CLUSTAL format seed alignment for MF_01345_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS17_FERNB       ---------------------------------------------------------MPK
RS17_THEM4       ---------------------------------------------------------MPK
RS17_THEP1       ---------------------------------------------------------MPR
RS17_PSELT       ---------------------------------------------------------MSK
RS17_MYCGE       ------------------------------------------------------MKRNQR
RS17_MYCPN       ------------------------------------------------------MKRNQR
RS17_MYCGA       -------------------------------------------------------MRNSR
RS17_UREP2       ------------------------------------------------------MERSRR
RS17_MYCPE       -----------------------------------------------MSSQVNTTRDSRR
RS17_AQUAE       ----------------------------------------------MTEQKQQKKWHEKR
RS17_GEOSL       ----------------------------------------------------MSQ-RGNR
RS17_PELPD       ----------------------------------------------------MSE-RGHR
RS17_PELCD       ----------------------------------------------------MSKIRGNR
RS17_SYNFM       ----------------------------------------------------MEEQKSGR
RS17_DESPS       ----------------------------------------------------MSENNTSR
RS17_CALS8       ----------------------------------------------------MEQKRGMR
RS17_SYMTH       ----------------------------------------------------MTAERNLR
RS17_MOOTA       ------------------------------------------------------MERNYR
RS17_CARHZ       -----------------------------------------------------MEKKKVQ
RS17_PELTS       -----------------------------------------------------MEGRGIR
RS17_ROSS1       -----------------------------------------------------MTEARRR
RS17_ANADF       ------------------------------------------------------MERGNR
RS17_MYXXD       --------------------------------------MREKMAEATETQASETSTRGRP
RS17_CHLMU       ---------------------------------------------------MASDVRGRR
RS17_CHLFF       ---------------------------------------------------MASEVRGLR
RS17_CHLPN       ---------------------------------------------------MASEPRGSR
RS17_PARUW       ---------------------------------------------------MQQEERGSR
RS17_ECOLI       ----------------------------------------------M---------TDKI
RS17_YERP3       ----------------------------------------------M---------TDQI
RS17_HISS2       ----------------------------------------------M---------TDKI
RS17_MANSM       ----------------------------------------------M---------TDKI
RS17_PSEHT       ----------------------------------------------M---------SDKI
RS17_VIBPA       ----------------------------------------------M---------SEVK
RS17_SHEFN       ----------------------------------------------M---------SDKA
RS17_SHESH       ----------------------------------------------M---------SDNI
RS17_BAUCH       -----------------------------------------MYNVDI---------KKNI
RS17_BUCAP       ----------------------------------------------M---------KEKI
RS17_BUCCC       ----------------------------------------------M---------NEKK
RS17_BUCBP       ----------------------------------------------M---------IDKF
RS17_BLOFL       ----------------------------------------------M---------NNKV
RS17_BLOPB       ----------------------------------------------M---------SDRI
RS17_WIGBR       -------------------------------------MKKKKVEIIMG--------KKKL
RS17_HYDCU       ----------------------------------------------MAGS------ENKA
RS17_FRAP2       ------------------------------------------M-------------SDKI
RS17_PSYCK       ---------------------------------------------MSDNNQAT----TNA
RS17_PSYWF       ---------------------------------------------MSDDIQQTEVSGTGV
RS17_COLP3       ---------------------------------------------MSE---------TKI
RS17_MARMS       ---------------------------------------------MAE---------TKA
RS17_ALCBS       ---------------------------------------------MAEAN-------TMR
RS17_ACIAD       -----------------------------------------------MSE-------KTV
RS17_CHRSD       ----------------------------------------------MAEE-------NNA
RS17_HAHCH       ---------------------------------------------MTANE-------KSV
RS17_SACD2       ---------------------------------------------MTEAK-------KLV
RS17_PSEU5       ---------------------------------------------MAEAQ-------KTV
RS17_MARHV       ---------------------------------------------MTEAT-------QTA
RS17_LEGPH       --------------------------------------------MSTNSE-------SNA
RS17_PSEA6       ----------------------------------------------MTEQ-------S-S
RS17_IDILO       ----------------------------------------------MTDE-------KRV
RS17_COXBN       ---------------------------------------------MNKNE-------KMV
RS17_DICNV       ---------------------------------------------MTEKQ-------VIH
RS17_METCA       ---------------------------------------------MTASE-------GRV
RS17_ALKEH       ---------------------------------------------MTENE-------KVT
RS17_HALHL       ---------------------------------------------MSE-E-------KNT
RS17_NITOC       ---------------------------------------------MSDQE-------KIS
RS17_XANC8       ---------------------------------------------MSDNNEK-----QTL
RS17_XYLFT       --------------------------------------------MMNDNNER-----KPL
RS17_GLUOX       ----------------------------------------------MP-----------R
RS17_GRABC       ----------------------------------------------MP-----------R
RS17_ACICJ       ----------------------------------------------MP-----------K
RS17_RHORT       ----------------------------------------------MP-----------K
RS17_SPHAL       ----------------------------------------------MP-----------K
RS17_ZYMMO       ----------------------------------------------MP-----------K
RS17_SPHWW       ----------------------------------------------MP-----------K
RS17_ERYLH       ----------------------------------------------MP-----------K
RS17_SINMW       ----------------------------------------------MP-----------K
RS17_OCHA4       ----------------------------------------------MP-----------K
RS17_RHILO       ----------------------------------------------MP-----------K
RS17_CHESB       ----------------------------------------------MP-----------K
RS17_BRADU       ----------------------------------------------MP-----------K
RS17_AZOC5       ----------------------------------------------MP-----------K
RS17_ROSDO       ----------------------------------------------MP-----------K
RS17_JANSC       ----------------------------------------------MP-----------K
RS17_PARDP       ----------------------------------------------MP-----------K
