CLUSTAL format seed alignment for MF_01344

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PETD_CYAM1      -MSILKKPDLSDAQLRAKLAKGMGHNMYGEPAWPNDLLYTFPVVILGTITCCIGLALMEP
PETD_CYACA      -MTIIKKPDLNNALLRAKLAKGMGHSYYGEPAWPNDLLYTFPIVILGTITCCVGLAVLEP
PETD_PORPU      -MSILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVILGTIACSIGLAILEP
PETD_GUITH      -MSVLKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTLACVIGLSVLAP
PETD_GRATL      -MSIIKKPDLTDPKLRAKLAKGMGHHYYGEPAWPNDILYMFPVVILGILACDVGLSILEP
PETD_TRICV      -MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVCILGTFACCIGLAVMAP
PETD_EMIHU      -MSILKKPDLADPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVCILGTIACCIGLGVLEP
PETD_ZYGCR      -MGVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTIACNVGLAVMEP
PETD_SPIMX      -MGVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTIACNVGLAVLEP
PETD_PHYPA      -MGVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEP
PETD_HUPLU      -MGVAKKPDLSDPVSRAKLAKGMGHNYYGEPAWPNDLLYIPPVVIPGTIACTVGLAVLEP
PETD_PICAB      -MGATKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEP
PETD_PINKO      -MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEP
PETD_PSINU      -MGVTKKPDLNDPVSRAKLAKGMGHNYYGEPAWPNDLLYIFPIVILGTIACIAGLAVLEP
PETD_ADICA      -MGVKK-PDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTVACTVGLAVLEP
PETD_CHAGL      -MGVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVCIFGTIACTVGLSVLEP
PETD_STAPU      -MGVIKKPDLTDPVLRAKLAKGMGHHYYGEPAWPNDLLYMFPVCILGTIACNVGLAVLEP
PETD_CHLRE      -MSVTKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDP
PETD_CHLMO      -MSVTKKPDLNDPVLRAKLAKGFGHNTYGEPAWPNDLLYIFPVVIFGTFACCIGLAVLDP
PETD_TETOB      -MSVTKKPDLTDPVLKEKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTFACVIGLSVLDP
PETD_AUXPR      -MAVTKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDIFYMFPVVIFGTFAGVIGLAVLDP
PETD_TUPAK      -MAVIKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVIFGSFACVIGLAVLDP
PETD_CHLVU      -MAVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTFACVIGLSVLDP
PETD_NEPOL      -MSVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTLSCITGLAVLDP
PETD_MESVI      -MSLQKKPDLKDPVLRAKLAKGMGHNYYGEPAWPNDLLYTFPVCILGTIGCLVGLAVLEP
PETD_NOSS1      -MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDP
PETD_MASLA      -MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDP
PETD_SYNP2      -MSIMKKPDLSDPKLRAKLAQNMGHNYYGEPAWPNDILFTFPICIAGTIGLITGLAILDP
PETD_SYNY3      -MSIIKKPDLSDPDLRAKLAKGMGHNYYGEPAWPNDILYMFPICILGALGLIAGLAILDP
PETD_PROHO      -MSVLKKPDLTDPVLLEKLAQNMGHNYYGEPAWPNDLLYTFPVVILGTLACVVGLAVLDP
PETD_PROMP      -MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDP
PETD_PROMT      -MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDP
