CLUSTAL format seed alignment for MF_01346

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPA_MYCGE       ---MADKLNEYVALIKTEIKKYSKKIF-NSEIGQVISVADGIAKVSGLENALLNELIQFE
ATPA_MYCPN       ---MADKLNEYVALIKNEIKKYSKQIF-NSEIGKVISVADGIAKVSGLENALLNELIEFE
ATPA_MYCGA       ---MAINLNEYSLLIKDQIKKYANKII-SDQKGYIITIGDGIVRVSGLDDVLLNELVEFE
ATPA_ANTAG       --MVNIRPDEISNIIRKQIEQYNQEVK-VINIGTVLQVGDGIARIYGLDKVMAGELVEFE
ATPA_MARPO       --MVNIRPDEISSIIRKQIEQYNQEVK-IVNIGTVLQVGDGIARIYGLDKVMAGELVEFE
ATPA_ADICA       -MVINIQPDEIGSIIRKQIKGYVPEMK-VVNIGTVLQVGDGIARIHGLDEVMAGELVEFE
ATPA_PINTH       --MGSIRLDEISSIIRKQIEQYNNEVR-VGNLGTVLQVGDGIARIHGLDEVMAGELVEFG
ATPA_SPIOL       --MATIRADEISKIIRERIEGYNREVK-VVNTGTVLQVGDGIARIHGLDEVMAGELVEFE
ATPA_TOBAC       --MVTIRADEISNIIRERIEQYNREVK-IVNTGTVLQVGDGIARIHGLDEVMAGELVEFE
ATPA_ARATH       --MVTIRADEISNIIRERIEQYNREVT-IVNTGTVLQVGDGIARIYGLDEVMAGELVEFE
ATPA_LOTJA       --MVTIRADEISKIIRERIEQYNTEIK-IVNTGTVLQVGDGIARIYGLDEVMAGELVEFE
ATPA_PEA         --MVTSRADEISQIIRKRIEQYNTEVK-IVNTGTVLQVGDGIARIYGLDDVMAGELVEFK
ATPA_OENEH       --MATIRADEISNIIRERIEQYNREVK-IVNTGTVLQVGDGIARIYGLDEVMAGELVEFE
ATPA_ORYNI       --MATLRVDEIHKILRERIEQYNRKVG-IENIGRVVQVGDGIARIIGLGEIMSGELVEFA
ATPA_ORYSA       --MATLRVDEIHKILRERIEQYNRKVG-IENIGRVVQVGDGIARIIGLGEIMSGELVEFA
ATPA_MAIZE       --MATLRVDEINKILRERIEQYNRKVG-IENIGRVVQVGDGIARIIGLGEIMSGELVEFA
ATPA_WHEAT       --MATLRVDEIHKILRERIEQYNRKVG-IENIGRVVQVGDGIARIIGLGEIMSGELVEFA
ATPA_MESVI       --MIKIQPEEISSVIRKQIEQYNQEVK-VVNTGTVLQVGDGIARIYGLAKAMAGELLEFE
ATPA_CHLRE       --MAMRTPEELSNLIKDLIEQYTPEVK-MVDFGIVFQVGDGIARIYGLEKAMSGELLEFE
ATPA_CHLVU       --MVKIRPDEISSIIKQQIEQYQQEVK-AVNVGTVFQVGDGIARIYGLDKVMAGELVEFE
ATPA_NEPOL       --MVKIRPDEISNIIRQQIEQYSQEVK-VVSVGTVLQVGDGIARIYGLEKVMAGELLEFE
ATPA_EUGGR       --MIRVRPNEVTRIIRQQVKKYRQELK-IVNVGTVLQVGDGIARIYGLEKVMAGELVEFD
ATPA_NOSS1       -MSISIRPDEISSIIQQQIEQYDQEVK-VANVGTVLQVGDGIARIYGLEKAMAGELLEFE
ATPA_SYNP6       --MVSIRPDEISSIIRQQIEQYSQDVK-VENVGTVLQVGDGIARIYGLQQVMSGELVEFE
ATPA_SYNY3       --MVSIRPDEISSIIRQQIESYDQSVQ-VSNVGTVLQVGDGTARIYGLEQVMSQELLEFE
ATPA_ANTSP       --MVNIRPDEISNIIRQQIDNYDQEVQ-VANIGTVLQVGDGIARVYGLDEVMAGELLQFE
ATPA_PORPU       --MVNIRPDEISSIIRQQIEKYDQDVE-VANIGTVLQVGDGIARVYGLDEVMAGELLEFE
ATPA_GALSU       --MVNIRPDEISTIIKEQIEKYETEVR-FSAVGTVLQVGHGIARVYGLEEVMAGELLEFE
