTNVHFGLYGLKAITRGRLKSSQIESARRA
RL16_WIGBR      -MLQPKRTKFRKMQKG---RNR---GLSV-NSEINFGKFGLKAIQRGRLTSRQIESARRA
RL16_CHRSD      -MLQPKRTKFRKVQKG---RNR---GLAHRGSKVSFGEYGLKATGRGRITARQIEAGRRA
RL16_SACD2      -MLQPKRTKFRKQQKG---RNR---GLAHRGSKVSFGEFALKATGRGRITARQIEAARRA
RL16_PSEAE      -MLQPKRTKFRKQMTG---HNR---GLAHRGSKVSFGEYALKATSRGRLTARQIESARRA
RL16_LEGPH      -MLQPKRTKYRKQMKG---RNR---GLALRGSKISFGEFGLKAVERGRLTARQIEAARRA
RL16_IDILO      -MLQPKRTKFRKVHTG---RNR---GLAQSGNKVSFGTFGLKATDRGRMTARQIEAGRRA
RL16_PSEHT      -MLQPKRTKFRKTHKG---RNR---GLAQNGNKVSFGTFGLKATGRGRMTARQIEAARRA
RL16_COLP3      -MLQPKRTKFRKQFKL---RNR---GLAHVGSSVSFGTFGLKSMERGRMTARQIEAARRA
RL16_HYDCU      -MLMPKRTKFRKMHKG---RNR---GLANVGNKISFGEFGLKAMERGRMTSRQIEAARRV
RL16_FRATT      -MLQPKRTKFRKQQKL---RNR---GLAHRGNKVSFGEFGLQATSRGRITARQIEAGRRA
RL16_NITOC      -MLQPKRTKFRKQQKG---RNR---GQALRGSQIDFGEYGLKAIGRGRITARQIEAARRA
RL16_DECAR      -MLQPNRRKFRKEHKG---RNE---GLATRGTKVSFGEWGLKAIGRGRLTARQIEAARRA
RL16_THIDA      -MLQPARRKFRKEQKG---RNT---GLATRGADVSFGDFGLKAVGRGRLTARQIEAARRA
RL16_BORA1      -MLQPSRRKYRKEQKG---RNT---GLATRGAQVSFGEFGLKATGRGRLTARQIEAARRA
RL16_RALSO      -MLQPKRRKYRKEQKG---RNT---GIATRGNAVSFGEFGLKAMGRGRLTARQIESARRA
RL16_AROAE      -MLQPSRRKYRKEQKG---RNT---GIATRGAKVSFGEFGLKAIGRGRLTARQIESARRA
RL16_NITMU      -MQQPARTKYRKQQKG---RNK---GIATRGAKVSFGEYGLKAVGRGRLTARQIEAARRA
RL16_METFK      -MLQPARQKFRKMQKG---RNK---GIATTGNKVSFGEFGLKAIGRGRLTARQIEAARRV
RL16_NITEU      -MLQPARTKFRKQHKG---RNT---GIATRGAKVSFGEFGLKAIGRGRLTSRQIEAARRA
RL16_NEIMB      -MLQPTRLKYRKQQKG---RNT---GIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRA
RL16_CHRVO      -MLQPTRLKYRKQHKG---RNT---GIATRGNKVSFGDFGLKAIGRGRLTARQIEAARRA
RL16_RHOFT      -MLQPARRKYRKEQKG---RNT---GIATRGSSVAFGDFGLKCIDRGRLTARQIEAARRA
RL16_HAHCH      -MLQPKRTKFRKVHKG---RNT---GLAQRGNKVSFGEFGLKATGRGRITARQIEAARRT
RL16_METCA      -MLQPKRTKYRKQHKG---RNT---GVAIAGSKVSFGEYGLKATTRGRITARQIEAARRT
RL16_PSYA2      -MLQPKRTKFRKMHKG---RNT---GLAHRGSTVAFGQIGLKSLTRGRMTARQIEAARRT
RL16_ACIAD      -MLQPKRTKFRKVQKG---RNT---GLAHRGSTVSFGSIAIKATERGRMTARQIEAARRT
RL16_XANC8      -MLQPKRTKYRKMHKG---RND---GLAWSGNAVSFGEYGLKATAHGQLTARQIEAARRT
RL16_XYLFT      -MLQPKRTKYRKMHKG---RNC---GLSWNANVVSFGQYGLRATAHGQLTARQIEAARRS
RL16_COXBU      -MLQPSNRKYRKDFKG---RNR---GVASRGNRVSFGEFGLKATECARITARQLEAARRT
RL16_HELHP      -MLMPKRTKYRKQMKG---RNR---GKSFRGANLAFGDIGIKAIEHGRIDSRQIESARIA
RL16_WOLSU      -MLMPKRTKFRKQMKG---RNR---GKSFRGNSLAFGDIGIKATEHGRIDSRQIEAARIA
RL16_HELPJ      -MLMPKRTKYRKQMKG---RNR---GKAHRGNSIAFGDIAIKAIEHGRIDSRQIESARVA
RL16_SULDN      -MLMPKRTKYRKMMKG---RNR---GYARSGYTLAFGDIALKAVEAGRINSRQIESARIS
RL16_CAMJR      -MLMPKRTKYRKMMKG---RNR---GYANRGTEFTFGEFALKATEAGRINSRQIEAARIA
RL16_DESAG      -MLTPKKVKFRKRQKG---RLK---GDALKGNNVAFGEIGLKVLEHGKLTSQQIEAARVA
RL16_DESVH      -MLSPRKVKFRKWQKG---RNK---GVATRGATVAFGDIGLKAIEHGKLTSQQIEAARIA
RL16_LAWIP      -MLAPKKVKFRKWQKG---RLR---GPALRGISIAYGDIALKSTEHGKLTSQQIEAARIA
RL16_LEPIC      -MLSPKRVKFRKRQRG---RLK---GTDERGSSVSFGEFGLKAVTSGRLTARQIEAARIT
RL16_DESPS      -MLSPKKVKHRKVFKG---RMR---GAAHRGSSLAFGDYALKALSCGTMTARQIEAARIT
RL16_EHRCJ      -MFIPKKTKYKKDFKG---RIS---GNAKGGYTLSFGSYGLKALEPCRLTSKQIESARRS
RL16_EHRRW      -MFIPKKTKYKKDFKG---RIS---GNAKGGYTLAFGTYGLKSLEPGRLTSKQVESARRS
RL16_ANAMM      MLFVPKKTKYSKSFKG---RIK---GQTKGGSELAFGSCGLKALEPCRLTSKQIESARRS
RL16_WOLPM      -MFIPKKSKYKKVFKG---RIK---GNTKGGSTLSFGDYGLKAMEAGRIQSKHIETARRV
RL16_WOLTR      -MFVPKKSKYRKVFKG---RIK---GNTKGGSTLSFGDYGLKTIEAGRVQSKHIETVRRV
RL16_NEOSM      -MLAPKKLKHKKFRKV---RFS---DASARGSGLAFGEYGLKAIGSARLNGRQIESARRV
RL16_RUEPO      -MLQPKRTKFRKMFKG---RIH---GLAKGGSDLNFGTYGLKALEPERVTARQIEAARRA
RL16_ROSDO      -MLQPKRTKFRKQFKG---SIK---GLAKGGSDLNFGTYGLKAIEPERITARQIEAARRA
RL16_RHOS4      -MLQPKRTKFRKQHKG---RIH---GEAKGGFLLNFGGFGLKATEPERVTARQIEAARRA
RL16_BRUSU      -MMQPKRTKFRKQFKG---RIH---GNSKGGTDLNFGAFGLKALEPERVTARQIEAARRA
RL16_CHESB      -MLQPKRTKFRKQFKG---RIH---GAAKGGTDLNFGAFGLKALEPERVTARQIEAARRA
RL16_BARQU      -MLQPKRTRFRKQFKG---RIH---GVSKGGTDLNFGAYGLKAVEPERITARQIEAARRA
RL16_CAUVC      -MLSPKKTKFRKQFKG---RIH---GTSKGGTLLNFGSYGLKAVEPERITARQIEAARRA
RL16_RHIME      -MLQPKRTKYRKQFKG---RIK---GVAKGGSDLAFGEFGLKAQEPNRVNAREIEAARRA
RL16_RHILO      -MLQPKRTKFRKQFKG---RIH---GTAKGGTNLDFGGFGLKALEPNRVTAREIEAARRA
RL16_NOVAD      -MLQPKKTKFRKAFKG---RIH---GLAKGGTDLNFGSYGLKALEPERVTARQIEAARRA
RL16_SPHAL      -MLQPKKTKFRKAFKG---RIH---GNAKGGTSLNFGSYGLKAMEPERITARQIEAARRA
RL16_ZYMMO      -MLQPKRTKFRKAHKG---RIH---GNAPGGATLNFGAYGLKAMEPDRITARQIEAARRA
RL16_RHORT      -MLSPKRTKFRKQHKG---RIH---GLAKGGTDLNFGSFGLKAVEPERVTARQIEAARRA
RL16_MAGSA      -MLSPKRTKFRKAHKG---RIK---GVTKGGSALNFGAYGLKALEPERITARQIEAARRA
RL16_GLUOX      -MLSPKRTKFRKAHKG---RIH---GLAKSGTQLNFGAFGLKALEPERITARQIEASRRA
RL16_RHOPA      -MMQPKRTKFRKAHKG---RIH---GVASSGATLAFGQFGLKAMEPERITARQIEAARRA
RL16_PELUB      -MLQPVRTKYRKAHKG---RIH---GTATRASKINYGSFALKAMAPERIIGKQIEAARVA
RL16_RICBR      -MLAPKKQKFRKAHKG---RVV---SKSKAGTTLAFGSFGLKSIDGWRVTARQIEAGRKA
RL16_BACTN      -MLQPKKTKFRRQQKG---RAK---GNAQRGNQLAFGSFGIKALETKWITGRQIEAARIA
RL16_PORGI      -MLQPKKTKFRRQQKG---RMK---GFAQRGNQLSFGSFGIKSLQSKWITGRQIEAARIA
RL16_SALRD      -MLEPKDTKHRKVQRNQGLKRN---KYAVKGTRLSFGDYGLKSLEEGEVNSRQLEAARVA
RL16_SYNSC      -MLSPKRVKFRKQQRG---RMR---GVATRGNTIAFGQFALQAQECGWITSRQIEASRRA
RL16_SYNPX      -MLSPKRVKFRKMQRG---RMR---GVATRGNTIAFGEFALQAQECGWITSRQIEASRRA
RL16_PROMM      -MLSPKRVKFRKQQRG---RMR---GVATRGNTIAFGEFALQAQECGWITSRQIEASRRA
RK16_PAUCH      -MLSPKRVKFRKQQRG---RMR---GIATRGNTIAFGQFALQAQECGWITSRQIEASRRA
RL16_PROMA      -MLSPKRTKFRKQQRG---RMR---GVATRGNKIAFGQFALQAQECGWITSRQIEASRRA
RL16_PROMT      -MLSPKRTKFRKQQRG---RMR---GVATRGNKIAFGQFALQAQDCGWVTSRQIEASRRA
RL16_PROM9      -MLSPKRTKFRKQHRG---RMR---GVASKGNTIAFGQFALQAQDCGWVTARQIEASRRA
RL16_PROMP      -MLSPKRTKFRKQHRG---RMK---GIASKGNTIAFGQFALQAQDCGWVTARQIEASRRA
RL16_SYNP6      -MLSPRRTKFRKQQRG---RMT---GKATRGNTLAFGNFGLQALECSWITARQIEASRRA
RK16_CYAPA      -MLSPRRTKFRKQQRG---RMK---GISTRGNNLVFGDFGLQALEPAWITSRQIEASRRA
RL16_MICDP      -MLSPRRTKFRKQQRG---RME---GLAHRGSTLNFGDFALQAQEPAWITSRQIEASRRA
RL16_SYNY3      -MLSPRRTKFRKQQRG---RMR---GLAERGSTLNFGDYALQATEPCWITSRQIEAARRA
RL16_THEEB      -MLSPKRTKFRKQQRG---RMT---GVASRGNSIHFGDYALQALEPAWITARQIEAGRRA
RL16_GLOVI      -MLMPKRTKFRKQQRG---RMN---GAACRGNEIEFGTYALQALEPVWMTSRQIEAARRA
RL16_SYNJA      -MLSPKRTKYRKQQRG---RMK---GKATRGNRINFGEYGLVALEPAWITARQIEASRRA
RL16_SYNJB      -MLSPKRTKYRKQQRG---RMK---GKATRGNRINFGEYGLVALEPAWITARQIEASRRA
RK16_CHAVU      -MLSPRKTKFRKHHRG---RMK---GISTRGNSIVFGKFALQALEPSWITSRQIEAGRRS
RK16_CHAGL      -MLSPKRTKFRRHHRG---RMK---GISSRGNFIAFGKFALQALEPSWITSRQIEAGRRA
RK16_SPIMX      -MLSPRRTKFRKQHRG---RMK---GVATRGNQIAFGRFALQAMEASWITSRQIEAGRRA
RK16_STAPU      -MLSPRRTKYRKQHRG---RLK---GTATRGNRICFGRFALQALEPSWITSRQIEAGRRA