RS17_MAGSA       ----------------------------------------------MP-----------K
RS17_CAUSK       ----------------------------------------------MP-----------K
RS17_MARMM       ----------------------------------------------MP-----------K
RS17_PARL1       ----------------------------------------------MP-----------K
RS17_HYPNA       ----------------------------------------------MP-----------K
RS17_MAGMM       ----------------------------------------------MA-----------K
RS17_RICBR       ----------------------------------------------MP-----------K
RS17_ORITB       ----------------------------------------------MP-----------R
RS17_THET8       ----------------------------------------------MP-----------K
RS17_PELUB       ----------------------------------------------MP-----------K
RS17_DEIRA       -----------------------------------------------M-----------K
RS17_EHRCR       --------------------------------------MREGKRKNMSN----------K
RS17_EHRRW       --------------------------------------MKERMRSRMS-----------K
RS17_ANAPZ       ----------------------------------------------MS-----------K
RS17_WOLTR       ----------------------------------------------MP-----------K
RS17_VEREI       ----------------------------------------------MTEAQ-----KSLK
RS17_METPP       ---------------------------------------------MTTQET-----VKNT
RS17_AROAE       ----------------------------------------------MTEQI-----EKVR
RS17_PARXL       ----------------------------------------------MNDSVK----TSLK
RS17_RALSO       ----------------------------------------------MTEAA-----TSLK
RS17_POLAQ       ----------------------------------------------MTELS-----KPLR
RS17_BORA1       ----------------------------------------------MSETQNTQ-VTKRQ
RS17_DECAR       ----------------------------------------------MSESS------SIK
RS17_NEIG1       ----------------------------------------------MSE-------TKNV
RS17_CHRVO       ----------------------------------------------MSE-------TKVV
RS17_METFK       ----------------------------------------------MSENQ----TEKLV
RS17_THIDA       ----------------------------------------------MSE------IKKVV
RS17_NITMU       ----------------------------------------------MSE-------ANLN
RS17_NITEU       ----------------------------------------------MSS-------DNQS
RS17_NITEC       ----------------------------------------------MNL-------DNQS
RS17_PROMM       ---------------------------------------------------------MAL
RS17_SYNPX       ---------------------------------------------------------MAV
RS17_SYNR3       ---------------------------------------------------------MAV
RS17_PROMA       ---------------------------------------------------------MAL
RS17_PROMT       ---------------------------------------------------------MAL
RS17_PROMP       ---------------------------------------------------------MAL
RS17_ACAM1       ---------------------------------------------------------MAI
RS17_THEEB       ---------------------------------------------------------MAV
RS17_MICAN       ---------------------------------------------------------MAV
RS17_SYNE7       ---------------------------------------------------------MAV
RS17_GLOVI       ---------------------------------------------------------MPR
RS17_TRIEI       ---------------------------------------------------------MAA
RS17_SYNJA       ---------------------------------------------------------MPA
RS17_SYNY3       ---------------------------------------------------------MAI
RR17_TRICV       ---------------------------------------------------------MPV
RR17_THAPS       ---------------------------------------------------------MPV
RR17_PHATC       ---------------------------------------------------------MPV
RR17_PYRYE       ---------------------------------------------------------MPL
RR17_CYACA       ---------------------------------------------------------MSA
RR17_GUITH       ---------------------------------------------------------MSI
RR17_CYAPA       ---------------------------------------------------------MAS
RR17_CYAM1       -----------------------------------------------------------M
RS17_KORVE       -----------------------------------------------MAETTNTPETSHR
RR17_EMIHU       ---------------------------------------------------------MVA
RS17_BDEBA       ---------------------------------------------------------MTE
RR17_GRATL       ---------------------------------------------------------MYK
RS17_TREDE       ------------------------------------------------METTENTKKIGK
RS17_TREPA       ------------------------------------------------------MKRPER
RS17_RUBXD       MSEEERNRGAEPEERAEALADTGDLPESEVAGDLGEAAQRGPAFDRDAGKVQKDTRRGRR
RS17_LEUMM       --------------------------------------------------MSEE--RNTR
RS17_OENOB       --------------------------------------------------MSEE--RNTR
RS17_LACBA       --------------------------------------------------MSDA--RNNR
RS17_BACHD       ----------------------------------------------------ME--RNQR
RS17_LACP3       --------------------------------------------------MAE---RNSR
RS17_LACSS       --------------------------------------------------MSEES-RNHR
RS17_LACPL       --------------------------------------------------MSEDT-RNSR
RS17_STRMU       ----------------------------------------------------ME--RKQR
RS17_LACDB       --------------------------------------------------MSESIERNRR
RS17_LACJO       --------------------------------------------------MSETNERNNR
RS17_MESFL       --------------------------------------------------ME----RNSR
RS17_CLOBL       --------------------------------------------------ME----RSNR
RS17_CLOK5       --------------------------------------------------ME----RGYR
RS17_CLOD6       --------------------------------------------------ME----RGRR
RS17_CALS4       --------------------------------------------------ME----RGQR
RS17_DESHY       --------------------------------------------------ME----RTQR
RS17_SYNWW       ------------------------------------------------MTEN----RANR
RS17_FUSNN       ---------------------------------------------------M----RNER
RS17_ONYPE       ------------------------------------------------------MQRNFR
RS17_MYCS5       ---------------------------------------------------MTFENRNNR
RS17_MYCMO       ----------------------------------------------------MQERINRR
RS17_MYCPU       -----------------------------------------------------MERINTR
RS17_MYCHJ       --------------------------------------------MNNLTLEKKAQTRNLR
RS17_CORDI       -------------MSEANVN---------------------------------KKEKGAR
RS17_CORJK       -------------MSEATVND----------------------------NAAVKNEKGAR