ATPA_CYACA       --MSNIRPDEISSILKQQIERYNESVK-IENTGTVLQVGDGIARIYGLDNIMAGELLEFE
ATPA_GUITH       --MVNIRPDEISSIIRQQIDKYDQAIQ-VSNVGTVLQIGDGIARVYGLDQVMAGELLEFE
ATPA_TRICV       --MINIRPDEISSIIREQIEQYDQDVK-VDNIGTVLQVGDGIARVYGLDQVMSGELLEFE
ATPA_SYNP1       --MVSIRPDEISSIIRQQIEQYEQSIN-VDNVGTVLQVGDGIARVYGLDKVMASELVEFE
ATPA_CYAPA       --MVSIRPDEISSIIRQQIEQYDQEIQ-VSNVGTVLQVGDGIARVYGLDKVMSGELLEFE
ATPA_MYCTU       MAELTIPADDIQSAIEEYVSSFTADTS-REEVGTVVDAGDGIAHVEGLPSVMTQELLEFP
ATPA_MYCBO       MAELTIPADDIQSAIEEYVSSFTADTS-REEVGTVVDAGDGIAHVEGLPSVMTQELLEFP
ATPA_MYCLE       MAELTISADDIQNAIEEYVSSFTADTF-REEVGTVVDVGDSIAHVEGLPSVMTQELLEFP
ATPA_STRLI       MAELTIRPEEIRDALENFVQSYKPDAASREEVGTVTLAGDGIAKVEGLPSAMANELLKFE
ATPA_AQUAE       MATLTY--EEALEILRQQIKDFEPEAK-MEEVGVVYYVGDGVARAYGLENVMAMEIVEFQ
ATPA_RHOBL       ---MGIQAAEISAILKEQIKNFGKDAE-VAEVGRVLSVGDGIARVYGLDNVQAGEMVEFP
ATPA_RHOCA       ---MGIQAAEISAILKEQIKNFGQDAQ-VAEVGRVLSVGDGIARVHGLDNVQAGEMVEFP
ATPA_RHORU       ---MEIRAAEISAILKEQIANFGTEAE-SAEVGQVLSVGDGIARVYGLDNVQAGEMVEFA
ATPA_RICCN       ---MKLKPIEVAEILQKEIANINCLSE-LEEVGQVITVGDGIAQIYGLANVKSGEVVEFK
ATPA_RICPR       ---MKLNPIEVAEILQKEIANINFLSE-LEEVGQVISVGDGIAKIYGLANVKSGEVVEFK
ATPA_MYXXA       ---MEIRADEISRIIREQIKDYGKKVT-VAETGTVLSVGDGIARIYGLEGALAGELVEFA
ATPA_PROMO       ---MKIRPEEISGIIKTEIENYKKSLD-VKTSGSVVQVGDGIARIYGLSNAKAGELLEFP
ATPA_CLOAB       ---MNIKPEEITSIIKSQIEGYESKLE-TVDSGTIIEIGDGIARIYGLQNCMAGELLEFP
ATPA_CLOPE       ---MHIKPEEITSIIKNEIKNYEKELE-TVDSGTIIQIGDGVARVYGLEECMEGELLEFP
ATPA_ACEWD       ---MNLRPEEISQIIKNEIERYEDKLE-VVDVGTVIQVGDGVARVHGLENAMAGELLAFP
ATPA_BACHD       ---MSIKPEEISSLIKQQIENFQSDVQ-VQDVGTVIRVGDGIALAHGLESVMAGELLEFS
ATPA_BACPE       ---MSIKPEEISSLIKQQIESFQSDVQ-VQDVGTVIRVGDGIALAHGLENVMAGELLEFS
ATPA_BACMQ       ---MSIKAEEISALIKQQIENYQSEIK-VSDVGTVIQVGDGIARAHGLDNVMAGELVEFS
ATPA_BACSU       ---MSIKAEEISTLIKQQIQNYQSDIE-VQDVGTVIQVGDGIARVHGLDNCMAGELVEFS
ATPA_BACP3       ---MSIRAEEISALIKQQIENYESQIQ-VSDVGTVIQVGDGIARAHGLDNVMSGEAVEFA
ATPA_GEOSE       ---MSIRAEEISALIKQQIENYESQIQ-VSDVGTVIQIGDGIARAHGLDNVMSGELVEFA