RK16_POPAL      -MLSPKRTRFRKQHRG---RMK---GISSRGNRICFGRYALQALEPAWITSRQIEAGRRA
RK16_OENEH      -MLSPKRTRFRKQHRG---RMR---GISYRGNRICFGKYALQALEPAWITSRQIEAGRRA
RK16_ARATH      -MLSPKRTRFRKQHRG---RLK---GISSRGNRICFGRYALQTLEPAWITSRQIEAGRRA
RK16_SPIOL      -MLSPKRTRFRKQHRG---RMK---GISYRGNRICFGRYALQALEPAWITSRQIEAGRRA
RK16_NICTO      -MLSPKRTRFRKQHRG---RMK---GISHRGNHISFGKYALQALEPAWITSRQIEAGRRA
RK16_EPIVI      -MLSPQKTRFRKQHRG---RMK---GISYRGNNICFGKYGLKALEPAWITPRQIEAGRRA
RK16_CALFG      -MLSPKRTRFRKQHRG---RMK---GISYRGNHICFGRYALQALEPSWITSRQIEAGRRA
RK16_WHEAT      -MLSPKRTRFRKQHRG---RMK---GKSCRGNRICFGRYALQALEPAWITARQIEAGRRA
RK16_PHAAO      -MLSPKRTRFRKQHRG---RMK---GISCRGNHICFGRYALQALEPAWITARQIEAGRRA
RK16_AMBTC      -MLSPKRTRFRKQHRG---RMK---GVSSRGNHICFGRYALQALEPAWITSRQIEAGRRA
RK16_NYMAL      -MLSPKRTRFRKQHRG---RMK---GVSYRGNRICFGRYALQALEPAWITSRQIEAGRRA
RK16_LANPU      -MLSPKRTRFRKQHRG---RMK---GKSYRGNHISFGRYALQAVEPAWITARQIEAGRRA
RK16_PINTH      -MLSPKRTKFRKQHRG---RMK---GVSYRGNRICFGRFALQALEPAWITSGQIEAGRRT
RK16_HUPLU      -MLSPKRTKFRKQHRG---RLG---GVSTRGNRICFGRFALQALEPAWITSRQIEAGRRA
RK16_ANTAG      -MLSPKRVKFRKQHRG---RMK---GISTRGNQICSGKFAPQALEPAWITSRQIEAGRRA
RK16_PHYPA      -MLSPKRTKFRKQHRG---RMK---GIATRGNSIAFGKFALQALEPSWITSRQIEAGRRA
RK16_MARPO      -MLSPKRTKFRKQHCG---NLK---GISTRGNVICFGKFPLQALEPSWITSRQIEAGRRA
RK16_ZYGCR      -MLSPKRTRFRKQHRG---RLK---GISTRGNRICFGRFGLQALEPSWITSRQIEAGRRA
RK16_PSINU      -MLSPKRTRFRKQHRG---RMK---GVSTRGNRICFGKFALQALEPAWITARQIEAGRRV
RK16_ADICA      -MQNPRRTKYRKQHRG---RLR---GISSRGNVVSFGKYALQALEPAWITARQIEAGRRA
RK16_OLTVI      -MLSPKRTKYRRYHRG---RMK---GKAMRGNKLTYGDFALQSLEPGWLTSRQIEAGRRV
RK16_TUPAK      -MLSPKRTKFRRHHRG---RMK---GKANRGNSIVYGDFGLQALEPGWIKSRQIESGRRV
RK16_CHLSP      -MLSPKRTKFRKPHRG---HLR---GKATRGNTIVFGDFALQAQEPCWITSRQIEAGRRV
RK16_TETOB      -MLSPKRTKFRRPHRG---NLK---GKACRGTKIAFGEYGLQALEPCWITSRQIESGRRV
RK16_OSTTA      -MLSPKRTKYRKPHRG---NRK---GQALRGNKISFGDFALQALEPGWITSRQIEAGRRA
RK16_NEPOL      -MLSPKRTKFRRPHRG---HRR---GRALRGNTIAFGDFAIQALESSWVTSRQIEAARRA
RK16_MESVI      -MLSPKRTKFRRHHRG---KMR---GVATRGNKVSFGDFGLKTLEPGWLTSRQIEAGRRA
RK16_EUGLO      -MLKPKKTKFHKYHRG---KIK---GKIY--DNVNFGEFALQSLEFGWITSKQIEAIRKV
RK16_EUGGR      -MLSPKRTKFRKYHRG---RLT---GKIYLIDKVVFGNYALQSLEPGWITSRQIEAARRV
RK16_PORPU      -MLSPKKTKFRKQHRG---RMK---GSASKGNTIAFGDYALQATEPVWLTSRQIEATRRT
RK16_GRATL      -MLSPKRTKFRKQHRN---RMN---GKASKGNTIAFGEYALQTLEPVWLTARQIEATRRT
RK16_CYAM1      -MLSPKNTKYRKPHLG---RLK---GRASRCNQIAFGDYALQAKERVWLTSRQIEATRRT
RK16_EMIHU      -MLLPKRTKFRKMHRG---RLK---GVATRANTVVFGEFGIQALEPVWLTSRQIEATRRS
RK16_GUITH      -MLSPKRTKFRKPHRG---RLR---GIATRGNTLIFGDYGLQALEPIWLTSRQIEATRRT
RK16_TRICV      -MLSPKRTKYRKYHRG---RMR---GKATRGNEVTFGDYGLQALEPTWITSRQIEAARRT
RK16_HELSJ      MIYIPKKIRYRKHHRG---RLK---GVASKGNNLFFASCGLQALESSWITSQQMEAARRA
RK16_CHLVU      -MLSPKRTKYRKHHRG---RMR---GKASRGNTVVFGDYALQSLEASWITSRQIEAARRA
RL16_CHLTE      -MLMPKRVQYRKTQRG---RMK---GNAQRGTAVTFGSFGLKAMEPAWITSRQIEAARIA
RL16_CHLCH      -MLMPKRVKYRKTQRG---RMK---GNAGRGTSVAFGSFGLKAMEPAWITSRQIEAARIA
RL16_RUBXD      -MLVPRKLKWRKPQRG---RMK---GRAKGGTEVQFGEYGLQALEPAWITNRQIEAARIA
RL16_DESHY      -MLVPTRVKHRKQHRG---RMH---GKATRGNTITFGEYGLVALEPAWITNRQIEAARIA
RL16_CALS4      -MLMPKRVKYRKQQRG---RIK---GNATRGNTLTYGEYGLQALEPGWITATQIEAARVA
RL16_CLOPE      -MLMPKRVKHRKVQRG---RMK---GKATRGNFLAYGDFGIQATTCGWITSNQIEAARIA
RL16_CLOTE      -MLMPKRVKHRKVQRG---RMK---GKATRGNFIAYGDYGIQATECGWITSNQIESARIA
RL16_CLOAB      -MLMPKRVKHRKVQRG---RMK---GKATRGNFIAYGDFAIQATECAWITSNQIEAARIA
RK16_CYACA      -MLSPKKTKYRKFHRG---RLK---GHATKGSALAFGRYGIQALTSSWITSRQIESVRRV
RL16_AQUAE      MYLQPKKVRWRKQRRG---TLK---GKAFRGNKLAFGEYGIQALDRAWITQQQIEAVRVA
RL16_TREDE      MAFSPKRVKHRKVQRG---RIK---GEATRCNNIDFGDYALVSLEPFLLTNRQIEAARVA
RL16_TREPA      MALSPKRVKYRKVQRG---RVK---GDATRCNAVDFGAYALVCLEPFWLTSRQIEAARVA
RL16_RHOBA      MALMPKRVKHRKSQRG---RIK---GNATRGNTVVFGDYGIQSLDAGWIKATTIEAGRIA
RL16_BORBP      -MLSPKKVKYRKKQRG---RLS---GEAQKGNKISFGEYGLVSLETSFITARQIEAARIA
RL16_DEHMC      -MLQPKRVKFRKVQRG---RRD---GAAHKGNTVAFGEFALQSLEAGWITARQIEATRRA
RL16_CHLPN      -MLMPKRTKFRKQQKG---QFA---GLSKGATFVDFGEYAMQTLERGWVTSRQIEACRVA
RL16_PARUW      MPLMPKRTKHRKMQKG---QFA---GLSKGANFVHFGEYGIQVLERGWITNQQIEACRVA
RL16_FUSNN      -MLMPKRTKHRKMFRG---RMK---GAAHKGNFVAFGDYGLQALEPSWITNRQIESCRVA
RL16_DEIRA      -MLLPKRTKFRKQFRG---RMT---GDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIV
RL16_THET8      -MLMPRRMKYRKQQRG---RLK---GATKGGDYVAFGDYGLVALEPAWITAQQIEAARVA
RL16_THEMA      -MLMPRRVKYRKQQRG---RMK---GKAKGGTFVQFGEWGLKALEPAWITAQQIEACRIA
RL16_LACJO      -MLVPKRVKHRREFRG---KMR---GEAKGGKTIAFGEYGLEAVESHWITNRQIEAARIA
RL16_LACDA      MPLVPKRVKHRREFRG---KMR---GAAKGGKTVAFGEYGLEALESHWITNRQIEAARVA
RL16_ENTFA      -MLVPKRVKHRREFRG---KMR---GEAKGGKEVAFGEWGLQATESHWITNRQIEAARIA
RL16_LISMF      -MLVPKRVKYRREFRG---NMR---GRAKGGTEVAFGEYGLQAVEASWITNRQIEAARIA
RL16_LACS1      -MLVPKRVKHRREFRG---KMR---GEAKGGKEVTFGKYGLKALDSHWITNRQIEAARIA
RL16_LACSS      -MLVPKRVKHRREFRG---KMR---GAAKGGKEVTFGEFGLQALESSWITNRQIEAARVA
RL16_LACPL      -MLVPKRVKYRRVHRG---KMR---GEAKGGKTVAFGDYGLQTLESHWISNRQIEAARVA
RL16_LACLA      -MLVPKRVKHRREFRG---KMR---GYAKGGDTISFGEYGLQATTSHWITNRQIEAARIA
RL16_BACC1      -MLMPKRVKYRREHRG---KMR---GRAKGGTEVAFGEFGLQAQAASWITNRQIEAARRA
RL16_BACSU      -MLLPKRVKYRREHRG---KMR---GRAKGGTEVHFGEFGIQALEASWITNRQIEAARIA
RL16_OCEIH      -MLMPKRVKYRRQHRG---KMR---GQAKGGTTVAFGEYGLQATEASWITSRQIEAARIA
RL16_GEOKA      -MLMPKRVKYRREHRG---RMK---GRAKGGTEVHFGEFGLQALESAWITNRQIEAARRA
RL16_CARHZ      -MLMPKRVKYRRPHRP---SLK---GKAKGGTQLHFGEYGLQAVEGAWITSQQIEAARVA
RL16_SYMTH      -MLAPKRVKWRRVHKA---VAKLNKGRSKAGNEVVFGDYGLQALEPAFITDRQIEAARVA
RL16_MOOTA      -MLMPKRVKYRKPHRP---GTQ---GKATRGNEVTFGDYGLQALEPAWITSRQIEASRIA
RL16_CORJK      -MLIPKRVKYRRQHRP---HRS---GVSKGGNRVTFGDYGLQALEPTYITNRQIESARIA
RL16_CORGL      -MLIPKRVKYRRQHRP---TRS---GISKGGNRVTFGEYGIQALEPAYITNRQIESARIA
RL16_STAS1      -MLLPKRVKYRRQHRP---KTT---GRSKGGNYVTFGEYGLQATTTSWITSRQIESARIA
RL16_FRACC      -MLIPRKVAHRKQHHP---GRT---GAAKGGTRVTFGEYGIQALESAYVTNRQIESARIA
RL16_THEFY      -MLIPRKVKHRKQHHP---SLR---GRAKGGTSVHFGEYGIQALESAYVTNRQIEAARIA
RL16_NOCFA      -MLMPRKVKHRKQHHP---SRT---GMAKGGTSVAFGDYGIQALEPAYVTNRQIESARIA
RL16_STRCO      -MLIPRRVKHRKQHHP---KRR---GMAKGGTQVAFGEYGIQALTPAYVTNRQIEAARIA
RL16_MYCPA      -MLIPRKVKHRKQHHP---RQR---GIASGGTAVNFGDYGIQALEHAYVTNRQIESARIA
RL16_LEIXX      -MLIPRRVKHRKQHHP---GRS---GQATGGTKVSFGEFGIQALTPAYVTNRQIESARIA
RL16_TROWT      MMLIPKKVKFRKQHRP---NRK---GMSGCGTRIVFGDYGIQALSRAYVTNRQVESARIA
RL16_CUTAK      -MLIPRRVKYRKQHHP---KRT---GAAKGGTQLAFGDYGIQATEGGYLTNRQIEAARIA
RL16_BIFLO      -MLIPKRTKYRKQHRP---VRS---GMSKGGNEINFGDFAIQSLAPAYVTNRQIEAARIA