RS17_STRCO       -------------MSE------------------------------SNVTEETKAARGFR
RS17_FRACC       -------------MTDETASQ-----------------------EASQSTDAAAPARGFR
RS17_SALTO       -------------MSE----------------------------------NTTATTRARR
RS17_THEFY       -------------MSE----------------------------------KTTAQERNHR
RS17_SACEN       -------------MSD----------------------------------GGQGVTRNTR
RS17_TROWT       -------------MSQQ---------------------------------------RGYR
RS17_LEIXX       -------------MAETTKAT------------------------AAEPAADEALVRGYR
RS17_MYCPA       ------------MMAEAKKAA--PKKAATAASKD-------ADAKGPKHTPPNPKVRGRR
RS17_MYCLE       ------------MAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGR
RS17_RHOJR       -------------MSEEKAVS--------------------------------TEERGSR
RS17_BIFLO       -------------MAE---------------------------------------ERNFR
RS17_CUTAK       -------------MSE-----------------------------------NTAERTTRR
RS17_CHLTE       -------------MSSG------------------------------------AETRGRK
RS17_PORGI       ---------------------------------------------------ME---RNLR
RS17_CYTH3       ---------------------------------------------------MEEILRNAR
RS17_SALRD       -------------MEQTEEHTDTHTD-----------------------EQDEAVDRNDR
RS17_ARCB4       --------------------------------------------------------MTHK
RS17_SULDN       --------------------------------------------------------MTHK
RS17_CAMC5       --------------------------------------------------------MALK
RS17_CAMHC       --------------------------------------------------------MAFK
RS17_WOLSU       ----------------------------------------------------MSNEQAHK
RS17_CAMJD       --------------------------------------------------------MAFK
RS17_NITSB       --------------------------------------------------------MAYK
RS17_HELAH       ----------------------------------------------------MNTKEPHK
RS17_HELHP       ----------------------------------------------------MSEKQAHT
RS172_BACTN      -----------------------------------------MVPCRLRPFLWNSPKVAVK
RS17_LEPBJ       ---------------------------------------------------MTVGKQHIN
RS17_SYNAS       -----------------------------------------------------MSERGFN
RS17_DEHM1       --------------------------------------------------------MEKN
RS17_BORAP       ------------------------------------------------------MARENK
RS17_RHOBA       ---------------------------------------------------------MPK
RS17_DESAG       --------------------------------------------------MSEAIENRNG
RS17_LAWIP       --------------------------------------------------MPQIIAKCNG
                                                                             

RS17_FERNB       KRL-------VGVVVS-DKMDKTVTVKVERLVKHAKFGKYVKRTKKFYAHDENN------
RS17_THEM4       KRL-------IGEVLS-DKMDKTVVVAVSTLVKHPRVGKYIKRTKKYYAHDENN------
RS17_THEP1       KRL-------TGIVVS-DKMDKTVVVAVEKLVQHPIYKKYVKRTKKYHAHDERN------
RS17_PSELT       KRL-------TGVVVS-NKMDKTVVVEVTRKLEHPVYKKYIQRSKKYYAHDEKN------
RS17_MYCGE       KQL-------IGTVVS-TKNAKTATVKVTSRFKHPLYHKSVIRHKKYHVHNF-G----EL
RS17_MYCPN       KVL-------IGIVKS-TKNAKTATVQVESRFKHPLYHKSVVRHKKYQAHNE-G----EV
RS17_MYCGA       KVL-------MGVVVS-DKMQKTATVKVESKNRHPFYHKLVISHKKYHVHNEEG----EN
RS17_UREP2       KVL-------EGLVVS-DKMQKTVVVSVETKSKHPIYRKLVISHKKYHAHND------ND
RS17_MYCPE       KIL-------QGIVVS-DKMQKTIVVQVERKSKHRLYKKLVITHKKYHAHDE------KE
RS17_AQUAE       KHL-------VGVVVS-DKMDKTVVVKVDRKVPHPIYGKHIIKSKKYHAHDE------HN
RS17_GEOSL       KTQ-------VGVVVS-DKMDKTVVVRVSHLVKHPVYNKYIKRSVKYKAHDTDN------
RS17_PELPD       RTQ-------NGVVVS-DKMDKTVVVKVDRLIKHPVYNKYIKRSAKYKVHDENN------
RS17_PELCD       KTR-------VGVVIS-DKMDKTVVVKVDQMVKHPIYKKYIKRRVTFKAHDEEN------
RS17_SYNFM       KTR-------VGRVLS-NKMDKTVVVVVERLIHHPQYHKFIRRQNKFKAHDAQN------
RS17_DESPS       KTR-------TGSVVS-DRMEKSVVVRVERKVRHKLYGKFMKTSVKYLADDPEN------
RS17_CALS8       KTR-------IGVVVS-DKMDKTVVVAVETLVQHPLYKKTIKRTTKFKAHDENN------
RS17_SYMTH       KTR-------VGVVTS-DKMDKTVVVAVETLVQHPLYKKRVRRTKKFKAHDEHN------
RS17_MOOTA       KTR-------VGSVVS-DKMDKTVVVAVEDRVRHPLLNKIIRHTRKFKAHDEKN------
RS17_CARHZ       KIK-------IGRVVS-DKMDKTVVVAVEELVSHPLYKKTIRRTKKFKAHDEHN------
RS17_PELTS       KTL-------TGRVVS-NKMDKTVVVAVETLVRHPLYQRTIRRTKKFKAHDEEN------
RS17_ROSS1       QFK-------VGRVVS-NKMQKTVVVAVDYLKPHPLYRKIIRRTSKFHAHDEQ-------
RS17_ANADF       KSR-------IGVVVS-NKMAKTVVVKVERRVADPKYGKIVKRAEKYKAHDENN------
RS17_MYXXD       KTR-------VGIVTS-NKMQKTVVVTVQRRAPHPKYGKIMSLREKYKAHVEDHDYPKKI
RS17_CHLMU       KTK-------IGVVVS-SKMEKTVVVRVERVYSHPQYAKVVRDSSKYYAHNEL-------
RS17_CHLFF       KTK-------VGVVVS-SKMDKTVIVRVERVYSHPQYAKVVRDSKKYYAHNDL-------
RS17_CHLPN       KVK-------IGVVVS-AKMEKTVVVRVERIFSHPQYLKVVRSSKKYYAHTEL-------
RS17_PARUW       KVK-------KGIVVS-NKMQKTVVVKVERTFAHPQYGKIVTRGKKYYAHNESG------
RS17_ECOLI       RTL-------QGRVVS-DKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENN------
RS17_YERP3       RTL-------QGRVVS-DKMEKSMVVAIERVVKHPIYGKFIRRTTKLHVHDENN------
RS17_HISS2       RTV-------QGKVIS-DKMDKSFVVAIERTVKHPIYGKFIRRTTKLHVHDEHN------
RS17_MANSM       RTV-------QGRVIS-DKMDKSFTIAIERKVKHPLLGKFIRRTTKLHVHDENN------
RS17_PSEHT       RTL-------QGRVIS-DKMEKSFTIAIARYVKHPIYGKFIRRTTKLHVHDENN------
RS17_VIBPA       RTQ-------QGRVVS-DKMDKSITVAIERFVKHPIYGKFVKRTTKVHAHDENN------
RS17_SHEFN       RTL-------QGKVIS-NKMDKSITVAIERQVKHPIYGKYIKRTTKIHAHDETN------
RS17_SHESH       RTL-------QGRVLS-NKMDKSITVAIERKVKHPLYGKYLKRTTKIHAHDEQN------
RS17_BAUCH       RIK-------QGRVVS-NKMDKSIVVAIERIIKHPIYGKYIKRTTKIHAHDENN------
RS17_BUCAP       RTL-------QGRVTS-NKMNKSAVVAIERFVKHPIYGKFVKKTTKLHIHDEKN------
RS17_BUCCC       NLL-------NGYIVS-NKMNKSAVVIVERKIKHSIYKKFIKKRTKLCIHDEKN------
RS17_BUCBP       RTL-------SGQVIS-NKMQKSAIVSIKRLIKHPLYKKFVKKTTKLCIHDENN------
RS17_BLOFL       HVL-------QGIVIR-SKMQKSIVVSINRIVKHSMYKKFINRTTKIYVHDTNN------
RS17_BLOPB       RIL-------LGRVCN-KKMNKSVVVSIERLIKHSTYEKFIKRTTKLHVHDPNN------
RS17_WIGBR       QIL-------KGSVIK-NKMQKSIVVSVERFVKHPIYKKFMKKTTKLHVHDENN------
RS17_HYDCU       RTM-------QGVVVS-NGMDKSVVVMTNRYIKHPKYKKFVRKSTKVMAHDADN------
RS17_FRAP2       RLL-------EGKVSS-VAMDKTVVVRAERYVKHPLYGKFVKKTTKYYVHDEKN------
RS17_PSYCK       SVL-------TGRVVS-DKMDKSITVLIERLVRHPLYGKQLRRSTKIKAHDENN------
RS17_PSYWF       GIV-------TGKVVS-NKMDKSITVLIERKVRHPLYGKQIRRSTKIKAHDENN------
RS17_COLP3       RTL-------QGVVVS-NKMDKSIVVLIERRVKHPMYGKYMTRSTKLKAHDETN------
RS17_MARMS       RIA-------TGKVVS-DKMDKTITVLVERTEKHPLYGKFIRRSTKLHAHDENN------
RS17_ALCBS       RTA-------TGKVIS-NKGDKTITVLVERRVQHPIYGKIIKRSTKLMAHDEEN------