ATPA_STAAM       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAAN       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAAR       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAAS       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAAW       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAAC       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAES       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_STAEQ       ---MAIKAEEISALLRSQIENYESEMS-VTDVGTVLQIGDGIALIHGLNDVMAGELVEFH
ATPA_LACLA       ---MAIKANEISSLIKKQIENFTPDFE-VAETGVVTYVGDGIARAYGLENAMSGELVEFS
ATPA_LACLM       ---MAIKANEISSLIKKQIENFTPDFE-VAETGVVTYVGDGIARAYGLENAMSGELVEFS
ATPA_STRMU       ---MAINAQEISALIKKQIENFQPNFD-VTETGVVTYIGDGIARACGLDNAMSGELLEFD
ATPA_ENTHA       ---MAIKAEEISALIKEQIENYQNVLS-VEEIGTVTYVGDGIARAHGLENAMSGELLEFS
ATPA_BUCAI       ---MRLNSTEISKLIKERIAQFEVFNQ-SYNEGSIISVSDGIIKINGLSNVMLGEMILLP
ATPA_BUCAP       ---MQLNSTEISQLIKERIAQFEVFNQ-SYNEGTIISVNDGIIKIYGLSDVMLGEMILLP
ATPA_ECOLI       ---MQLNSTEISELIKQRIAQFNVVSE-AHNEGTIVSVSDGVIRIHGLADCMQGEMISLP
ATPA_ECO57       ---MQLNSTEISELIKQRIAQFNVVSE-AHNEGTIVSVSDGVIRIHGLADCMQGEMISLP
ATPA_ECOL6       ---MQLNSTEISELIKQRIAQFNVVSE-AHNEGTIVSVSDGVIRIHGLADCMQGEMISLP
ATPA_SHIFL       ---MQLNSTEISELIKQRIAQFNVVSE-AHNEGTIVSVSDGVIRIHGLADCMQGEMISLP
ATPA_HAEIN       ---MQLNSTEISELIKKRIAQFDVVSE-ARNTGTIVSVSDGIIRIHGLSDVMQGEMIALP
ATPA_PASMU       ---MQLNSTEISELIKKRIAQFDVVSE-ARNTGTIVSVSDGIIRIHGLSEVMQGEMIALP
ATPA_VIBAL       ---MQLNSTEISDLIKQRIESFEVVSE-ARNEGTIVSVSDGIIRIHGLADVMQGEMIELP
ATPA_VIBCH       ---MQLNSTEISDLIKQRIESFNVVSE-ARNEGTIVSVSDGIIRIHGLADVMQGEMIELP
ATPA_BUCBP       ---MQISSSEICELISKKIAKFDIISS-MHNEGRVISVSDGIIQIYGLSDVMQGEMLSLP
ATPA_ACIFR       --MQQLNPSEISELIRARIAGFEGRVE-TRSQGTIISLSDGILRIHGLEDVMYGEMLELP
ATPA_HELPY       --MSQLKLEEISSVIEEKIKNFELDCD-MAEVGKVVSYADGVAKVYGLNGVMSYEVLEFE
ATPA_HELPJ       --MSQLKLEEISSVIEEKIKNFELDCD-MAEVGKVVSYADGVAKIYGLNGVMSYEVLEFE
ATPA2_MYCPU      --------MDNAKIVIKSIKDYIVEVQ-------------------GDYDFRLYEVFQLT
                          :    :   :                           *       * . : 

ATPA_MYCGE       NN--IQGIVLNLEQNTVGIALFGDYSSLREGSTAKRTHSVMKTPVGDVMLGRIVNALGEA
ATPA_MYCPN       NN--VQGIALNLEQNTVGVALFGDYSKIREGSTAKRTHNVMQTPVGDVMLGRIVNALGEP
ATPA_MYCGA       NG--AYGIALNLEPNSVGVVMLSDYYDLKEGSSVKRTGKVIQAPVGDGLLGRVIDPIGLP
ATPA_ANTAG       DG--TVGIALNLESDNVGVVLMGDGLSIQEGSSVEATGKIAQIPVSDAYLGRVVNALAQP
ATPA_MARPO       DG--TVGIALNLESDNVGAVLMGDGLTIQEGSSVKATGKIAQIPVSDAYLGRVVNALAQP