RL16_MYCMS      -MLQPKRTKYRKPHRV---SYE---GKAKGVKEINFGEFGLMALDGAWIDNHQIEAARIA
RL16_MESFL      -MLLPKRTKYRKPHKV---SFK---GKAKGAKTINFGEYGLMSLDGAWIDNRQIEAARIA
RL16_SPIKU      -MLLPKRTKYRRPHRI---KYE---GKAKGNTKVDFGEFGLKSLDGAWITNRQIEAARIA
RL16_MYCPN      -MLQPKRTKYRKPHNV---SYE---GKAKGNSYVAFGEYGLVATKGNWIDARAIESARIA
RL16_MYCGA      -MLQPKRTKYRKPHNV---SYE---GKAKGNSYVAFGEYGIMATNGAWIDARQIESARIA
RL16_MYCPE      -MLEPKRTKYRRPHKV---SYE---GKAKGNKYVAFGEFGLMATNGAWISNRQIESARIA
RL16_UREPA      -MLQPKRTKFRKPHKV---SYE---GKAKGNKQVDFGEFGLMALEGAWIDARQIESARIA
RL16_ONYPE      -MLMPKRTKYRRPHRV---SFE---GKSKGKNVIANGNHALVAKEGAFITNKQIEAARIA
RL16_MYCPU      -MLQPKRTKHRKMFRI---RHDK--KDAFKGNKVSFGEYGLQATTSAWITARQIESARIA
RL16_MYCS5      -MLQPKRTKYRKPFLQ---SHDK--RKAHKGNKVSFGSHGLQAVTSAWVDSRQIESARIA
RL16_MYCHJ      -MLQPKKTKHRKTFRL---YHDK--RDAHSGNFVAFGDYGLQATGSAWVSAAQIEAARIA
RL16_MYCMO      -MLQPKRTKYRRTHRL---QHDK--GEAHTGNKVSFGKFGLQAKTSAWITARQIESARIA
                    *      :                     .  .           :    :*: *  

RL16_GEOMG      MTRYIKRGGKIWIRMFPDKPLTSKPAETRMGKGKGSPDSWVCVVKPGKVLYEMEG--VSE
RL16_GEOSL      MTRYIKRGGKIWIRLFPDKPLTSKPAETRMGKGKGSPDSWVCVVKPGKVLYEMEG--VTE
RL16_PELCD      MTRHVKRGGKIWIRIFPDKSLTKKPAETRMGKGKGSPDSWVAVIKPGMMLYEMQG--VDK
RL16_SYNAS      ITRHVRRGGKIWIRIFPHKSITKKPAETRMGKGKGAPEEWVAVVKPGTVLYEMQG--VSK
RL16_BDEBA      ISRSVKRGGKIWCRVFPNIPVTKKPAETRMGSGKGNPELWVARVLPGKVLFEMNG--VTR
RL16_MYXXD      MTRHVKRGGKIWIRIFPDKPITKKPAETRMGTGKGGVEYYVAVVKPGRILYEMEG--MTP
RL16_ECOLI      MTRAVKRQGKIWIRVFPDKPITEKPLAVRMGKGKGNVEYWVALIQPGKVLYEMDG--VPE
RL16_YERPS      MTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFEMAG--VPE
RL16_HAEI8      MSRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDG--VSE
RL16_PHOPR      MTRHVKRQGQIWIRVFPDKPITSKPLEVRQGKGKGNVEYWVAQIQPGKVLYEMDG--VPE
RL16_SHEON      MTRHIKRQGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYEMNG--VSE
RL16_VIBPA      MTRHVKRQGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVAQIQPGKVMYEMGG--VPE
RL16_BUCAK      ITRAIKRQGQVWIRVYPDTPVTEKPLEVRMGNGKGNVEYWVSKIQPGKVLYEIDG--VPE
RL16_BAUCH      ITRAIKRQGKIWIRIFPDKPITEKPLEVRMGKGKGNVENWVALIKPGKILYEIDG--VTE
RL16_BLOFL      ITRAIKRQGKVWIRIFPDKPITQKPLEVRMGKGKGNVEYWVALVQPGKILYEMSG--VSK
RL16_BLOPB      ISRAIKRQGKIWIRVFPDKPITKKPLEVRMGKGKGNVEYWVALIQPGKILYEING--VPK
RL16_BUCAI      ITRCIKRQGKMWIRIFPDKPITQKPLEVRMGKGKGNVEYWVALVQPGKILYELEG--VTE
RL16_BUCAP      ITRYIKRQGKIWIRVFPDKPITQKPLEVRMGKGKGNVEYWVALIQPGKILYEMDG--VSE
RL16_BUCBP      ITRAIKRQGKIWIRIFPDKPITKKPLEVRMGKGKGNVEYWVALVQPGKILYEISG--VSE
RL16_WIGBR      MSRSIKRQGKIWIRVFPDKPITKKPLEVRMGKGKGNVEYWVALIQPGKILYEIDE--VSE
RL16_CHRSD      ITRHVKRGGKIWIRVFPDKPITEKPLEVRMGKGKGSVEYWVAQIQPGKVLYEIEG--VSE
RL16_SACD2      MTRHVKRGGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVCQIQPGKVLYEMEG--VSE
RL16_PSEAE      LTRHVKRGGKIWIRVFPDKPVTKKPLEVRMGKGKGGVEYWVAQIQPGKVLYEIEG--VSE
RL16_LEGPH      MTRHIKRGGKIWIRVFPDKPITQKPLEVRQGKGKGSVEYWVAQIQPGKVLFEMEG--VSK
RL16_IDILO      MTRHVKRQGKIWIRVFPDKPITKKPLEVRMGKGKGNVEYWVAQIQPGRVLYEMDG--VPE
RL16_PSEHT      MTRHVKRQGKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAEIQPGKVLYEMEG--VSE
RL16_COLP3      MTRHVKRQGKIWIRVFPDKPITKKPLEVRMGKGKGSVEYWVCQILPGRVLYEMEG--VSE
RL16_HYDCU      MTRKVKRGAKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAQVQPGRVLYEMQG--VDE
RL16_FRATT      ISRHIKRGGKIWIRIFPDKPITQKPLEVRMGKGKGSVEYWVAQIQPGRVLYEITG--VKE
RL16_NITOC      MTRHIKRGGKIWIRIFPDKPITQKPLEVRQGKGKGGVEFWAANIQPGRVLYEMEG--VPE
RL16_DECAR      MTRHIKRGGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMDG--VNE
RL16_THIDA      MTRHIKRGGRIWIRIFPDKPISRKPAEVRMGNGKGAPEYYVAEIQPGKVLYEMDG--VNE
RL16_BORA1      INRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEG--VSE
RL16_RALSO      MTRHIKRGGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDG--VGE
RL16_AROAE      MTRHIKRGGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMDG--VDE
RL16_NITMU      MTRHIKRGGRIWIRIFPDKPISHKPAEVRMGNGKGNPEYFVAEIQPGKVLYEMDG--VDE
RL16_METFK      MTRHIKRGGRVWIRVFPDQPISKKPAEVRMGNGKGSTEYYIAQIQPGKMLYEMDG--VSE
RL16_NITEU      MTRHIKRGGRIWIRVFPDKPVSQKPAEVRMGKGKGNPEYYVAEIQPGKMLYEMDG--VDE
RL16_NEIMB      MTRHIKRGGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEIKPGKVLYEMDG--VPE
RL16_CHRVO      MTRHIKRGGRIWIRIFPDKPITSKPAEVRMGGGKGSPEYYVAEIQPGKMLYEMDG--VSE
RL16_RHOFT      ISRHVKRGGRIWIRVFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVG--VPE
RL16_HAHCH      MTRRIKRGGKIWIRIFPDKPITKKPLEVRMGKGKGPVEYWVAEIEPGRMLYEMEG--VSE
RL16_METCA      ISRHVKRGGKIWIRVFPDKPVSKKPLEVRMGSGKGSVEFWVAEIKPGTMLYELEG--VSE
RL16_PSYA2      ITRKIKRGGKIWIRVFPDKPITNKPLEVRMGKGKGPVEYWVCEIKPGKILYELEG--ISE
RL16_ACIAD      ISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPGKILYEIEG--VND
RL16_XANC8      ISRHVKKGGKMWIRVFPDKPITKKPIEVRMGSGKGNVEYWVAQIQPGRMIYEIEG--IPE
RL16_XYLFT      ISRYVKRGGKLLIRVFPDKPITKKPIEVRMGSGKGNVEYWVAQIQPGRMIYEIEG--VSE
RL16_COXBU      IARHIKRGGKITIRIFPDKPITKKPLEVRQGKGKGSVEYWVALVQPGRMIFEIEG--VDE
RL16_HELHP      MTRHIKRAGKVWIRVFPDKPLTAKPLETRMGKGKGGVEKWVMNIKPGRLIYEMAG--IDE
RL16_WOLSU      MTRHIKRAGKIWIRVFPDKPLTAKPLETRMGKGKGSVDKWVMNIQPGRIVYEMAG--IEE
RL16_HELPJ      MTRHIKRAGKVWIRVFPDKPLTAKPLETRMGKGKGSVEKWVMNIKPGRIVYEMLG--IEE
RL16_SULDN      ATRHIKRNGKIWIRVFPAKPLTAKPLETRMGKGKGSVDQWVMNIKPGRIIFEMAG--VPE
RL16_CAMJR      LTRFVKRQGKTWIRVFPDKPLTKKPLETRMGKGKGAVEEWVMNIKPGRIIYEMAG--VSE
RL16_DESAG      AMRHIKRGGKMWIRIFPDQPYTAKPLETRQGKGKGAPVGWYAPVKPGRVLYEIKG--VNL
RL16_DESVH      MMRHIKRGGKVWIRIFPDRPVTAKPLETRQGSGKGSPVGWCAPVKPGRVLYEIKG--VSL
RL16_LAWIP      MMRHIKRGGKVWIRVFPDHPITAKPLETRQGSGKGSPVGWCAPVKPGRILYEIKG--VNI
RL16_LEPIC      INRQVKRGGKLWIRIFPHTPITKKPAETRMGKGKGNPEFWIAEIRPGRILFEMSG--IDE
RL16_DESPS      INRTMKRGGQVWIRVFPDKPLTKKPAETRMGKGKGSPESWVAIVKPGRLLYEVAG--VSE
RL16_EHRCJ      ISRTLKRVGKVWIRAFCHTSVSKKPMDVRMGKGKGSVEMWVCKVKPGKILFEISG--VSL
RL16_EHRRW      ISRTLKRVGKVWIRVFCHTPVSKKPMDVRMGKGKGSIEMWVCKVKPGKILFEISG--VSL
RL16_ANAMM      ISRSLRRVGKVWIRVFCHLPVSKKPVDVRMGKGKGSIEMWVCRVQPGRVLFEIGG--VSS
RL16_WOLPM      ISRTLKRSGKVWIRIFPDTPVSKKPADVRMGKGKGSVEFWVFKAKPGRMLFEISSD-VPM
RL16_WOLTR      ISRTLKRSGKIWIRIFPDTPISKKPTDVRMGKGKGSVEFWVFKAKPGRVLFEISSD-VPM
RL16_NEOSM      ITRIVSKAGKLWINVFPGIPLTRKPTDVRMGGGKGSVDSYIFAISPGRVLFELGG--VDR
RL16_RUEPO      MTRHMKRQGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWACKVKPGRVMFEIDG--VND
RL16_ROSDO      MTRHMKRQGRVWIRIFPDVPVTAKPIEVRMGKGKGSVDRWAAKVKPGRVMFEIDG--VND
RL16_RHOS4      ITRHMKRQGRVWIRVFPDVPVTSKPTEVRMGKGKGSVDYWAAKVKPGRIMFEIDG--VSE
RL16_BRUSU      ITRHMKRAGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWACRVAPGRVMFELDG--VPE
RL16_CHESB      ITRQMKRQGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEFWACRVKPGRIMFEIDG--VAE
RL16_BARQU      ITRYMKRSGRVWIRIFPDLPVTSKPTEVRMGKGKGGVEYWAARVAPGRIIFEIDG--VLE