RS17_ACIAD       RTL-------TGKVVS-DKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN------
RS17_CHRSD       RTL-------TGKVVS-DKMDKSVVVQIERRVRHPIYDKYVKRSTKLHAHDEAN------
RS17_HAHCH       RTE-------TGKVVS-DKMDKSIVVLVERRVKHPLYGKYVKRSSKLHAHDENN------
RS17_SACD2       RTL-------TGKVVS-DKMEKSIVVLIERRVKHPVYGKYVSKSTKMKAHDEAN------
RS17_PSEU5       RTL-------TGRVVS-DKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETN------
RS17_MARHV       RTL-------SGKVVS-NKMDKSIVVLVERQVKHPLYGKYMKRSTKIHAHDESN------
RS17_LEGPH       RTM-------IGKVVS-DKMDKTIVVMIERTVKHPKYGKIMKRRTKLHAHDENQ------
RS17_PSEA6       RTV-------QGRVVS-NKMDKTITVAVERKVKSPIYGKFIKRTTKLHAHDETN------
RS17_IDILO       RTL-------QGKVVS-DKMDKTITVAVERRVKHPVYGKYITRTTKVHAHDEEN------
RS17_COXBN       RSL-------MGTVVS-NKMNDTVVVRVERRVKHPKYGKFIKRSTKIHAHDKGN------
RS17_DICNV       RIL-------QGEVVS-NKSDKSITVTVVRYVKHPLYGKYIKRTLRCHAHDENN------
RS17_METCA       RSV-------TGRVVS-NKMDRTIVVAIERQVSHPLYGKYIRRTTKVLAHDENN------
RS17_ALKEH       RNV-------QGRVVS-NKADKTITVLVERRVRHPLYGKYIRRSSKMQAHDEGN------
RS17_HALHL       RTV-------NGRVVS-SKMDKTLTVLVERRVKHPLYGKFIRRSTKLHAHDEGN------
RS17_NITOC       HTV-------IGRVVS-DKMDKTITVLIERKVAHSLYKKYVRRFTKLHAHDENN------
RS17_XANC8       RTV-------EGRVVS-NKMDKTVTVLVERQVKHPLYGKYIKRSSKLHAHDADN------
RS17_XYLFT       RTI-------KGLVIS-NKMQKTVTVLVERQIKHALYGKYIKRSTKLHAHDADD------
RS17_GLUOX       RVL-------TGRVTS-DKMDKTVTVLLDRRIMHPLYKKFIRRSKKYAAHDEEN------
RS17_GRABC       RVL-------TGRVTS-DKMDKTVTVLVDRRIIHPLYKKFIRKSKKYAAHDEAN------
RS17_ACICJ       RVL-------TGRVVS-DKMDKTVTVLVERRVMHPLYKKFIRRSKKYAAHDEGN------
RS17_RHORT       RIM-------QGVVVS-DKMDKTIVVQVERRFKHAVYKKFIKRTKKFAAHDELN------
RS17_SPHAL       RIL-------TGTVVS-DKGDKTVVVKVERKVKHPLYGKIIRRSKKYHAHDEDN------
RS17_ZYMMO       RVL-------TGTVVS-DKTDKTVVVLVERKVKHPLYGKIIRLSKKYHAHDEQN------
RS17_SPHWW       RVL-------TGTVVS-DKTDKTVVVKVERRVKHALYGKIIKRSKKYHAHDETN------
RS17_ERYLH       RIL-------IGTVTS-DKTDKTVTVLVERKVKHPLYGKIIRRSKKYHAHDEKN------
RS17_SINMW       RIL-------QGTVVS-DKNDKTVVVRVERRFAHPILQKTVRRSKKYKAHDESN------
RS17_OCHA4       RVL-------QGVVVS-DKNDKTVVVKVERRYSHPLLQKTVRQSKKYKAHDENN------
RS17_RHILO       RIL-------QGTVVS-DKNEKTVVVKVERRFTHPVMKKTVRMTKKYKAHDENN------
RS17_CHESB       RVL-------QGTVVS-DKNDKTVVVRVERRFAHPLLKKTVRRSKRYKAHDENN------
RS17_BRADU       RTL-------QGVVVS-DKTAKTVVVRVDRRFTHPIYKKTIRRSKNYHAHDENN------
RS17_AZOC5       RVL-------QGVVVS-DKQDKTVVVRVERRFTHPLLKKTVRRSKKYHAHDEAN------
RS17_ROSDO       RIL-------SGVVTS-DANDQTVSVSVERRFTHPVLKKTIRKSKKYRAHDENN------
RS17_JANSC       RIL-------TGTVTS-DANEQTVTVSVERRFKHPVMQKTIRKSKKYRAHDPQN------
RS17_PARDP       RIL-------QGKVVS-DKNEQTVTVLVERRFKHPLLHKTVRSSKKYRAHDADN------
RS17_MAGSA       RIL-------QGVVVS-DKMEKTVVVSVERRVMHPIYKKFIRRSKKYHAHDENN------
RS17_CAUSK       RIL-------EGVVVS-DKGDKTVVVKVERTIVHPLLKKIVRRSKKYHAHDESN------
RS17_MARMM       RIL-------QGVVVS-DKGAKTIVVRVERTFLHPLLRKTVRRTKRYHAHDEAN------
RS17_PARL1       RIL-------QGVVVS-DKNEKTIVVNVERRFQDPLLKKIVRRSKKYHAHDENK------
RS17_HYPNA       RIM-------KGVVVS-AKQDKTAIVRVERTFTHPMLKKIVRKTNKYHAHDENN------
RS17_MAGMM       RIM-------QGVVVS-DKMDKTVVVLVERKVRHPLYGKIVRQSKKYKAHDEEN------
RS17_RICBR       RVL-------QGVVIS-SKTDKTVTVKVERRFKHPIYKKFIKVSKKYAAHDPNN------
RS17_ORITB       RVL-------QGQVIS-AKSDKTIIVSVERRFKHPMYHKTVKIAKKYAVHDPDN------
RS17_THET8       KVL-------TGVVVS-DKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEE------
RS17_PELUB       KIL-------TGVVTS-DKPNKTITVSVERKYSHPVLKKVVKVRKKYNAHDENN------
RS17_DEIRA       KTF-------TGVVVS-DKADKTVSVKVERRFAHPLYGKVVTRSHKYAAHDENN------
RS17_EHRCR       KVL-------TGIVVD-AKCDKTIKVMVSRMIMHKTYKKIVKKRKNYVVHDEHN------
RS17_EHRRW       QVL-------TGVVVG-AKCDKTIKVMVSRMVSHKMYKKIVKKRKNYVVHDEYN------
RS17_ANAPZ       GVL-------VGVVTD-ARRDKTVKVSVYRMVHHKVYKKIVKKCRVYSVHDEQN------
RS17_WOLTR       KVF-------CGVVTK-AKCDKTVKVSVLRVYKDKLYKKVIKRYKEYTVHDENN------
RS17_VEREI       RTL-------IGKVVS-DKRQKTVTVLVERRVKHELYGKIIARSSKYHAHDEKG------
RS17_METPP       RTL-------VGRVVS-DQRSKTITVLVERRVKHELYGKIVARSRKYHAHDENN------
RS17_AROAE       RAL-------VGRVVS-DKMQNTVTVLVERRVKHELYGKVITRSAKYHAHVEDG------
RS17_PARXL       RTL-------VGKVVS-NKMDKTVTVLVEHRVKHPIYGKYVVRSKKYHAHDDAN------
RS17_RALSO       RTL-------VGRVVS-SKMDKTVTVLVENRVKHPLYGKYVVRSKKYHAHDEAN------
RS17_POLAQ       RTL-------VGRVVS-DKMQKTVTVLVERQVKHPVIGKYVGQSKKYHAHDEAG------
RS17_BORA1       RTL-------VGKVVS-NKMDKTVVVLVERRVKHPIYGKIVMRSAKYKAHDESN------
RS17_DECAR       RTL-------IGRVVS-DKMDKTVTVLVERKVKHPMYGKVMVRSKKYHAHNEGN------
RS17_NEIG1       RTL-------QGKVVS-DKMDKTVTVLVERKVKHSLYGKIIRLSTKIHAHDENN------
RS17_CHRVO       RTL-------TGVVVS-DKMDKTVTVLVERKVKHPIYGKIIRRSKKFHAHDENN------
RS17_METFK       RTL-------SGRVVS-DKMDKTVTVLVERKVKHPLIGKVVRRSNKFHAHDENN------
RS17_THIDA       RTL-------TGRVVS-DKMNKTVTVLVERRVKHPVIGKVIRMSKKYHAHDENN------
RS17_NITMU       RTL-------SGKVVS-DKMNKTITVLVERKVKHPLYGKIMVRSKKYHVHDEAN------
RS17_NITEU       KTL-------IGQVVS-DKRDKTVTVRIDRKVKHPLYGKIVTRSSKYHAHDELN------
RS17_NITEC       KYL-------IGQIIS-DKRDKTVTVRIDRKVKHPLYGKIITRSKKYHAHDEHN------
RS17_PROMM       KER-------LGTVVS-DKMDKTVVVAVENRFPHPIYQKTVSRTTRYKAHDAGN------
RS17_SYNPX       KER-------VGTVVS-DKMEKTVVVAVESRFPHPIYQKTVSRTTRYKAHDEDN------
RS17_SYNR3       KER-------VGTVVS-DKMEKTVVVAVENRFPHPIYKKTVSRTTRYKVHDEDN------
RS17_PROMA       KER-------LGTVVS-DKMDKTVVVAVVNRFPHSIYQKTVSRTTRYKAHDEEN------
RS17_PROMT       KEM-------VGTVVS-DKMQKTVVVAVENRFPHPIYQKIISRTTRYKAHDAEN------
RS17_PROMP       KER-------IGTVVS-DKMDKTVVVAVINRYPHPTYKKIVSKTTRYKAHDPEN------
RS17_ACAM1       KER-------IGVVVS-DKMDKTVVVAVSNRVPHKKYGKIVGQTRRYKAHDEEN------
RS17_THEEB       KER-------VGVVVS-DKMQKTVVVAVENRAPHPKYGKIVVKTRRYKAHDENN------
RS17_MICAN       KER-------VGVVVS-DKMDKTVVVAIENRSPHPKYGKIVVKTQKFKAHDAEN------
RS17_SYNE7       KER-------VGVVVS-DKMDKTVVVAIEDRTAHPKYGKIVVRTKRYKAHDEDN------
RS17_GLOVI       KEK-------IGLVVS-DAMQKTVVVAVENRVPHPKYKKIVVRTRKFKAHDEEN------
RS17_TRIEI       KER-------VGVVVS-NKMHKTIVVAIENRSAHPRYGKIVVKTKKYKVHDEEN------
RS17_SYNJA       REK-------IGVVVS-NKMQKTVVVAVENRVAHPKYGKIVVKTKKFKAHDEEN------
RS17_SYNY3       KER-------VGIVVS-NKMDKTVVVAVESRSPHPKYGKIVVKTKKFKAHDEEN------
RR17_TRICV       KEK-------VGIVVS-NKMQKTIVVKVESRYSHPIYSKTMTKTRKYLAHDEMG------
RR17_THAPS       KEK-------VGVVIS-NKMQKTVVVKVESRYPHPIYSKTMIKTRKYLAHDEMS------
RR17_PHATC       KQQ-------IGIVIS-NKMQKTIVVKIENRYPHPMYSKTLIKTKKYLAHDELG------
RR17_PYRYE       KET-------TGKVVS-DKMNKTIVVAVENRISHRKYAKTMIRTKKYKAHDENN------
RR17_CYACA       KEI-------IGIVIT-KSLDKTAIVKTQSKSSHERYVKIIKKVKKYTVHDREN------
RR17_GUITH       KER-------LGLVIS-DKMDKTVVVSIANRVTHKRYGKIVTKTKKYKVHDPNN------