PETD_PROMA      -MSTLKKPNLSDPKLRAKLSKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDP
PETD_PROMM      -MHILKKPDFSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTFACLVGLAVLDP
PETD_SYNPX      -MHILKKPDLSDPKMRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACIVGLAVLDP
PETD_SYNP6      -MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDP
PETD_THEEB      MAKVLKKPDLTNPALRAKLKKGMGHNYYGEPAWPNDLLYIFPVVIMGTIALVIGLAVMDP
PETD_GLOVI      --MPLKRPELDDPEIRELLEQGMGHNTYGEPFWPNDIL-IFGVVILGTIFGVIALAVLDP
PETD_CYAPA      -MSILKKPDLNDPELRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGSIACCGGLAVLDP
PETD_AMPOP      --MVVRLPYVKGSILCSALAKGCGHNYYGEPAWPNDILYIFPVVILGTISFSLGLGVIEN
                     : * . ..     * :. **  **** ****:     : * * .    .*.::  

PETD_CYAM1      SAIGEAANPFATPLEILPEWYFYPTFNLLRVIPN--------KLLGVLSMASVPLGLIFV
PETD_CYACA      SSLGEPANPFATPLEILPEWYLYPTFNMLRIIPN--------KLFGVISISLVPVGLGIV
PETD_PORPU      SSLGEKSNPFATPLEILPEWYFFPTFNLLRVIPN--------KLLGVLSMAAVPAGLLTV
PETD_GUITH      SPIGEKADPFATPLEILPEWYFFPTFNLLRVIPN--------KLLGVLSMAAVPVGLITV
PETD_GRATL      SVIGEPANPFATPLEILPEWYFFPTFNLLRVIPN--------KLVGVLSMASVPAGLITV
PETD_TRICV      TQMGEPADPFNTPLEILPEWYFFPTFNLLRVLPN--------KLLGVLAMARVPAGLITV
PETD_EMIHU      TPLGEKADPFATPLEILPEWYFFPTFNLLRVIPN--------KLLGVLSMAAVPIGLITV
PETD_ZYGCR      SMIGEPANPFATPLEILPEWYFFPVFQILRTVPN--------KLLGVLLMAAVPAGLLTV
PETD_SPIMX      SMIGEPANPFATPLEILPEWYFFPVFQILRTVPN--------KLLGVLLMAAVPAGLLTV
PETD_PHYPA      SMIGEPANPFATPLEILPEWYFFPVFQILRTVPN--------KLLGVLLMAAVPAGLLTV
PETD_HUPLU      SMIGEPANPFATPLEILPEWYFSPVFQILRTVPN--------KLLGVLLMAAVPAGLLVV
PETD_PICAB      SMIGEPANPFATPLEILPEWYLFPVFQILRTVPN--------KLLGVLLMASVPAGSLTV
PETD_PINKO      SMIGEPANPFATPLEILPEWYLFPVFQILRTVPNQILRTVPNKLLGVLLMASVPAGSLTV
PETD_PSINU      SMIGEPANPFATPLEILPEWYFYPVFQILRTVPN--------KLLGVLLMASVPAGLLTV
PETD_ADICA      SMVGEPANPFATPLEILPEWYFFPVFQILRTVPN--------KLLGVLLMASVPAGLLTV
PETD_CHAGL      VIVGEPANPFATPLEILPEWYFFPVFQILRTVPN--------KLLGVLLMAGVPVGLLTV
PETD_STAPU      SLIGEPANPFATPLEILPEWYFFPVFQILRVVPN--------KLLGVLLMASVPVGLITV
PETD_CHLRE      AAMGEPANPFATPLEILPEWYFYPVFQILRVVPN--------KLLGVLLMAAVPAGLITV
PETD_CHLMO      AAMGEPANPFATPLEILPEWYFYPVFQILRTVPN--------KLLGVLAMAAVPVGLLTV
PETD_TETOB      AAIGEPANPFATPLEILPEWYFYPVFQLLRTVPN--------KLLGVLLMAAVPAGLITV
PETD_AUXPR      AAIGEPANPFATPLEILPEWYFYPVFQLLRTVPN--------KLLGVLLMAAVPAGLITV
PETD_TUPAK      AAVGEPANPFATPLEILPEWYFYPTFQLLRTVPN--------KLLGVLLMAAVPAGLLTV
PETD_CHLVU      AAIGEPANPFATPLEILPEWYFYPVFQILRVVPN--------KLLGVLLMAAVPAGLLTV
PETD_NEPOL      AAIGEPANPFATPLEILPEWYFFPVFQLLRTVPN--------KLLGVLLMAAVPAGLLTV
PETD_MESVI      TMFGEPANPFATPLEILPEWYFFPVFQILRVIPN--------KLLGVVLMAGVPAGLLTV
PETD_NOSS1      AMTGEPANPFATPLEILPEWYLYPVFQILRSLPN--------KLLGVLAMASVPLGLILV