RL16_CAUVC      ITRQMKRQGRVWIRIFPDVPVTGKPAEVRMGKGKGAVDYWAARVAPGRIMFEIDG--VPD
RL16_RHIME      ITRHMKRAGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDG--VNE
RL16_RHILO      ITREMKRAGRVWIRIFPDLPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMFEIDG--VSE
RL16_NOVAD      ITRHIRRQGRLWIRVFPDVPVSKKPAEVRQGKGKGSIEYWAARVKPGRILFELDG--VPG
RL16_SPHAL      ISRAIKRQGRLWIRIFPDVPVSSKPAEVRMGKGKGSPEYWAARVKPGRILFELDG--VPG
RL16_ZYMMO      ITRHIRRQGRLWIRIFPDVPVSSKPAEVRMGSGKGSPEFWVARVKPGRILFELDG--VPG
RL16_RHORT      ITRHMKRQGRLWIRIFPDVPVSKKPAEVRMGSGKGSPEFWVARVKPGRVMFELDG--VPE
RL16_MAGSA      LTRHMKRQGRVWIRIFPDLPVSSKPAEVRMGSGKGAPEFWTARVAPGRILFEVDG--VAE
RL16_GLUOX      ITRAMKRAGRVWIRIFPDTPVSTKPAEVRMGSGKGNPEYWAARVKPGRILFEIEG--VPP
RL16_RHOPA      LTRHMKRAGRVWIRVFPDLPVSKKPAEVRMGSGKGSPELWVARVKPGRVMFEIDG--VNQ
RL16_PELUB      LTRHMKRQGRVWTRIFPNIPVSKKPVEVRMGKGKGAPEYWACRVKPGRILFEIDG--VSE
RL16_RICBR      ATRCMKRQGRLWIRIFPDLPVSKKPAEVRMGKGKGNPEFFAVRVSPGRIMFEIEG--VEE
RL16_BACTN      VTRYMQRQGQIWIRIFPDKPITRKPADVRMGKGKGAPEGFVAPVTPGRIIIEAEG--VSY
RL16_PORGI      VTRYMQRQGQVWVRIFPDKPITKKGEGVRMGKGKGAPEGFVAPITPGRIIFEVEG--VPY
RL16_SALRD      INRYLKRDGKVWIRVFPDKPKTKTPAETRMGKGKGEPEHFVAPVQPGNVIFEVGGG-ADE
RL16_SYNSC      MTRYVKRGGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGDEITP
RL16_SYNPX      MTRYVKRGGKIWIRIFPDKSITMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGAEITP
RL16_PROMM      MTRYVKRGGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILFEMGGAEITE
RK16_PAUCH      MTRYVKRGGRIWIRVFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGPEITE
RL16_PROMA      MTRYVKRGGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEEITE
RL16_PROMT      MTRYVKRGGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGDEITE
RL16_PROM9      MTRYIKRGGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGDDITE
RL16_PROMP      MTRYVKRGGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEEITE
RL16_SYNP6      MTRYTRRGGKIWIRIFPDKPITMRPAETRMGSGKGNPEFWVAVVKPGRVLFEIGG-EVAE
RK16_CYAPA      INRYVRRGGKIWIRIFPDKPVTMRPAETRMGSGKGAPEYWVAIVKPGRVIFEING--VSQ
RL16_MICDP      MTRYIRRGGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEIAG--VSE
RL16_SYNY3      MTRYIRRGGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRVMFELAG--VSE
RL16_THEEB      MTRYIRRGGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRIMYEIAG--VTE
RL16_GLOVI      MTRYIRRGGKIYIRVFPDKPVTQRAAETRMGSGKGAPEYWVCVVKPGRILFEIDG--VAE
RL16_SYNJA      MARYVRRGGQIWIRIFPDKPVTQRPAETRMGSGKGNPEYWVCVVKPGRILFEMGG--VPE
RL16_SYNJB      MTRYVRRGGQIWIRIFPDKPVTQRAAETRMGSGKGNPEYWVCVVKPGRILFEMGG--VAE
RK16_CHAVU      MTRYARRGGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRILYEMDG--VPE
RK16_CHAGL      MTRYARRGGKIWIRIFPDKPVTMRAAETRMGSGKGSPEFWVAVVKPGRILYEMSG--VSE
RK16_SPIMX      MTRYARRGGKLWIKIFPDKPITMRPAETRMGSGKGAPEYWVAVVKPGRILYEMSG--ISE
RK16_STAPU      MTRYARRGGKLWIRIFPDKSITMRPAETRMGSGKGAPEYWVAVVKPGRILYEMSG--VSE
RK16_POPAL      MTRNVRRGGKIWVRIFPDKPVTLRPSETRMGSGKGSPEYWVAVVKPGRMIYEMGG--VAE
RK16_OENEH      MTRNVRRGGKTWVRIFPDKPVTLRAAETRMGSGKGNPEYWVAVVKPGRILYEMGG--VAE
RK16_ARATH      MTRNVRRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGKILYEMGG--VPE
RK16_SPIOL      MTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEISG--VAE
RK16_NICTO      MTRNARRGGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGG--VTE
RK16_EPIVI      ITRKFRRGGKIWVRVFPDKPVTVRSSETRMGSGKGSHKYFVAVVKPGLILYEIGG--VTE
RK16_CALFG      MTRYARRGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGG--VSE
RK16_WHEAT      ITRYARRGGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVSVVKPGRILYEMGG--VSE
RK16_PHAAO      MTRYARRGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRIIYEMSG--VSE
RK16_AMBTC      MTRYARRGGKIWVRVFPDKPITVRPAETRMGSGKGSPEYWVSVIKPGRILHEMGG--VPE
RK16_NYMAL      ISRYARRGGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVSVVKPDRILYEMGG--VSE
RK16_LANPU      ISRYARRGGKIWVRLFPDKRVTLRPAETRMGSGKGSPEYWVSVVKPGRILYEIGG--VSE
RK16_PINTH      INRYARRGGKIWVRIFPDKPITMRPAETRMGSGKGSPEYWVSVIRPGRILYEMGG--VSE
RK16_HUPLU      ITRYARRGGKIWIRIFPDKPITVRPAETRMGSGKGSPEYWVSVVKPGRILYEVGG--IPE
RK16_ANTAG      ISRYARRGGKIWIRIFPDKPVTMRPAETRMGSGKGSPEFWVSVVKPNRILYEIGG--VPE
RK16_PHYPA      ITRYARRGGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVVKPGRILYEISG--VPE
RK16_MARPO      ITRYARRGGKLWIRIFPDKPITIRPAETRMGSGKGSPEYWVAVVKPGKILYEISG--VSE
RK16_ZYGCR      ITRYARRGGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVAVVKPGRILYEMSG--VSE
RK16_PSINU      IARYARRGGKMWIRIFPDKPITMRPAETRMGSGKGSPEYWVAVVKKGRILYEING--VSE
RK16_ADICA      ITRHARRGGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVIKPGRIIYELGG--VSK
RK16_OLTVI      LTRYVRRTGKLWIRIFPDKPITMRPADTRMGKGKGAPEFWVAVVKPGTMIYEITG--VTE
RK16_TUPAK      LTRYVRRNGKLWVCLFPDKPVTMRAAESRMGSGKGMPEYWVAVVKPGKILYELTG--LTE
RK16_CHLSP      LTRYVRRGGKLWIRIFPDKAVTMRPAGTRMGSGKGAPDYWVAVVHPGKILYEMQG--VSE
RK16_TETOB      LTRYVRRTGKLWIRIFPDKPITMRPAGTRMGSGKGFPEYWVAVVHPGKILYEIQG--VSE
RK16_OSTTA      MSRYAKRGGKLWIRMFPDRSITARAAETRMGAGKGAPDYWVCIVKPGKILYELAG--VPE
RK16_NEPOL      MTRYARRGGKIWIRIFPDKAITMRPAETRMGSGKGSPEYWVAVVKAQKILFEMKG--VPE
RK16_MESVI      MTRYTRRGGQLWIRVFPDKPVTIRPAETRMGSGKGSPEYWVAVVKPGTILYEMKG--VTP
RK16_EUGLO      ITRYSKKGGKLWIRIFPDKPITFRPAETRMGSGKGNVEYWVAVIKPGKIICEISG--IPN
RK16_EUGGR      ITRYAKRGGKLWIRIFPDKPVTFRAAETRMGSRKGNVEYWVAIVKPGKILYEVLG--ISE
RK16_PORPU      ITRYVRRGGKLWIRVFPDKPVTARPAETRMGSGKGAPEYWVAVIKPGHILFEITG--VPQ
RK16_GRATL      ITRYVKRGGKIWIRVFPDKPITARPAETRMGSGKGATEYWVAVIKPGHILFEIAG--VSK
RK16_CYAM1      LTRYMKRGGKLWIRVFPDRAVTAKPAETRMGSGKGAPEYWAAPVRPDQILFELKG--VPF
RK16_EMIHU      ITRYVRRTGKIWIRVFPDRSVTERAAESRMGAGKGAVSYWVAVVKPGTVLFEING--LSE
RK16_GUITH      ITRQVKRVGRLWIRVFPDKSISAKPPETRMGAGKGAPEYWVAVIKPGHILFEING--VSQ
RK16_TRICV      ITRYTKRGAALWIRIFPDKTVTARAAESRMGSGKGAVDYWVAVVKPGTILFEIAS--VPE
RK16_HELSJ      CTRKVKRHGKLFMRFFPDKPVTYRSAETRMGSGKGTPRDWVAVIKPGKILYELKG--IPE
RK16_CHLVU      MTRQVRRGGQIWIRLFPDKPVTMRPAETRMGSGKGAPEFWVAVVRPGKVLYELKG--VPE
RL16_CHLTE      MNRYMKRDGKIWIRIFPDKPVSKKPAETRMGSGKGSPEFWVAVVKPGRVMFEADG--VPR
RL16_CHLCH      MTRYMKRDGKVWIRIFPDKPVTQKPAETRMGSGKGSPEFWVAVVKPGRVMFEADG--VSK
RL16_RUBXD      MTRKIRRGGKVWINIFPHKPVTKKPAETRMGSGKGSPEEYVAVVKPGRVMFEMSG--VGE
RL16_DESHY      MTRYIKRGGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRVMFELAG--VPE
RL16_CALS4      MTRYIKRGGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLFEIGG--VSE
RL16_CLOPE      INRYIRRGGKLWIKIFPDKPVTEKPAETRMGSGKGSVEYWVAVVKPGRVLFELSG--VDE
RL16_CLOTE      INRYIRRGGKLWIKIFPDKPVTQKPAETRMGSGKGTPEYWVAVVKPGRVLFELTG--VDE
RL16_CLOAB      INRYVKRGGKLWIKIFPDKPVTQKPAETRMGSGKGSPEYWVAVVKPGRVLFEMSD--VTE
RK16_CYACA      IVRHLKRGGKLWIRIFPDKAVTAKPLETRMGSGKGSPEHWIAVVKSGHILFEIDG--VSL
RL16_AQUAE      LVRSLKKGAKVWIRIFPDKPYTKKPNEVRMGGGKGDPEGFVAVVKPGRILFEFTG--VPE