RR17_CYAPA       KER-------VGVVIR-NPQEKTVIVAVNNRVRHNKYSKIIIRTKKYQVHDHSH------
RR17_CYAM1       KKL-------LGLVVS-CRMQKTVIVEVKTQVKHALYGKRIMKKKRYAVHDPEK------
RS17_KORVE       KEL-------IGLVVS-TKMQKTIVVQVERQKSHAMYGRVISRRKRFYAHDEEQ------
RR17_EMIHU       KEK-------IGTVVS-DKMLNTRIVAVSDRVSHKNYGKVITRTKRYVAHDIES------
RS17_BDEBA       TNSRGRKIEVVGEVIS-DKMDKTISVLIYRMVKHAKYGKYVKKTSVFKAHDEKN------
RR17_GRATL       KYT-------IGTVIS-NKMNKTITVAVKNKAQHLRYKKIITKTNKYYAHDEHN------
RS17_TREDE       RE-------FVGIVTS-DKMNKTIVVEVRTKKLHKLYKKYVSSSKKYKAHDEEN------
RS17_TREPA       RT-------LVGLVTS-DKMHKTVTVRITTKKLHALYKKYVSRSKKYQAHDEEN------
RS17_RUBXD       KE-------RVGLVVS-DAADKTVTVSVETLKEHPMYKKRIRRSKKFLVHDERN------
RS17_LEUMM       KV-------YQGRVVS-DKMNKTITVAVDTYLTHDVYGKRVKYTKKFKAHDENN------
RS17_OENOB       KV-------YRGRVVS-DKMDKTITVAVETYKNHPVYGKRVNYAKKFKAHDENN------
RS17_LACBA       KV-------YRGRVVS-DKMDKTITVVVETTKTDARYGKRVKYSKKYKAHDENG------
RS17_BACHD       KV-------YTGRVVS-DKMDKTITVLVETYKKDRLYGKRVKYSKKFKAHDENN------
RS17_LACP3       KV-------YQGRVVS-DKMDKTITVEVSTVKMHPVYGKRMKYSKKYYVHDEDN------
RS17_LACSS       KV-------YQGRVVS-DKMDKTITVMVETYKTHPEYGKRVKYSKKYYAQDDNN------
RS17_LACPL       KV-------IQGRVVS-DKMDKTIVVIVETYKNHPVYGKRVRYSKKFKAHDEKN------
RS17_STRMU       RT-------LVGRVVS-DKMDKTITVVVETKRNHPVYGKRINYSKKYKAHDENN------
RS17_LACDB       HV-------YQGRVVS-DKMDKTIVVVVDTYKNHPVYSKRTRYSKKYYAMDENN------
RS17_LACJO       HV-------YQGRVVS-DKMDKTITVVVDTYKNHPVYKKRIKYSKKYYAHDENN------
RS17_MESFL       RI-------LVGKVVS-DKMDKTITVLVETYKNHPIYKKRVKYSKKYKAHDEQQ------
RS17_CLOBL       KT-------RIGRVVS-NKMDKTIVVAVETKVRHPLYGKIMNRTTKFKAHDENN------
RS17_CLOK5       KT-------RIGTVTS-DKMDKTIVVAVENRVRHPLYGKIIKKTSKFKAHDENN------
RS17_CLOD6       KV-------RIGRVVS-DKMDKTIVVAVEEFVRHPLYNKRVKRTKKFKAHDEKN------
RS17_CALS4       KV-------RIGTVVS-NKMQKTIVVAVEDKFRHPLYGKIVKRTKKYKVHDENN------
RS17_DESHY       KV-------RMGKVVS-DKMDKTVVVAVEMKVRHPLYHRTITQTKKFKAHDENN------
RS17_SYNWW       KI-------RIGTVSS-DKMDKTITVSVETVKQHPLYKKTIKTSKKYKAHDENN------
RS17_FUSNN       KV-------REGIVVS-DKMQKTIVVAIETMILHPIYKKRVKRTTKFKAHDEEN------
RS17_ONYPE       KT-------FVGKVVS-DKMDKTITVIVDIYKKDPLYGKRVKQSKKFHVHDENQ------
RS17_MYCS5       KT-------LTGKVVSAQKTQKTIIVEVDRYKKHLLYGKRFKKTKRYAVHDEAQ------
RS17_MYCMO       KA-------LTGVVVS-DKSSKTIVVAVDTFKKDPLYQKRFKSTKKFAAHDEKE------
RS17_MYCPU       KA-------LVGSVVS-SVNDKTIIVAVDIYKKHPIYSKRFKKTKRFAAHDEQN------
RS17_MYCHJ       KT-------LQGIVIR--TSPKTIMVEVETAYKHKLYAKRFKKRKKFNTHDEKN------
RS17_CORDI       KV-------RTGYVVS-DKMQKTIVVELEDRKSHAKYGKTIRTNSKVKAHDEKE------
RS17_CORJK       KV-------RSGYVVS-TKMNKTIVVELEDRKQHALYGKIMRRNSRVKVHDENE------
RS17_STRCO       KT-------RQGLVVS-DKMDKTVVVAVEDRVTHALYGKVIRRTEKLKAHDEQN------
RS17_FRACC       KV-------REGLVVS-DKMTKTVVVAVEDRVQHPLYGKTIRRTKKVKAHDESG------
RS17_SALTO       KV-------REGLVVS-DKMDKTVVVEVEDRVKHGLYGKIMRRTSKLKVHDEQN------
RS17_THEFY       KV-------REGYVVS-DKMDKTVVVAVENRFKHPLYGKIIRRTTKYKAHDEAN------
RS17_SACEN       KV-------REGYVVS-DKMDKTIVVSLEDRKKHALYGKVMRRNTKVKAHDEAN------
RS17_TROWT       KS-------RRGYVTS-NSMDKTIVVKIEDRVKHALYGKVIRKTSKVKAHDQGS------
RS17_LEIXX       KA-------RRGYVVS-DKMDKTIVVEVEDRVKHPLYGKVLRRTSKVKAHDESN------
RS17_MYCPA       KT-------RIGYVVS-DKMQKTIVVELEDRVKHPLYGKIIRTTKKVKAHDENS------
RS17_MYCLE       KM-------RIGYVVS-DKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENS------
RS17_RHOJR       KV-------RTGYVVS-DKMEKTIVVELEDRVKHPLYGKIIRRTSKVKAHDENG------
RS17_BIFLO       KV-------RRGYVVS-DKMDKTITVELEQRSTHPLYGKVVRSTSKVKAHDEHN------
RS17_CUTAK       KV-------REGLVVS-DKMNKTITVMVEDRVKHPLYGKVMTKSVRLKAHDENN------
RS17_CHLTE       KS-------WLGKVVS-DSMDKGIVVAVERRVQHPVYKKYFKKTTRLMAHDENN------
RS17_PORGI       KE-------RVGVVSS-NKMDKTITVAVKWKEKHPIYGKFVNKTKKYHAHDEKN------
RS17_CYTH3       KE-------RTGKVVS-NKMNKSITVAVERKVKHAKYGKFIHKTTKLMAHDENQ------
RS17_SALRD       KE-------RIGVVES-AKMDKTITVSVRRQMKHPMYGKYLERSSTFMAHDEGD------
RS17_ARCB4       RE-------IQGVVVK-KSGDKTASVLVTRSVLHPKYHKTVKRFKKYLIHDEKN------
RS17_SULDN       RE-------IQGNVVK-ISGDKTASIVVERRVMHPRYHKVVKRFKKYLVHDERN------
RS17_CAMC5       RE-------IQGVVLQ-KAGDKTATILVERRVMHPRYHKFVKRFKKYLVHDEKN------
RS17_CAMHC       RE-------IHGLVVK-KAGDKTATILVERRVMHPRYRKFVKKFKKYLVHDEKN------
RS17_WOLSU       RV-------IQGKVVT-KAGDKSVTILVERRVTHPKYRKIVKRFKKYIVHDESN------
RS17_CAMJD       RE-------IQGVVVK-IAGEKTVSVLVERKVVHPKYRKIVKRFKKYLIHDERN------
RS17_NITSB       RV-------IQGKVVK-KSGDKTVSLLVERKVVHPKYHKIVKRFKKYLVHDEHN------
RS17_HELAH       RV-------VQGKVIS-KFAEKSAVILVERKVVHKKYRKIVKKFKKYTIHDQDN------
RS17_HELHP       RV-------IQGKVIS-QAGNKSIVILVERKVVHSKYRKIVKRFKKYTIHDENQ------
RS172_BACTN      RIPRQC---IEGIVVS-TKMQKTVVIEVERTKKHPKYGKTVQYTKKYKIHDPLE------
RS17_LEPBJ       KSLL-----YEGRVVS-NSMNKTVVIVVETRKTHPKFKKIVRRSIKIKVHDEKN------
RS17_SYNAS       RTI-------KGVVVS-NKMDKTIVIRAERLVKHPVFHKYTRKHVKYMVHDEKN------
RS17_DEHM1       KT-------RIGHVIS-DRMEKTIVVGIDVAKRHPLYKKTYRRTMKYLVHDEKN------
RS17_BORAP       KE-------LIGRVVS-DKMSKTIVVEIVQRKMHPIYHKYLKVSKKVKAHDEKE------
RS17_RHOBA       RV-------VAGIVTS-DKMSKTRRVEIARLVKHPKYKKYIRRRTVCHVHDENN------
RS17_DESAG       RA-------LVGVVVS-DKNDKTIVVRVETLVKHPLLKKYIRRRKKFTAHDPNN------
RS17_LAWIP       RV-------LVGTVIS-DKNDKTIIVHVETLVKHPLLKKFIRHRKKFTAHDPLN------
                            * :           :            :                     

RS17_FERNB       ACRVGDVVEIEESRPLSKLKRWVVVNILER----SKLSETPEIEETIDIEGGSEQ-----
RS17_THEM4       ECRVGDIVEIVESRPLSKLKRWKVERIVER----SVFAEKAPEE---DLEGGSNNDN---
RS17_THEP1       ECKIGDVVEIEETRPLSKTKRWRVVRIIQRFEPERVLKEEEDIQE--EIEAVEGKGGVES
RS17_PSELT       ECKAGDTVLIEETRPLSKMKRWRVVEVLKR----EVIAEETLNTK--ESEEV--------
RS17_MYCGE       VANDGDRVQIIETRPLSALKRWRIVKIIER-------AK---------------------
RS17_MYCPN       LAKDGDKVQIVETRPLSATKRFRIAKIIER-------AK---------------------
RS17_MYCGA       AAKVGDKVLIMETRPLSATKRWRIAKIIER-------AK---------------------
RS17_UREP2       DAKVGDLVEITETRPLSATKNWRVSKILER-------AR---------------------
RS17_MYCPE       ECKIGDFVEIMETRPLSATKRWRLNKIIQK-------AK---------------------
RS17_AQUAE       ECRVGDIVMIRETRPLSKTKRWVVVKILQR-------ARRPEEEIQKQQEGQEQ------
RS17_GEOSL       SCKTGDRVLIVETRPLSKDKRWKVRQIIDR-------VE---------------------
RS17_PELPD       VCKIGDRVQIIECRPLSKDKRWNLKQISN-------------------------------
RS17_PELCD       RCNVGDKVSVVETRPLSRDKRWRVREILEK-------NVIL-------------------
RS17_SYNFM       ACRVGDRVIIEESRPISKDKRWVVVQVLDK-------AVI--------------------
RS17_DESPS       QCNIGDVVLIEECRPLSKRKRWRVKTILEQ-------AV---------------------
RS17_CALS8       ECRVGDKVLIMETRPLSKEKRWRVVQILER-------AK---------------------