PETD_MASLA      AMVGEPADPFATPLEILPEWYLYPVFQILRSVPN--------KLLGVLLMASVPLGLILV
PETD_SYNP2      AMIGEPGNPFATPLEILPEWYLYPVFQILRVLPN--------KLLGIACQGAIPLGLMMV
PETD_SYNY3      AMIGEPADPFATPLEILPEWYLYPTFQILRILPN--------KLLGIAGMAAIPLGLMLV
PETD_PROHO      AMVGEPANPFATPLEILPEWYLYPAFQILRVVPN--------KLLGILLQTAIPLGLMLV
PETD_PROMP      AMLGDKANPFATPLEILPEWYLYPVFQILRVVPN--------KLLGIALQTLIPLGLMIL
PETD_PROMT      AFLGDKANPFATPLEILPEWYLYPVFQILRVVPN--------KLLGIALQTLIPLGLMIL
PETD_PROMA      AFLGDKANPFATPLEILPEWYLYPVFQILRVVPN--------KLLGIALQTLIPLGLILI
PETD_PROMM      AMLGDKADPFATPLEILPEWYLYPVFQILRVVPN--------KLLGIALQTLVPLGLMLI
PETD_SYNPX      AMLADKADPFATPLEILPEWYLYPVFQILRVVPN--------KLLGIALQTLVPLGLMLV
PETD_SYNP6      ALVGEPADPFATPLEILPEWYLYPVFQILRIVPN--------KLLGIVLQSMIPLGLIAI
PETD_THEEB      AMVGEPADPFATPLEILPEWYLYPTFQIFRVVPN--------KLLGVLMNASIPLGLMLI
PETD_GLOVI      AKMGEPADPFNTPLHILPEWYFYPVFQILRVVPN--------KLLGVVLMAAIPIGLALV
PETD_CYAPA      ALIGEPADPFSTPLEILPEWYFFPVFQILRVIPN--------KLLGVVLMAAVPAGLIAV
PETD_AMPOP      QAIGEPANPFATPLEILPEWYFFPTFNLLRILPD--------KLVGVLSLASVPVILVLT
                   .: .:** ***.******: *.*:::* :*:        **.*:     :*      

PETD_CYAM1      PFIENRNRYQNPWRRPIATTVFLVGTVVTIWLGIGATKS-IQDAISLGLF----------
PETD_CYACA      PFVENINKFQNPFRRPIATSVFIFGTVTTVWLGIGATMS-IDKALTLGIFF---------
PETD_PORPU      PFIENVNKFQNPFRRPIATTIFLISTVITIWLGIGATMP-INNAITLGLF----------
PETD_GUITH      PFIESVNKFQNPFRRPVAMTVFVFSVVFAIWLGIGATMP-INKALTLGLF----------
PETD_GRATL      PFIESVNKFQNPFRRPIATSVFLVGTIVAVWLGIGATMP-LSKAITLGLF----------
PETD_TRICV      PFIENVNKFQNPFRRPIASLVFILGFFTAVWLGIGACLP-IDKAVSLGFW----------
PETD_EMIHU      PFIENVNKFQNPFRRPVASLVFLFGTFTAFWLGIGATMP-ITQALTLGFF----------
PETD_ZYGCR      PFLENVNKFQNPFRRPVATTVFLIGTVVSIWLGIGAAMP-IDQSLTLGLF----------
PETD_SPIMX      PFLENVNKFQNPFRRPVATTVFLFGTVVALWLGIGAALP-IDKSLTLGLF----------
PETD_PHYPA      PFLENVNKFQNPFRRPVATTVFLIGTVVSIWLGIGAALP-IDISLTLGLF----------
PETD_HUPLU      PFPENVNKFQNPFRRPVATTVFSAGTAVAPWLGIGAALP-IDKSLTLGLF----------
PETD_PICAB      PFLENVNQFQNPFRRPVATTVSLIGTAVALWLGIGAALP-IDESLTLGLFQFDPTVEYKN
PETD_PINKO      PFLENVNQFQNPFRRPVATTVSLIGTAVALWLGIGAALP-IDESLTLGLFQSN-LIQLSN
PETD_PSINU      PFLENVNKFQNPFRRPVATTVFLIGTVVAIWLGIGAALP-IDRSLTLGLF----------
PETD_ADICA      PFLENVNKFQNPFRRPVATTVFAIGTVAAIWLGIGATLP-IEGSLTLGLF----------
PETD_CHAGL      PFIENVNKFQNPFRRPVATTVFLLGTVVAIWLGIGAALP-IDTSLTLGLF----------
PETD_STAPU      PFIENVNKFQNPFRRPVATTIFLIGTVVAVWLGIGATLP-IDTSLTLGLF----------
PETD_CHLRE      PFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFP-IDISLTLGLF----------
PETD_CHLMO      PFIESINKFQNPYRRPIATILFLVGTLVAVWLGIGATFP-IDISLTLGLF----------
PETD_TETOB      PFIENINKFQNPYRRPIATTLFLVGTLVAVWLGIGATLP-IEISLTFGLF----------
PETD_AUXPR      PFIKIYNKFQNPFRRPVATTVFLVGTVAAIWLGIGAALP-IDISLTLGLF----------