RL16_TREDE      LNRKIKRGGKLWIRVFPDKPYSKKPAEVRMGGGKGAPEYWVAVVKPGTIIFELAG--VDK
RL16_TREPA      LNRRIKRGGKLWIRVFPDKPYSKKPAETRMGKGKGSPEYWVAVVKPGTVLFELMG--VER
RL16_RHOBA      AQQYVRGQGKLYIRIFPDKSVTSTPLETRMGKGKGEPDFWAAVVKPGTILYELSG--VTE
RL16_BORBP      MTRKIKRGGRVWIRIFPDIPYTKKPAETRMGKGKGGVDHWNAPVKLGTVMFEMAG--VIE
RL16_DEHMC      ITRYIRRGGQVWIRIFPDKPITKKPAETRQGGGKGAPEEWVAVVRRGRIMFEIGG--VTP
RL16_CHLPN      INRYLKRRGKVWIRIFPDKSVTKKPAETRMGKGKGAPDHWVAVVRPGRILFEVAN--VSK
RL16_PARUW      INRFFQRRGKVWIRIFPDKPITKKPAEVRMGKGKGAVDHWVAVVRPGRILFEVAN--VPK
RL16_FUSNN      INRTFKREGKTYIRIFPDKPITARPAGVRMGKGKGNVEGWVSVVRPGRILFEVSG--VTE
RL16_DEIRA      MSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAG--VTE
RL16_THET8      MVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAG--VTE
RL16_THEMA      MLRVMKRSGKIWIRIFPDKPYTKKPPESRMGKGKGNVEGWVAVVKPGKILFEVAG--VDE
RL16_LACJO      MTRFMKRGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKRGKIMFEIGG--VSE
RL16_LACDA      MTRYMKRGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGG--VSE
RL16_ENTFA      MTRYMKRGGKVWIKIFPHKSYTSKAIGVRMGKGKGAPEGWVSPVKRGKIMFEIAG--VPE
RL16_LISMF      MTRYMKRGGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGKIMFEIAG--VPE
RL16_LACS1      MTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVLFEIDG--VSE
RL16_LACSS      MTRYMKRGGKVWIKIFPHKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGG--VSE
RL16_LACPL      MNRYMKRGGKVWIKIFPHKSYTEKGVGVRMGNGKGTPAGWVAPVKRNKIMFEVAG--VPE
RL16_LACLA      MTRYMKRNGQVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGVVMFELGG--VDE
RL16_BACC1      MTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAG--VSE
RL16_BACSU      MTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLFEISG--VSE
RL16_OCEIH      MTRYMKRGGKVWIKIFPDKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAG--VSE
RL16_GEOKA      MTRYMRRGGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEVGG--VSE
RL16_CARHZ      ISRYIRRGGKIWINIFPDHPITRKPAETRMGSGKGAPEYWVAVVKPGKIMFELAG--VSE
RL16_SYMTH      MTRFIKRGGKVWIKIFPHKALTRKPAEVRMGSGKGAPEVWVAVVKPGRILFELAG--VDE
RL16_MOOTA      MTRYIKRGGKVWIKIFPDTPITAKPAETRMGSGKGAPEYWVAVVKPGRILFEMAG--VSE
RL16_CORJK      INRHMKRGGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWVANVKPGRILFEASY--PNE
RL16_CORGL      INRHVKRGGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWVANIKPGRILFEMSY--PDE
RL16_STAS1      MTRFMKRGGKVWIKIFPHTPYTQKPLEVRMGAGKGAVEGWIAVAKPGRILFEIAG--VNE
RL16_FRACC      MTRHIRRGGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSG--VAE
RL16_THEFY      MTRHIRRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVAPVKAGRVMFELAG--VPE
RL16_NOCFA      MTRHIRRGGKIWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFEMSY--PNE
RL16_STRCO      MTRHIKRGGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVHPGRVMFELSY--PNE
RL16_MYCPA      INRHIKRGGKVWINVFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPGRVLFELSY--PNE
RL16_LEIXX      MTRHIKRGGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFEVSG--VSE
RL16_TROWT      MTRHIRRGGRVWINIYPDRPLTKKPAETRMGSGKGSPEYWVANIRPGRIMFEVSG--VSE
RL16_CUTAK      MTRYIKRGGKVWINVYPDRPMTKHPAESRMGSGKGTPEWWIANIKPGRVLFELSG--VPE
RL16_BIFLO      MTRYIKRGGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANVRPGRVMFEIGG--VSE
RL16_MYCMS      MTRYMKRDGKIWMRIFPHMAMTKKPAEVRMGSGKGNPEKWVAVVKKGTIMFEVAQ--VNE
RL16_MESFL      MTRYMRRDGKVWMRIFPHISMSKKPAEVRMGSGKGNPEKWVAVVKEGTVMFEIAG--VSE
RL16_SPIKU      MTRYMKRWGKVWIRIFPHMAKTKKPLEVRMGSGKGSPEEWVAVVKTGTVMFEVAG--VSE
RL16_MYCPN      ISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKQGTVMFEVAN--IPE
RL16_MYCGA      ISKQLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKEGTVMFEVAN--IPE
RL16_MYCPE      ISKALGKTGKMWIRIFPHLSLTKKPLEVRMGSGKGSPEKWVAVVKAGTVMFEVAN--IPE
RL16_UREPA      ISKRLLKTGKMWIRIFPHMSLTKKPLEVRMGSGKGSPEKWVAVVKAGTVMFEIAN--VSE
RL16_ONYPE      MTRYMKRTGKVWINIFPHLSLTKKPLEVRMGSGKGSPEEWVAVVKTGKVLFEVKD--TTN
RL16_MYCPU      ATRRMGREGQVIIRIFPHLSKTSKPIGVRMGSGKGSPEKWYSVVKRQTMMFEVSG--IKP
RL16_MYCS5      ATRSLGREGNVIIRIFPHFSKTSKPIGVRMGSGKGSPEKWYTPVKVNTVVFEIQG--VSA
RL16_MYCHJ      ITRRMGREGQVIIRVFPHLALTSKPIGVRMGSGKGSVDRWVAVVKRNTILFEVRG--VKD
RL16_MYCMO      ITRYMGREGQVFIRIFPQLSLTSKPIGVRMGKGKGSPEKWVAVAKVNTMLFEVSG--VKD
                  :     .      :     :      * *  **    :        :: *        

RL16_GEOMG      E--IAREAFRLAANKLPVGTKFISRKE-GYES----------------------------
RL16_GEOSL      E--IAREAFRLAAHKLPVGTKFISRKD-GHES----------------------------
RL16_PELCD      E--VACEALRLAAHKLPMKTKIVVREDVANES----------------------------
RL16_SYNAS      E--VAREAFRLASHKLPIGTRFLSRELTDEG-----------------------------
RL16_BDEBA      E--QAKEAFERAAHKLPFKTRFLVRE----------------------------------
RL16_MYXXD      E--VATGALKLAQAKLPVLTKIVKRADLSL------------------------------
RL16_ECOLI      E--LAREAFKLAAAKLPIKTTFVTKTVM--------------------------------
RL16_YERPS      E--TAREAFKLAAAKLPVGTTFVTKTVM--------------------------------
RL16_HAEI8      E--VARNAFALAAAKLPVKTTFVTKTVM--------------------------------
RL16_PHOPR      V--LAREAFNLAARKLPIKTTFVIKAVM--------------------------------
RL16_SHEON      V--IAREAFALAAAKLPIKTTFVTKTVM--------------------------------
RL16_VIBPA      E--LAREAFRLAARKLPFKTTFVTKQVM--------------------------------
RL16_BUCAK      E--AAREAFALATSKLPLRTTFVTKTVM--------------------------------
RL16_BAUCH      E--LAREALRLAAAKLPMKTTFANKMILS-------------------------------
RL16_BLOFL      E--LADHAFKLGSSKLPVRTVVTGI-----------------------------------
RL16_BLOPB      E--LAYNAFKLGASKLPVKTTLIGR-----------------------------------
RL16_BUCAI      E--ESRAAFKLAAAKLPIKTTFVNKMVM--------------------------------
RL16_BUCAP      E--ESREAFKLAAAKLPIKTTFVTKMVM--------------------------------
RL16_BUCBP      E--LSRIAFKLAAAKLPVKTMFVTKLVM--------------------------------
RL16_WIGBR      T--IARYAFKLATAKLPITTTFVNKMVM--------------------------------
RL16_CHRSD      E--LAREAFDLAAQKFPVSTTFVKRTVM--------------------------------
RL16_SACD2      E--LAREAFTLAAAKLPVTTTFVKRSVM--------------------------------
RL16_PSEAE      E--LAREAFALAAAKLPLATSFVKRTVM--------------------------------
RL16_LEGPH      E--LAMEAFDLAKAKLPFKVMFEERTVM--------------------------------
RL16_IDILO      E--LAREAFRLAARKLPFKTTFVTRTVM--------------------------------
RL16_PSEHT      E--LAREAFDLAARKLPFKTTFVTRTVM--------------------------------
RL16_COLP3      E--IAREAFALAASKLPFKTTFVTRTAL--------------------------------
RL16_HYDCU      V--VAREAFELAAAKLPFKTQFVTRTVM--------------------------------
RL16_FRATT      E--LAREAFARAAAKMPVQTTFVEKQVM--------------------------------
RL16_NITOC      G--VARRAFELAAAKLPIKTVFVTRAIM--------------------------------
RL16_DECAR      A--LAREAFALAAAKLPIPTTFVTRHLG--------------------------------