RS17_SYMTH       QCKVGDKVRIMETRPLSKEKRWRVVEIIES-------APDYKSAPEV-------------
RS17_MOOTA       ECRIGDKVRIMETRPLSKEKRWRVVEIMER-------AR---------------------
RS17_CARHZ       ACRTGDIVKIAETRPLSKEKRWRVVEIIER-------GKVLGEEENLETIEG--------
RS17_PELTS       ACRIGDKVKMMETRPLSKEKRWRVVEILER-------TKQI-------------------
RS17_ROSS1       QCRIGDIVRIGETRPLSKTKRWEVVEIIKR-------NEEA-------------------
RS17_ANADF       ACQIGDKVRIVETRPMSKDKRWRIAETLEK-------AEV--------------------
RS17_MYXXD       TINEGDRVRIAETKPASKDKRWRVVEVLEK-------SKNV-------------------
RS17_CHLMU       DVKEGDTVRIQETRPLSKTKRWRVVDRVN-------------------------------
RS17_CHLFF       NVSEGEKVRIQETRPLSKLKRWRVVERIS-------------------------------
RS17_CHLPN       KVSEGDKVKIQETRPLSKLKRWRVIEHVGV-------VS---------------------
RS17_PARUW       DLQIGDEVKIMETRPLSKLKRWRVVA----------------------------------
RS17_ECOLI       ECGIGDVVEIRECRPLSKTKSWTLVRVVE--------KAVL-------------------
RS17_YERP3       ECGIGDVVEIRECRPLSKTKSWTLVVPRK--------PPARLGVQ---------------
RS17_HISS2       EAKLGDVVEVRGCRPLSKTKSHTLVRVVE--------KAQA-------------------
RS17_MANSM       EARIGDTVEIKECRPVSKTKSWTLVRVVE--------KAVEA------------------
RS17_PSEHT       EVQAGDVVTIRECAPISKSKSWTFVAVIE--------RPKQA------------------
RS17_VIBPA       ECGIGDTVEIAECRPLSKTKSWTLVKVVE--------KAKM-------------------
RS17_SHEFN       QCNEGDFVAISQCRPLSKTKSWTLAEVVT--------KA---------------------
RS17_SHESH       QCNAGDVVTIRECRPLSKTKSWTLVEVVS--------KA---------------------
RS17_BAUCH       ACNIGDLIEIKECRPISKTKSWILIRIIE--------KAIC-------------------
RS17_BUCAP       ECSIGDLIEIRESRPISKTKSWILVKILE--------KNIF-------------------
RS17_BUCCC       ICNIGDIVTIRECRPISKTKSWILVNILE--------KSIV-------------------
RS17_BUCBP       QCSFGDIVEIRECRPISKTKSWMLVRISK--------KSLRS------------------
RS17_BLOFL       ISNVGDIVEITECRPISKTKCWKLTSIIK--------KYNSS------------------
RS17_BLOPB       ETNVGDLVEVQECRPISKTKSWILTSIIK--------KSNF-------------------
RS17_WIGBR       SSKVGDVVEIQECRPISKTKSWKLINIKK--------NN---------------------
RS17_HYDCU       ACGVGDRVTISECTPFSKRKTWSLVSIDE--------KAAL-------------------
RS17_FRAP2       ECKEGDVIKFKETRPYSKTKKWCLVDIIN--------REK--------------------
RS17_PSYCK       VCQQGDLVRIKETRPISKTKSWTLVDVVE--------KVEKI------------------
RS17_PSYWF       VCKEGDVVRIIETRPISKTKSWKLVDVVE--------TAEKI------------------
RS17_COLP3       VCNEGDLVTITEVAPISKSKNWKLVDVIT--------KA---------------------
RS17_MARMS       ECQIGDLVKVVETRPYSKSKTWKLVQVVE--------KAAAV------------------
RS17_ALCBS       QCREGDLVTIEECRPLSKRKAWMLVNVVE--------QSKA-------------------
RS17_ACIAD       VAKLGDLVTIKESRPISKTKAWTLVEVVE--------VAAE-------------------
RS17_CHRSD       QARVGDTVSIEECRPISKLKAWTLVEVVE--------QAKG-------------------
RS17_HAHCH       ECRIGDTVQVQESRPLSKTKSWKLVNIVE--------RAEKV------------------
RS17_SACD2       DCKIGDTVTIAESRPLSKTKSWTLVKIEE--------RATQI------------------
RS17_PSEU5       QCKIGDKVSIRETRPQSKTKSWALVEVVE--------RAVEV------------------
RS17_MARHV       QCNIGDTVTIQETRPVSKTKSWALVEVTE--------RAAKV------------------
RS17_LEGPH       VCRVGNTVKIRESRPLSKTKSWVLVEVIS-------------------------------
RS17_PSEA6       QCNTGDVVTVRECRPMSKSKNWMLVDIVT--------KA---------------------
RS17_IDILO       QVKAGDTVIVRECRPLSKNKSWTLEEIVD--------RATVV------------------
RS17_COXBN       GCQIGDIVTIRECRPISKTKSWTLVKINE--------RAEKVE-----------------
RS17_DICNV       ECNIGDVVRISQSRPISKTKTWRLVEIVE--------RAKG-------------------
RS17_METCA       ECSIGDLVTLHASRPISKKKAWTLGAIVE--------RAV--------------------
RS17_ALKEH       ECQVGDVVTIEQCRPISKSKAWRLVKVLE--------RAAQ-------------------
RS17_HALHL       EGREGDWVSIQECRPLSKNKTWRLVKVLE--------RAAS-------------------
RS17_NITOC       ECRMGDIVAIAGTRPLSKTKAWKLVDILE--------RAR--------------------
RS17_XANC8       ACNEGDVVRVTEIAPMSKTKNWRVVEIVT--------RAAV-------------------
RS17_XYLFT       LCNEGDVVLMTEVAPISKTKNWRVVEIVA--------RSD--------------------
RS17_GLUOX       VCQTGDLVRIEECAPISKRKTWSVVSRNG--------EDLASASSSVSA-----------
RS17_GRABC       ECREGDIVRIVECPPISKRKTWEVVWRNGHVLSTAHKEAIDAAATQIAHAEASGEAAAAA
RS17_ACICJ       VCAMGDLVRIEECPPISKRKAWLVTARNG--------EPVGAAAEAQGA-----------
RS17_RHORT       QFKIGDLVRIRECAPISRRKTWEVVLDNA--------E----------------------
RS17_SPHAL       AIKAGETVRIEETKPISKLKTWKVLDKVE--------TSTKAKAAEA-------------
RS17_ZYMMO       AYHEGETVRIEECAPISKLKSWRVLEKAD--------KASAA------------------
RS17_SPHWW       EYREGETVRIEETAPMSKLKTWKVIERVD--------THATPNHA---------------
RS17_ERYLH       EYTLGDVVRIEETKPISKTKTWAVKDRVV--------AGGTQAIEADLDVAEATPGGAE-
RS17_SINMW       QFKVGDLVSIEECAPISKDKRWTVVSAQS-------------------------------
RS17_OCHA4       QFKVGDLVSIQESAPISKDKRWVVLTNEA--------AG---------------------
RS17_RHILO       AHKVGDQVFIQESKPISKDKRWIVVSSDQ--------A----------------------
RS17_CHESB       MCKVGDVVLIQETRPISKDKCWVVVNENQ--------AQ---------------------
RS17_BRADU       EFKPGDMVWIEESKPISKLKRWVVIRGEH--------KKSA-------------------
RS17_AZOC5       TWSIGDTVWIEEHRPLSKLKNWIVVQGEK--------RAEV-------------------
RS17_ROSDO       TFKKGDAVRIVECAPKSKTKRWEVLQAAE--------V----------------------
RS17_JANSC       SFKTGDQVRIQECAPVSKSKRWEVIVG---------------------------------
RS17_PARDP       QFKVGDTVRIVECAPISKTKRWTVLTETA--------EVSA-------------------
RS17_MAGSA       VFKTGETIRIRECAPISKTKCWEVIVEPQ--------A----------------------
RS17_CAUSK       AYKAGEVARIVECAPKSKLKTWEVLPKAS--------A----------------------
RS17_MARMM       AYKVGDQVQIQECAPKSKLKRWEVVTVAA-------------------------------
RS17_PARL1       SAKVGDIVKIRECKPVSKLKKWEVFTDEA-------------------------------
RS17_HYPNA       VAVEGQTIAIRECAPKSKLKRWEVVAEEG--------TEA--------------------
RS17_MAGMM       QYRTGDMVMIQESRPLSKDKNWVVTERTA--------VAVEG------------------
RS17_RICBR       KFQEGDKVNIIESRPISKTKTWVVIN--EE------------------------------
RS17_ORITB       LYNQGDKVKIIESRPISKTKCWRVIE--DKGQ----------------------------
RS17_THET8       KYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA----
RS17_PELUB       KFKTGDTVSIIECKPFSKNKKFQVMD--ESK-----------------------------
RS17_DEIRA       EYKIGDRVEIIAVRPISKTKTWKVTKLIERPRGIETTLAETEVAGGEA------------
RS17_EHRCR       QYKCGDVVKIQEHIPISATKRWIVI-----------------------------------
RS17_EHRRW       RYKCGDVVQIREHIPISATKRWVVI-----------------------------------
RS17_ANAPZ       RCARGDVVKIREHVPISATKRWIVVDE---------------------------------
RS17_WOLTR       SCKEGDKVFIQEHRPISATKKWVIVRVE--------------------------------
RS17_VEREI       EYKLGDMIEITESRPLSKTKNWVASRLVQ--------KAGLL------------------
RS17_METPP       EYKLGDLVEIAEGRPISKTKAWVVTRLVE--------KARVV------------------