PETD_TUPAK      PFIENINKFQNPFRRPIATTVFLIGTFAAIWLGIGACLP-IDISLTLGLF----------
PETD_CHLVU      PFIENINKFQNPFRRPVATTVFLIGTVAAIWLGIGAALP-IDISLTLGLF----------
PETD_NEPOL      PFIESINKFQNPFRRPVATTVFLIGTVVAIWLGIGATLP-IDISLTLGLF----------
PETD_MESVI      PFIESINKFQNPFRRPVAMTVFLIGTVVAVWLGIGATLP-IDTSLTLGFF----------
PETD_NOSS1      PFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALP-LDKSLTLGLF----------
PETD_MASLA      PFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFP-LDKTLTLGLF----------
PETD_SYNP2      PFIESVNKFQNPFRRPVAMAVFLFGTAVTLWLGAGACFP-IDESLTLGLF----------
PETD_SYNY3      PFIESVNKFQNPFRRPIAMTVFLFGTAAALWLGAGATFP-IDKSLTLGLF----------
PETD_PROHO      PFIENINKFQNPFRRPIAMAVFLFGTLVTLWMGVAATLP-IDKFFTLGLF----------
PETD_PROMP      PFIENVNKFSNPFRRPVAMSVFLFGTFLTIYLGIGACLP-IDKSLTLGLF----------
PETD_PROMT      PFIENINKFANPFRRPVAMSLFLFGTVLTMYLGIGACLP-IDKSLTLGLF----------
PETD_PROMA      PFIENVNKFSNPFRRPVAMAFFLFGTALTIYLGIGACLP-IDKSLTLGLF----------
PETD_PROMM      PFIESVNKYQNPFRRPIAMAFFLFGTVITIYLGIGACLP-IDKSLTLGLF----------
PETD_SYNPX      PFIESFNKFQNPFRRPVAMTVFLFGTVTTIYLGIGAALP-IDKSLTLGLF----------
PETD_SYNP6      PFIESVNKFQNPFRRPIATAVFLFGTVFTLYLGIGAALP-IDKSLTLGLF----------
PETD_THEEB      PFIESVNKFQNPFRRPVAMTVFLFGTLVTLWLGIGAAFP-LDKSLTLGLF----------
PETD_GLOVI      PFIENVNKFQNPFRRPLATAVFLIGTVVTMYLGIGAMIPDIPKSLTLGLF----------
PETD_CYAPA      PFIENVNKFQNPFRRPVASAVFLFGTFVAIWLGIGATFP-IDKSLTLGLF----------
PETD_AMPOP      AFIENINRYQNPFRRPVASLVYLTSTCYALWLGYGSVLG-ISEALPFV------------
                .* :  *:: **:***:*  .   .   : ::* .:    :   ..:             

PETD_CYAM1      ------------
PETD_CYACA      ------------
PETD_PORPU      ------------
PETD_GUITH      ------------
PETD_GRATL      ------------
PETD_TRICV      ------------
PETD_EMIHU      ------------
PETD_ZYGCR      ------------
PETD_SPIMX      ------------
PETD_PHYPA      ------------
PETD_HUPLU      ------------
PETD_PICAB      LSIF----YSYI
PETD_PINKO      IKIFQIFFFSYI
PETD_PSINU      ------------
PETD_ADICA      ------------
PETD_CHAGL      ------------
PETD_STAPU      ------------
PETD_CHLRE      ------------
PETD_CHLMO      ------------
PETD_TETOB      ------------
PETD_AUXPR      ------------
PETD_TUPAK      ------------
PETD_CHLVU      ------------
PETD_NEPOL      ------------
PETD_MESVI      ------------
PETD_NOSS1      ------------
PETD_MASLA      ------------
PETD_SYNP2      ------------
PETD_SYNY3      ------------
PETD_PROHO      ------------
PETD_PROMP      ------------
PETD_PROMT      ------------
PETD_PROMA      ------------
PETD_PROMM      ------------
PETD_SYNPX      ------------
PETD_SYNP6      ------------
PETD_THEEB      ------------
PETD_GLOVI      ------------
PETD_CYAPA      ------------
PETD_AMPOP      ------------