RL16_THIDA      Q--LAREAFRLAAAKLPIATTFVTRLIGS-------------------------------
RL16_BORA1      E--LAREAFRLAAAKLPISTTFVARHIGA-------------------------------
RL16_RALSO      E--LAREAFRLAAAKLPIATSFVVRQVGT-------------------------------
RL16_AROAE      T--LAREAFRLAAAKLPLETVFVHRQMG--------------------------------
RL16_NITMU      V--LARQAFRLAAAKLPILTTFVVRQVGG-------------------------------
RL16_METFK      E--LAREAFRLAAAKLPIETTFITRHIGS-------------------------------
RL16_NITEU      S--LAREAFRLAAAKLPMQTTFVIRHLGS-------------------------------
RL16_NEIMB      E--LAREAFELAAAKLPIPTTFVVRQVGQ-------------------------------
RL16_CHRVO      E--LAREAFRLAAAKLPIATVFVTKQVGQ-------------------------------
RL16_RHOFT      E--LAREAFRLAAAKLPLRTTFVARMIGQ-------------------------------
RL16_HAHCH      E--LAREAFTLAAAKLPVATTFVTRTVM--------------------------------
RL16_METCA      E--LAREAFRLAAAKLPVQTTFSLRTVM--------------------------------
RL16_PSYA2      E--LAREALTLAASKLPFKTTIVKRTIM--------------------------------
RL16_ACIAD      E--LATQAFKLAAAKLPFKTTIVTRTVM--------------------------------
RL16_XANC8      D--IAREAFRLAAAKLSVTTTFVTRTVR--------------------------------
RL16_XYLFT      D--VAREAFRLAASKLSVTTAFVVRTVR--------------------------------
RL16_COXBU      A--LAREAFSRAAAKLPLKCLFVKRTVM--------------------------------
RL16_HELHP      A--LAREALALAQSKLPFKTKIITSESENEIY----------------------------
RL16_WOLSU      E--LAREALALAQSKLPFKTKIVTSESENEIY----------------------------
RL16_HELPJ      G--LAREALALSQSKLPFKTKIVTCESENEIY----------------------------
RL16_SULDN      E--LAREALTLALHKLPFKTKIITAEMSNEIF----------------------------
RL16_CAMJR      E--MAREALTLAMHKLPFKTKFVTRESQNEIY----------------------------
RL16_DESAG      E--LAREALTRAAHKLPVKTTIVVREGL--------------------------------
RL16_DESVH      E--LAKEALTRAAHKLPVKTVIVVREGV--------------------------------
RL16_LAWIP      D--LAREALIRAAHKLPVKTVIVLKERL--------------------------------
RL16_LEPIC      E--TAKKALSLASYKLPIHTEFVKRSAL--------------------------------
RL16_DESPS      D--VAIKALSLASNKLPFPCKVVTRRTTL-------------------------------
RL16_EHRCJ      N--LAREALNKAQAKLPMKCKFVSDEL---------------------------------
RL16_EHRRW      N--LAKEALQKSQAKLPVKCKFISDEL---------------------------------
RL16_ANAMM      V--LAREALRKASAKLPMRCSYIEDGLR--------------------------------
RL16_WOLPM      H--LARLALEKATAKLPMKCKFVSNHN---------------------------------
RL16_WOLTR      H--LAKLALEKAMAKLPVKCKFISNYS---------------------------------
RL16_NEOSM      E--KAKLALCKASAKLPFSTKFVERVSCEL------------------------------
RL16_RUEPO      E--IAREALRLAAMKLPIKTRVVVREDW--------------------------------
RL16_ROSDO      D--VAREALRLAAMKLPIKTRVVVREDW--------------------------------
RL16_RHOS4      T--IAREALRLGAMKLPVMTRIVVREDW--------------------------------
RL16_BRUSU      D--VAREALRLGAAKLPIKTRFIQRIAE--------------------------------
RL16_CHESB      D--IAREALRLGAAKLPIKTRFIQRIAE--------------------------------
RL16_BARQU      D--VAREALRLGAAKLPIKTRFIQRLAE--------------------------------
RL16_CAUVC      D--IAREALRLGAAKLPIRTRVVTRIDAGVAQEA--------------------------
RL16_RHIME      E--LAREALRLGAAKLSVKTRFVQRIAE--------------------------------
RL16_RHILO      E--TAREALRLGAAKLSVRTRFVQRIAE--------------------------------
RL16_NOVAD      P--LAAEAFSRAAMKLPIKTKVVARLGDTSHLAGE-------------------------
RL16_SPHAL      P--VAALAFERAAMKLPIKTKVIARLGDTSHLEG--------------------------
RL16_ZYMMO      P--IARVAFERAAAKLPIKVKVVARLGETIYEEA--------------------------
RL16_RHORT      D--IARGAFELAAAKLPLKTKFIARIGEV-------------------------------
RL16_MAGSA      E--IARHGFALAAAKLPIKTKFISRIGDI-------------------------------
RL16_GLUOX      E--VAKLALSLGAAKLPIKTKFVQRIGDA-------------------------------
RL16_RHOPA      Q--IAREALTLAAAKLPIKTRFVARIAE--------------------------------
RL16_PELUB      T--IAKEALYKASAKLPIKTKFIKRFA---------------------------------
RL16_RICBR      D--VAVKALELASAKLPVRTRIVRHYE---------------------------------
RL16_BACTN      E--IAKEALRLAAQKLPITTKFVVRRDYDIQNQNA-------------------------
RL16_PORGI      E--IAKEALRLAAQKLPVTTKFVVRHDYDIQNQNA-------------------------
RL16_SALRD      E--SAREALRLGKHKLPLKTKFVVRPGSRAEE----------------------------
RL16_SYNSC      E--IAKEAMRLAQYKLPVKTKFIQLDEQEK------------------------SAGAKA
RL16_SYNPX      E--IAKEAMRLAQYKLPVKTKFIALDEQQK------------------------QSAAEA
RL16_PROMM      D--IAKEAMRLAQYKLPIKTKFIGLDDQEK------------------------VAGSDK
RK16_PAUCH      T--IAREAMRLAQYKLPLKTKFLILNSQE-------------------------------
RL16_PROMA      E--IAKEAMRLAQYKLPIKTKFLALAEGEKPTQVGKAPPKSSFLPSDETETAAAQAGTEA
RL16_PROMT      A--IAKEAMRLAQYKLPVKTKFISLDEDLN-------------------------KGNYK
RL16_PROM9      E--IAKEAMRLAQYKLPVKTKFISSDKNLE------------------------VSSQEN
RL16_PROMP      E--IAKEAMRLAQYKLPVKTKFISSDINLS------------------------SDSSGE
RL16_SYNP6      E--TAREAMRLASHKLPIKTKFITRDSEAQ------------------------------
RK16_CYAPA      E--MAKAAFRIATFKLPIKTKFISSRV---------------------------------
RL16_MICDP      E--VAREAMRLAAYKLPIKTKFIVRPQVQE---------------------------QE-
RL16_SYNY3      E--VAREAMRLAAQKLPIKTKFISRQEDYI------------------------------
RL16_THEEB      E--VAREAMRLAAYKMPIKTRFLVRNQEEQ---------------------------QQE
RL16_GLOVI      E--IAREAMRLAAAKLPIKSRFIVKSETAP---------------------------AEE
RL16_SYNJA      A--TAREAMRLAAQKLPIKVKFVTKANFEE---------------------------PEP
RL16_SYNJB      P--IAREAMRLAAQKLPIKVKFVTKADFEK---------------------------PEP
RK16_CHAVU      N--IARAAMKIAAYKMPNKTQFLIRDNKDLIDSKI-------------------------
RK16_CHAGL      S--IAKSAMRIAAFKMPIKTQFLVK--KDKV-----------------------------
RK16_SPIMX      T--IARAAMRIAAYKMPIKTRFIVAN-LSKNPTND-------------------------
RK16_STAPU      T--VARSAMKIASYKMPIKTQFLVAS-KDSITV---------------------------
RK16_POPAL      N--IAKKAISIAASKMPIRTQFIILR----------------------------------
RK16_OENEH      N--IARKAISIAASKMPIRTQFIISG----------------------------------
RK16_ARATH      N--IARKAISIAASKMPIKTQFIISE----------------------------------
RK16_SPIOL      N--IARRAVAIAASKMPIRTQFIISG----------------------------------
RK16_NICTO      N--IARRAISLAASKMPIQTQFIIS-----------------------------------
RK16_EPIVI      N--IAKRAILIAASKMPMQTQFIISG----------------------------------
RK16_CALFG      T--VARAAISIAACKMPIRTQFIIAR----------------------------------
RK16_WHEAT      T--VARAAISIAASKMPIRSQFIRLEI---------------------------------
RK16_PHAAO      A--VAKAAMEIAACKMPIRTQFVISG----------------------------------
RK16_AMBTC      T--VARAAMEIAACKMPIRTQFISAK----------------------------------
RK16_NYMAL      T--VARAAMEIAARKMPIRTKFVIAE----------------------------------
RK16_LANPU      T--VARTAMLLAASKMPIRTQFIIEE----------------------------------