RS17_AROAE       GAAAGDLVEIEECRPISKTKSWRVAKVLE--------KARVI------------------
RS17_PARXL       TYNEGDLVEIQETRPISKTKAWVVARLVE--------AARVI------------------
RS17_RALSO       QYKEGDRVEIVESRPISRTKAWVVSRLVE--------AARVI------------------
RS17_POLAQ       TYKMGDTVEIAESKPISRTKSWVVTRLVE--------ASKGI------------------
RS17_BORA1       QYNEGDTVEIAEGRPISRSKAWRVVRLVE--------AARII------------------
RS17_DECAR       SAKAGDLVEIVETRPVSRTKTWAVTSVLE--------KAIVV------------------
RS17_NEIG1       QYGIGDVVVISESRPLSKTKSWVVSELVE--------KARSI------------------
RS17_CHRVO       EFKAGDLVVISESRPLSKTKSWVVTGLVE--------KSRQV------------------
RS17_METFK       ECKEGDLVMIEESRPLSKTKTWRVSKIVE--------KARIV------------------
RS17_THIDA       ECHEGDTVQIEESRKLSRTKAWTVSKLVE--------RARV-------------------
RS17_NITMU       EFHTGDVVVIEECRPLSKTKAWRVVKLMQ--------KAEQVS-----------------
RS17_NITEU       QYKLGDIVAISETRPKSKTKAWQVVRVIK--------VN---------------------
RS17_NITEC       QYKVGDVVAISEARPISKTKSWRVIKVVK--------IN---------------------
RS17_PROMM       TCRVGDRVRITETRPLSRSKRWTVAEVLSHSPKA---------------QEVST------
RS17_SYNPX       SCRVGDRVRITETRPMSRHKRWAIAEVLSHSPKADKSAGSTAPAPEAAAKEVSE------
RS17_SYNR3       RCQVGDRVRITETRPLSRSKRWAVAEIMTTKSGS--------------------------
RS17_PROMA       NCKVGDRVRITETRPLSATKRWSVAEVLRTTKQE---------------KEAVK------
RS17_PROMT       HCKVGDRVRIKESPPISAHKRWTVTDVLVKGMKS---------------KEAAK------
RS17_PROMP       SCVLGDRVKIKETRPLSAHKRWAIEEILNKTIMS---------------KEDKK------
RS17_ACAM1       ACHVGDRVRIRESRPLSRTKRWAVTDVLVAANRP--------------------------
RS17_THEEB       EAKVGDRVRIRETRPLSRTKRWVIAEILSPRTA---------------------------
RS17_MICAN       QAKQGDRVRIRETRPLSKTKRWEVAEILTDS-----------------------------
RS17_SYNE7       RAKTGDRVRIQETRPLSRTKRWTVAEILESVGA---------------------------
RS17_GLOVI       RCKVGDRVRILESPPLSKTKRWVVLDILDEARNP--------------------------
RS17_TRIEI       KCNEGDRVRIRETRPLSRTKRWELSEIIGSKATL--------------------------
RS17_SYNJA       RCQEGDLVRITETRPLSRTKRWRVAEIIREVKKL--------------------------
RS17_SYNY3       QCQEGDKVRIQETRPLSKTKRWQVINIMSHSS----------------------------
RR17_TRICV       ECNIGDQVLVQECRPLSKRKRWTLSKVLSKSSLVS-------------------------
RR17_THAPS       ECNIGDQVLVQECRPLSKKKRWSVARIISRSSLIT-------------------------
RR17_PHATC       ECNIGDQVLVEECRPLSKRKRWKLIKILSKSSLIN-------------------------
RR17_PYRYE       ECTIGDIVTIQETRPLSRTKCWTMVNILSKS-FDN-------------------------
RR17_CYACA       ISRVGDKVIILQTRPLSKTKRWVIKSIL--------------------------------
RR17_GUITH       NCQVGDLILINETRPLSKTKRWMFKEIKQKSLKLDKDTIGE-------------------
RR17_CYAPA       ICKLGDEVKISEVKPISKTKRWIISEVLSSTVNPEKFGD---------------------
RR17_CYAM1       KASLGELIWIRTCRPISKTKKWIYDSSANASQSSR-------------------------
RS17_KORVE       TAHIGDYVRIEETRPLSKLKRWKLAEVLRRSALAPEVQEAAS------------------
RR17_EMIHU       NSKIGDKVKIQETRPISKSKNWILVSILEKSST---------------------------
RS17_BDEBA       QAKIGDIVKIRETRPLSKTKRWALAEVVETAKA---------------------------
RR17_GRATL       QCYIGDIVKIRPYRPLSKKKRWILIERIIEK-----------------------------
RS17_TREDE       TAHIGDTVRIVEHKPISKDKAWMLTEVIERAK----------------------------
RS17_TREPA       TARAGDVVRIAESRPLSRRKRWRLVEIVERAK----------------------------
RS17_RUBXD       EARVGDTVRIIETRPLSRRKRWRLASIISRAE----------------------------
RS17_LEUMM       AAKQGDIVQIMETRPLSATKHFRLVKIVEEAVIL--------------------------
RS17_OENOB       DAKLNDVVEIMETRPLSATKRFRLVRVVEKAVVL--------------------------
RS17_LACBA       EAHTGDIVEIMETRPLSATKRFRLVDIVEKAVII--------------------------
RS17_BACHD       SAKIGDIVRIQETRPLSKDKHFRLVEIVEEAVII--------------------------
RS17_LACP3       TAKTGDIVRIAETRPLSRNKRFRLLNIVEKAVII--------------------------
RS17_LACSS       EAKVGDVVRVMETRPLSRTKRFRLLDVVEKAVII--------------------------
RS17_LACPL       EAKTGDIVKIMETRPLSATKRFRLIEVVQKAVII--------------------------
RS17_STRMU       IAKAGDIVRIMETRPLSATKRFRLVEVVEEAVII--------------------------
RS17_LACDB       EAKVGDIVRIMETRPLSRTKRFRLVDIVKKSV----------------------------
RS17_LACJO       EAKIGDTVRIMETRPLSHAKRYRLTKIVKKSI----------------------------
RS17_MESFL       VAKIGDKVQIMETRPLSKTKNFRLVKVVEKAIL---------------------------
RS17_CLOBL       AANINDKVLIMETRPLSKQKRWRLVEVVEKAK----------------------------
RS17_CLOK5       EAKNNDKVLIMETRPLSKDKRWRLVEIVEKAK----------------------------
RS17_CLOD6       ICNIGDRVKIMETRPLSKDKRFRLVEVVEKVK----------------------------
RS17_CALS4       ICNVGDVVKIMETRPLSKEKRWRLVEVIKKAE----------------------------
RS17_DESHY       EAKTGDTVVIMETRPLSKDKRWRLIEITERAVAL--------------------------
RS17_SYNWW       EAKTGDIVKIMETRPLSKDKRWRLVEIVQKAKTLQ-------------------------
RS17_FUSNN       VAQVGDKVKIMETRRLSKDKNWRLVEIIEKAR----------------------------
RS17_ONYPE       EAKPGDLVNFMETRPLSKTKRFRLFKILSHA----KSAK---------------------
RS17_MYCS5       VAKVNDMVMIMETRPLSKTKHFRLYQVLSTASDVEKEAK---------------------
RS17_MYCMO       EAQMGDIVKIVGTRPLSKTKFFRLEKIRQRA----KEGKGSE------------------
RS17_MYCPU       KAKIGDIVKIIETRPISKTKKFRLDKIIELA----KEGN---------------------
RS17_MYCHJ       LAEVGDFVKIAECRPISKTKHFRLVEVLQKK----GEI----------------------
RS17_CORDI       IAGIGDLVRIEETRPLSKDKHFRLVEIVEKAK----------------------------
RS17_CORJK       TAGVGDRVRIEETRPLSKDKHFRLTEVIEKAR----------------------------
RS17_STRCO       AAGVGDRVLLMETRPLSATKRWRVVEVLEKAK----------------------------
RS17_FRACC       TTGVGDRVLLMETRPLSATKRWRIVQVLEKAK----------------------------
RS17_SALTO       SAGIGDRVLIMETRPLSATKRWRLVEILEKAK----------------------------
RS17_THEFY       IAGVGDRVRLMETRPLSATKRWRVVEILEKAK----------------------------
RS17_SACEN       TAGVGDRVLLMETRPLSASKRWRLVEVVEKAK----------------------------
RS17_TROWT       IAGVGDLVLISETRPISATKRWRLVQILEKAK----------------------------
RS17_LEIXX       VAGIGDLVLINETRPLSASKRWRLVEILEKAK----------------------------
RS17_MYCPA       IAGIGDRVSLMETRPTSATKRWRLVEILEKAK----------------------------
RS17_MYCLE       VAGIGDRVSLMETRPLSATKRWRLVEILEKAK----------------------------
RS17_RHOJR       VAGIGDRVQLMETRPLSATKHWRLVEVLEKAK----------------------------
RS17_BIFLO       DAHIGDLVSIMETRPLSKTKRWRLESIIERAK----------------------------
RS17_CUTAK       EAGMGDRVRIMETRPLSATKRWRLVEIIEKAK----------------------------
RS17_CHLTE       EAGVGDLVRITECRPLSKNKSCRLVEIVEKAK----------------------------
RS17_PORGI       ECGIGDTVRIMETRPLSRTKRWRLTEIIERAK----------------------------
RS17_CYTH3       ECGIGDTVRVMETRPLSKLKRWRLVEVIEKAK----------------------------
RS17_SALRD       EANEGDTVRIMETRPISKNKRWRLVEIIERAK----------------------------
RS17_ARCB4       ELNVGDSVIAIECRPLSKTKSFRLKTIVATGVK---------------------------