RK16_PINTH      T--VARAAARIAAYKMPIRTQFVTT-----------------------------------
RK16_HUPLU      T--IARAAMKIAAYKMPVRTQIIVATPIEMQNQ---------------------------
RK16_ANTAG      D--IAKAAIRIAAYKMPIRTQFIILHL---------------------------------
RK16_PHYPA      S--VARAAMRIAAYKMPIRTQFITAITSV-------------------------------
RK16_MARPO      N--IARAAMKIAAYKMPIRTQFITTSSLNKKQEI--------------------------
RK16_ZYGCR      T--IARAAMRIAAFKMPIKTQFIKTPVLATIQ----------------------------
RK16_PSINU      K--MAQAAMKIAAHKMPIHTKFITLSQLTNG-----------------------------
RK16_ADICA      E--VAEAAMLIAAHKMPIQTRLVTSEKL--------------------------------
RK16_OLTVI      P--IARSAMRITAYKMPVKTQFVAR-----------------------------------
RK16_TUPAK      T--VARKALRITGHKMPVKTQIVINKKF--------------------------------
RK16_CHLSP      T--IARQAMRIAAYKMPVKTKFLTKQA---------------------------------
RK16_TETOB      P--VAKQALKTAAYKMPIKTKFVKVESNP-------------------------------
RK16_OSTTA      T--IARASMRIAAYKMPVKTKFLVRDEYVAPQ----------------------------
RK16_NEPOL      T--IARASMRIACFKMPMKTRILQR-----------------------------------
RK16_MESVI      E--IARSAMRVAGFKMPVKTQFVVRDV---------------------------------
RK16_EUGLO      S--ISKYCLKIAGYKLPVKTKILYKN----------------------------------
RK16_EUGGR      S--IAKYSLKIAGYKMPIKTRVIVKI----------------------------------
RK16_PORPU      K--TAQQAMKLASYKLPIKTKFIVRNTIES------------------------------
RK16_GRATL      Q--TAQEAMKLASYKLPIKTKFITKQ----------------------------------
RK16_CYAM1      Q--VAKEAIHMASYKLPIRVKMLCRNNNENNNSV--------------------------
RK16_EMIHU      E--MSHQVLKSASYKLPIKTKIISRESGN-------------------------------
RK16_GUITH      D--LRYLAFKNASYKLPIKTKFISR-----------------------------------
RK16_TRICV      E--IAATALHLASYKLPIKTKFITRIKI--------------------------------
RK16_HELSJ      P--LARKALKLASAKLPLKTKFIFKKE---------------------------------
RK16_CHLVU      S--VARVALRLAASKLPVKTQILVK-----------------------------------
RL16_CHLTE      E--VAVEAFRLAAKKLPIKTKFIVRPDYEG------------------------------
RL16_CHLCH      E--IATEAFRLAAKKLPIKTKFIIRPDYEG------------------------------
RL16_RUBXD      E--LAREAMRLAAQKLPIKTRFLVRGGGS-------------------------------
RL16_DESHY      E--IAKEALRLAMHKLPVKCKIVRREELEGGDANEN------------------------
RL16_CALS4      D--VAKEALRLAMHKLPIKTKFLKREEL-GGESNES------------------------
RL16_CLOPE      E--KAREAMRLASHKLPVKTKFVTRRDFEEMGGEE-------------------------
RL16_CLOTE      E--TAREAMRLAAHKLPVKTKFVKKSDFEEVGGEINEG----------------------
RL16_CLOAB      E--QAREAFRLASHKLPIKTKFVTRKDFEEMGGEANEG----------------------
RK16_CYACA      E--LAKEAVKLAIYKLPIKCKFLSNDEFAKD-----------------------------
RL16_AQUAE      E--VAQEAFTIAASKLPIPVRLVKYGEFTFKY----------------------------
RL16_TREDE      N--LAEQAMTLAGSKLPFKTRFAEQIQAD-------------------------------
RL16_TREPA      A--LAEQAMLLAGSKLPIKTRFAERVQEI-------------------------------
RL16_RHOBA      Q--QAKVCFARLASKMPVKVRFVERRSA--------------------------------
RL16_BORBP      E--LAQEAMSLASSKLPVKTMFVVRRDLR-------------------------------
RL16_DEHMC      E--AAKEAMRLASYKMPVKTRFVARDIPVVAGETEVEEAE--------------------
RL16_CHLPN      E--DAQDALRRAAAKLGIKTRFVKR--------VERV-----------------------
RL16_PARUW      D--MAQSALRRAAAKLGLKTRFVER--------VEQV-----------------------
RL16_FUSNN      E--KAAAALRKAAMKLPIRCKVVKR--------EEKENGGEN------------------
RL16_DEIRA      E--QAKEAFRLAGHKLPIQTKMVKR--------EVYDEAQ--------------------
RL16_THET8      E--QAMEALRIAGHKLPIKTKIVRR--------DAYDEAQ--------------------
RL16_THEMA      E--TAHEALRYAASKLPIATKIVPR--------HHIGGEAV-------------------
RL16_LACJO      D--VAREALRLASNKLPIKTKFVKK-------SSEVGGESNEG-----------------
RL16_LACDA      E--TAREAMRLAASKLPIKCKFVKRE------DQEAGGATNED-----------------
RL16_ENTFA      E--VAREALRLASHKLPVKTKIVKR--------EEMGGESNEG-----------------
RL16_LISMF      D--VAREALRLAAHKLPVKTKIVKR--------EEIGGEANES-----------------
RL16_LACS1      E--VAREALRLASHKLPVKTKFVQR--------EEVGGESNEG-----------------
RL16_LACSS      E--VAREALRLASHKLPVKTKIVKR--------EEVGGESNEG-----------------
RL16_LACPL      E--VAREALRLAGTKLPVKTKIVKR--------EEVGGESDEG-----------------
RL16_LACLA      A--TAREALRLASHKLPVKTKFVKR------------GEA--------------------
RL16_BACC1      E--VAREALRLAAHKLPVKCKFVKR--------EENGGESNEN-----------------
RL16_BACSU      E--VAREALRLASHKLPIKTKFVKR--------EEIGGESNES-----------------
RL16_OCEIH      E--VAREALRLASHKLPVKTKFVKR--------EEIGGESNEG-----------------
RL16_GEOKA      E--VAREALRLASHKLPIKCKFVKR--------EETGGEA--------------------
RL16_CARHZ      E--VAREALRLASHKLPIKTKFVKR---------EVGGEAHES-----------------
RL16_SYMTH      E--TAQEAMRLAAHKLPIKCKFVKREKAVTPAAAETGGEANEG-----------------
RL16_MOOTA      E--VAREAMRLAAHKLPIKTKFVKR--------TGLGGDANEG-----------------
RL16_CORJK      E--VALEALRRAGNKLPCKVRIVKK--------EDQF-----------------------
RL16_CORGL      A--TALEALRRAGQKLPCKVRIVKR--------EDQL-----------------------
RL16_STAS1      E--VAREALRLASHKLPVKTKFVKR--------EELGGETNES-----------------
RL16_FRACC      P--VAREAMRRAIHKLPMKCRFVVR--------EGGA-----------------------
RL16_THEFY      P--VAKEALRRAIHKLPMKCKVVKR--------EAGE-----------------------
RL16_NOCFA      E--TAREALRRAMHKLPMKCRIVTR--------EEQF-----------------------
RL16_STRCO      K--IAREALTRAAHKLPMKCRIVKR--------EAGEA----------------------
RL16_MYCPA      Q--TARAALTRAIHKLPIKARIVTR--------EDQF-----------------------
RL16_LEIXX      D--LAREAMSRAIHKLPLKARIIKR--------EEGDA----------------------
RL16_TROWT      S--LAKEALMRAIHKLPLRARIVER--------QEFDDAGL-------------------
RL16_CUTAK      D--VAREAMRLAIHKLPMKARFISR--------EGGDN----------------------
RL16_BIFLO      D--IAKEALRRAIDKLPMKCRIIAR--------EGGDI----------------------
RL16_MYCMS      Q--VAREALRLAMHKLPIRCKFVK---------RGEN-----------------------
RL16_MESFL      E--TAREALRLAMHKLPVRCKFVK---------RGEE-----------------------
RL16_SPIKU      E--TALEALRLAMHKLPVRCKIVK---------KGEE-----------------------
RL16_MYCPN      S--QMIKALTRAGHKLPVTWKILK---------REEVSA---------------------
RL16_MYCGA      A--QMKEALTRAGHKLGVTWKIVA---------RQGAQ----------------------
RL16_MYCPE      E--VARTALKNAGNKLSVNWKIVK---------KGEIAHD--------------------
RL16_UREPA      E--LMCEALRAAGNKLPIKVKIVK---------KGEAN----------------------
RL16_ONYPE      SSKVEMEALRLASHKLPIKTKIVK---------KGAEV----------------------
RL16_MYCPU      E--VAKDALRLAGHKLPVKWRIVEAS------PKEEVI----------------------
RL16_MYCS5      E--RAKEALRLAGHKLPVKWKIIE---------KEGVN----------------------
RL16_MYCHJ      E--IARDALRLGGHKLPLKWKIVA-----------TV-----------------------
RL16_MYCMO      E--VAKEALRLGSYKLPVKSKIVL---------KESE-----------------------
                              *:                                            

RL16_GEOMG      ----------------
RL16_GEOSL      ----------------
RL16_PELCD      ----------------
RL16_SYNAS      ----------------
RL16_BDEBA      ----------------
RL16_MYXXD      ----------------
RL16_ECOLI      ----------------
RL16_YERPS      ----------------
RL16_HAEI8      ----------------
RL16_PHOPR      ----------------
RL16_SHEON      ----------------
RL16_VIBPA      ----------------
RL16_BUCAK      ----------------
RL16_BAUCH      ----------------
RL16_BLOFL      ----------------
RL16_BLOPB      ----------------
RL16_BUCAI      ----------------
RL16_BUCAP      ----------------
RL16_BUCBP      ----------------
RL16_WIGBR      ----------------
RL16_CHRSD      ----------------
RL16_SACD2      ----------------
RL16_PSEAE      ----------------
RL16_LEGPH      ----------------
RL16_IDILO      ----------------
RL16_PSEHT      ----------------
RL16_COLP3      ----------------
RL16_HYDCU      ----------------
RL16_FRATT      ----------------
RL16_NITOC      ----------------
RL16_DECAR      ----------------
RL16_THIDA      ----------------
RL16_BORA1      ----------------
RL16_RALSO      ----------------
RL16_AROAE      ----------------
RL16_NITMU      ----------------
RL16_METFK      ----------------
RL16_NITEU      ----------------
RL16_NEIMB      ----------------
RL16_CHRVO      ----------------
RL16_RHOFT      ----------------
RL16_HAHCH      ----------------
RL16_METCA      ----------------
RL16_PSYA2      ----------------
RL16_ACIAD      ----------------
RL16_XANC8      ----------------
RL16_XYLFT      ----------------
RL16_COXBU      ----------------
RL16_HELHP      ----------------
RL16_WOLSU      ----------------
RL16_HELPJ      ----------------
RL16_SULDN      ----------------
RL16_CAMJR      ----------------
RL16_DESAG      ----------------
RL16_DESVH      ----------------
RL16_LAWIP      ----------------
RL16_LEPIC      ----------------
RL16_DESPS      ----------------
RL16_EHRCJ      ----------------
RL16_EHRRW      ----------------
RL16_ANAMM      ----------------
RL16_WOLPM      ----------------
RL16_WOLTR      ----------------
RL16_NEOSM      ----------------
RL16_RUEPO      ----------------
RL16_ROSDO      ----------------
RL16_RHOS4      ----------------
RL16_BRUSU      ----------------
RL16_CHESB      ----------------
RL16_BARQU      ----------------
RL16_CAUVC      ----------------
RL16_RHIME      ----------------
RL16_RHILO      ----------------
RL16_NOVAD      ----------------
RL16_SPHAL      ----------------
RL16_ZYMMO      ----------------
RL16_RHORT      ----------------
RL16_MAGSA      ----------------
RL16_GLUOX      ----------------
RL16_RHOPA      ----------------
RL16_PELUB      ----------------
RL16_RICBR      ----------------
RL16_BACTN      ----------------
RL16_PORGI      ----------------
RL16_SALRD      ----------------
RL16_SYNSC      PAASEAITVES-----
RL16_SYNPX      PAAAEAVNVES-----
RL16_PROMM      PASVPAITAES-----
RK16_PAUCH      --SETLVTPEV-----
RL16_PROMA      SSASSVTPLES-----
RL16_PROMT      PAKTPVTADDSESSS-
RL16_PROM9      TKNNKESQEEVKQ---
RL16_PROMP      GKTGKDSKEEVKK---
RL16_SYNP6      ---------EA-----
RK16_CYAPA      ----------------
RL16_MICDP      ----------------
RL16_SYNY3      ----------------
RL16_THEEB      G---------------
RL16_GLOVI      PTNAPT----------
RL16_SYNJA      VQKAAPETTEVAASAI
RL16_SYNJB      AQATA---SEVATSSV
RK16_CHAVU      ----------------
RK16_CHAGL      ----------------
RK16_SPIMX      ----------------
RK16_STAPU      ----------------
RK16_POPAL      ----------------
RK16_OENEH      ----------------
RK16_ARATH      ----------------
RK16_SPIOL      ----------------
RK16_NICTO      ----------------
RK16_EPIVI      ----------------
RK16_CALFG      ----------------
RK16_WHEAT      ----------------
RK16_PHAAO      ----------------
RK16_AMBTC      ----------------
RK16_NYMAL      ----------------
RK16_LANPU      ----------------
RK16_PINTH      ----------------
RK16_HUPLU      ----------------
RK16_ANTAG      ----------------
RK16_PHYPA      ----------------
RK16_MARPO      ----------------
RK16_ZYGCR      ----------------
RK16_PSINU      ----------------
RK16_ADICA      ----------------
RK16_OLTVI      ----------------
RK16_TUPAK      ----------------
RK16_CHLSP      ----------------
RK16_TETOB      ----------------
RK16_OSTTA      ----------------
RK16_NEPOL      ----------------
RK16_MESVI      ----------------
RK16_EUGLO      ----------------
RK16_EUGGR      ----------------
RK16_PORPU      ----------------
RK16_GRATL      ----------------
RK16_CYAM1      ----------------
RK16_EMIHU      ----------------
RK16_GUITH      ----------------
RK16_TRICV      ----------------
RK16_HELSJ      ----------------
RK16_CHLVU      ----------------
RL16_CHLTE      ----------------
RL16_CHLCH      ----------------
RL16_RUBXD      ----------------
RL16_DESHY      ----------------
RL16_CALS4      ----------------
RL16_CLOPE      ----------------
RL16_CLOTE      ----------------
RL16_CLOAB      ----------------
RK16_CYACA      ----------------
RL16_AQUAE      ----------------
RL16_TREDE      ----------------
RL16_TREPA      ----------------
RL16_RHOBA      ----------------
RL16_BORBP      ----------------
RL16_DEHMC      ----------------
RL16_CHLPN      ----------------
RL16_PARUW      ----------------
RL16_FUSNN      ----------------
RL16_DEIRA      ----------------
RL16_THET8      ----------------
RL16_THEMA      ----------------
RL16_LACJO      ----------------
RL16_LACDA      ----------------
RL16_ENTFA      ----------------
RL16_LISMF      ----------------
RL16_LACS1      ----------------
RL16_LACSS      ----------------
RL16_LACPL      ----------------
RL16_LACLA      ----------------
RL16_BACC1      ----------------
RL16_BACSU      ----------------
RL16_OCEIH      ----------------
RL16_GEOKA      ----------------
RL16_CARHZ      ----------------
RL16_SYMTH      ----------------
RL16_MOOTA      ----------------
RL16_CORJK      ----------------
RL16_CORGL      ----------------
RL16_STAS1      ----------------
RL16_FRACC      ----------------
RL16_THEFY      ----------------
RL16_NOCFA      ----------------
RL16_STRCO      ----------------
RL16_MYCPA      ----------------
RL16_LEIXX      ----------------
RL16_TROWT      ----------------
RL16_CUTAK      ----------------
RL16_BIFLO      ----------------
RL16_MYCMS      ----------------
RL16_MESFL      ----------------
RL16_SPIKU      ----------------
RL16_MYCPN      ----------------
RL16_MYCGA      ----------------
RL16_MYCPE      ----------------
RL16_UREPA      ----------------
RL16_ONYPE      ----------------
RL16_MYCPU      ----------------
RL16_MYCS5      ----------------
RL16_MYCHJ      ----------------
RL16_MYCMO      ----------------