RS17_SULDN       ELKVGDEIVAIECRPLSKTKSYRLKSVVV-GVK---------------------------
RS17_CAMC5       ETNAGDTIVAVECRPLSARKSFRLKAIVAKGVE---------------------------
RS17_CAMHC       AVKIGDTISAVECRPLSAKKSFRLKAVLKAGVE---------------------------
RS17_WOLSU       AVKVGDMIEAIECRPLSKRKSFSLHKVLSVGVEA--------------------------
RS17_CAMJD       EVKVGDTVVAVECRPLSKRKSFRLKSVLATGVE---------------------------
RS17_NITSB       KAKVGDIVTAVECRPISKRKSFRLKEIVQAGVE---------------------------
RS17_HELAH       QVKVGDFVSAIECKPLSKTKSFTLKEILVVGV----------------------------
RS17_HELHP       SAKIGDVVSAIECKPISKTKAFRFKEIITAGVEL--------------------------
RS172_BACTN      ECSVGDRVLAHETRHFSKTKYFRFYRKLY-------------------------------
RS17_LEPBJ       ECTIGDKILAIETRPLSREKRHRLYRIVEKAK----------------------------
RS17_SYNAS       ECKVGDTVIVMESRPLSRLKRWRMLRIVAKAE----------------------------
RS17_DEHM1       EAKIGDMIEIVKCRPISKGKYWRLNRIITKGHIVAA------------------------
RS17_BORAP       VSKVGDKVKIIEVRPISKDKRWSLVEVLEKLK----------------------------
RS17_RHOBA       ESGVGDKVEIIESEPLSKLKRWRLVRVLEKSTAVDVVALRAARKNAEAEGLAAAHAGEPE
RS17_DESAG       ECKVGDKVKIIEFRPVSRNKRWHLVSILEKAV----------------------------
RS17_LAWIP       ECSIGDTVKIIEFRPLSRNKRWHLVAILEKAV----------------------------
                     .:          *  *                                        

RS17_FERNB       --------
RS17_THEM4       --------
RS17_THEP1       --------
RS17_PSELT       --------
RS17_MYCGE       --------
RS17_MYCPN       --------
RS17_MYCGA       --------
RS17_UREP2       --------
RS17_MYCPE       --------
RS17_AQUAE       --------
RS17_GEOSL       --------
RS17_PELPD       --------
RS17_PELCD       --------
RS17_SYNFM       --------
RS17_DESPS       --------
RS17_CALS8       --------
RS17_SYMTH       --------
RS17_MOOTA       --------
RS17_CARHZ       --------
RS17_PELTS       --------
RS17_ROSS1       --------
RS17_ANADF       --------
RS17_MYXXD       --------
RS17_CHLMU       --------
RS17_CHLFF       --------
RS17_CHLPN       --------
RS17_PARUW       --------
RS17_ECOLI       --------
RS17_YERP3       --------
RS17_HISS2       --------
RS17_MANSM       --------
RS17_PSEHT       --------
RS17_VIBPA       --------
RS17_SHEFN       --------
RS17_SHESH       --------
RS17_BAUCH       --------
RS17_BUCAP       --------
RS17_BUCCC       --------
RS17_BUCBP       --------
RS17_BLOFL       --------
RS17_BLOPB       --------
RS17_WIGBR       --------
RS17_HYDCU       --------
RS17_FRAP2       --------
RS17_PSYCK       --------
RS17_PSYWF       --------
RS17_COLP3       --------
RS17_MARMS       --------
RS17_ALCBS       --------
RS17_ACIAD       --------
RS17_CHRSD       --------
RS17_HAHCH       --------
RS17_SACD2       --------
RS17_PSEU5       --------
RS17_MARHV       --------
RS17_LEGPH       --------
RS17_PSEA6       --------
RS17_IDILO       --------
RS17_COXBN       --------
RS17_DICNV       --------
RS17_METCA       --------
RS17_ALKEH       --------
RS17_HALHL       --------
RS17_NITOC       --------
RS17_XANC8       --------
RS17_XYLFT       --------
RS17_GLUOX       --------
RS17_GRABC       AEHQGA--
RS17_ACICJ       --------
RS17_RHORT       --------
RS17_SPHAL       --------
RS17_ZYMMO       --------
RS17_SPHWW       --------
RS17_ERYLH       --------
RS17_SINMW       --------
RS17_OCHA4       --------
RS17_RHILO       --------
RS17_CHESB       --------
RS17_BRADU       --------
RS17_AZOC5       --------
RS17_ROSDO       --------
RS17_JANSC       --------
RS17_PARDP       --------
RS17_MAGSA       --------
RS17_CAUSK       --------
RS17_MARMM       --------
RS17_PARL1       --------
RS17_HYPNA       --------
RS17_MAGMM       --------
RS17_RICBR       --------
RS17_ORITB       --------
RS17_THET8       --------
RS17_PELUB       --------
RS17_DEIRA       --------
RS17_EHRCR       --------
RS17_EHRRW       --------
RS17_ANAPZ       --------
RS17_WOLTR       --------
RS17_VEREI       --------
RS17_METPP       --------
RS17_AROAE       --------
RS17_PARXL       --------
RS17_RALSO       --------
RS17_POLAQ       --------
RS17_BORA1       --------
RS17_DECAR       --------
RS17_NEIG1       --------
RS17_CHRVO       --------
RS17_METFK       --------
RS17_THIDA       --------
RS17_NITMU       --------
RS17_NITEU       --------
RS17_NITEC       --------
RS17_PROMM       --------
RS17_SYNPX       --------
RS17_SYNR3       --------
RS17_PROMA       --------
RS17_PROMT       --------
RS17_PROMP       --------
RS17_ACAM1       --------
RS17_THEEB       --------
RS17_MICAN       --------
RS17_SYNE7       --------
RS17_GLOVI       --------
RS17_TRIEI       --------
RS17_SYNJA       --------
RS17_SYNY3       --------
RR17_TRICV       --------
RR17_THAPS       --------
RR17_PHATC       --------
RR17_PYRYE       --------
RR17_CYACA       --------
RR17_GUITH       --------
RR17_CYAPA       --------
RR17_CYAM1       --------
RS17_KORVE       --------
RR17_EMIHU       --------
RS17_BDEBA       --------
RR17_GRATL       --------
RS17_TREDE       --------
RS17_TREPA       --------
RS17_RUBXD       --------
RS17_LEUMM       --------
RS17_OENOB       --------
RS17_LACBA       --------
RS17_BACHD       --------
RS17_LACP3       --------
RS17_LACSS       --------
RS17_LACPL       --------
RS17_STRMU       --------
RS17_LACDB       --------
RS17_LACJO       --------
RS17_MESFL       --------
RS17_CLOBL       --------
RS17_CLOK5       --------
RS17_CLOD6       --------
RS17_CALS4       --------
RS17_DESHY       --------
RS17_SYNWW       --------
RS17_FUSNN       --------
RS17_ONYPE       --------
RS17_MYCS5       --------
RS17_MYCMO       --------
RS17_MYCPU       --------
RS17_MYCHJ       --------
RS17_CORDI       --------
RS17_CORJK       --------
RS17_STRCO       --------
RS17_FRACC       --------
RS17_SALTO       --------
RS17_THEFY       --------
RS17_SACEN       --------
RS17_TROWT       --------
RS17_LEIXX       --------
RS17_MYCPA       --------
RS17_MYCLE       --------
RS17_RHOJR       --------
RS17_BIFLO       --------
RS17_CUTAK       --------
RS17_CHLTE       --------
RS17_PORGI       --------
RS17_CYTH3       --------
RS17_SALRD       --------
RS17_ARCB4       --------
RS17_SULDN       --------
RS17_CAMC5       --------
RS17_CAMHC       --------
RS17_WOLSU       --------
RS17_CAMJD       --------
RS17_NITSB       --------
RS17_HELAH       --------
RS17_HELHP       --------
RS172_BACTN      --------
RS17_LEPBJ       --------
RS17_SYNAS       --------
RS17_DEHM1       --------
RS17_BORAP       --------
RS17_RHOBA       TESAATDA
RS17_DESAG       --------
RS17_LAWIP       --------