ATPA_ADICA       DG--TVGIALNLESDNVGAVLMGDGLTIREGGSVRATGKIAQIPVSDSFLGRVVNALAQP
ATPA_PINTH       DG--TVGIALNLGSDNVGAVLMGDGLMIQEGSSVRATGKIAQIPVSDAYLGRVVNALAQP
ATPA_SPIOL       EG--TIGIALNLESNNVGVVLMGDGLMIQEGSSVKATGRIAQIPVSEAYLGRVINALAKP
ATPA_TOBAC       EG--TIGIALNLESNNVGVVLMGDGLLIQEGSSVKATGRIAQIPVSEAYLGRVINALAKP
ATPA_ARATH       EG--TIGIALNLESNNVGVVLMGDGLMIQEGSSVKATGKIAQIPVSEAYLGRVINALANP
ATPA_LOTJA       EG--TIGIALNLESKNVGVVLMGDGLMIQEGSSVKATGRIAQIPVSEGYLGRVINALAKP
ATPA_PEA         EG--TVGIALNLESKNVGVVLMGDGLMIQEGSSVKATGRIAQIPVSEGYLGRVVNALAKP
ATPA_OENEH       EG--TIGIALNLESKNVGVVLMGDGLLIQEGSSVKATGRIAQIPVSEAYLGRVINALAKP
ATPA_ORYNI       EG--TRGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLGRVINALAKP
ATPA_ORYSA       EG--TRGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLGRVINALAKP
ATPA_MAIZE       EG--TRGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLGRVINALAKP
ATPA_WHEAT       EG--TRGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLGRVVNALAKP
ATPA_MESVI       DG--TVGIALNLESNNVGAVLMGDGFSIQEGSRVKATGKIAQIPIGESYIGRVVDALARP
ATPA_CHLRE       DG--TLGIALNLEANNVGAVLLGDGLKITEGSRVRCTGKIAEIPVGEAYLGRVVDGLARP
ATPA_CHLVU       DG--TVGIALNLEAKNVGAVLMGEGTRVQEGSSVRATGKIAQIPVGDGYLGRVVNSLARP
ATPA_NEPOL       DG--TVGIALNLEADNVGAVLMGSGLSIQEGSAVKATGKIAQVPVGEAFLGRVVNALARP
ATPA_EUGGR       EG--TIGIALNLEADNVGAVLMGEATNLKEGASVKTTGKIAQIPVGRGFLGRVVDALARP
ATPA_NOSS1       DG--TVGIAQNLEEDNVGAVLMGEGREIQEGSTVTATGRIAQIGVGEALIGRVVDALGRA
ATPA_SYNP6       DG--TTGIALNLEEDNVGAVLMGEGRNIQEGSTVKATGKIAQIPVGDALVGRVVSPLGAP
ATPA_SYNY3       DG--TIGIALNLEEDNVGAVLMGDGFGIQEGSTVKTTGQIAQIPIGDAMVGRVVDSLGRP
ATPA_ANTSP       DKEQTVGIALNLESDNVGVVLMGDGRNILEGSSVKSTGKIAQIPVGDEFLGRVVNPLAKP
ATPA_PORPU       DK--TIGVALNLESDNVGVVLMGDGRDILEGSSVKGTGKIAQIPVGDAFLGRVVDPLARP
ATPA_GALSU       DK--TIGIALNLENDNVGVVLMGDDSNILEGSPVKSTGKIAEIPVGEEFLGRVVNALGKS
ATPA_CYACA       EK--TIGIALNLETDNVGAVLMGDGRDILEGSSVKGTGKIAQIGVGDNLLGRVLNALGNP
ATPA_GUITH       DK--TIGIALNLESDNVGVVLMGEGRGILEGSSVKATGKIAQVPVGKSYLGRVVNALGTP
ATPA_TRICV       DK--TIGIALNLENDNVGVVLMGNGRQILEGSTVKTTGQIAQIPTGEAFLGRVVNPLGAP
ATPA_SYNP1       DG--TVGIALNLEEDNVGVVLMGAGLGIEEGSTVRATGKIASVPVGEAVIGRVVDALMRP
ATPA_CYAPA       DG--TIGIALNLEADNVGVVLMGDGRNILEGSSVRATQKIAQVPVGDAVIGRVVDALARP
ATPA_MYCTU       GG--ILGVALNLDEHSVGAVILGDFENIEEGQQVKRTGEVLSVPVGDGFLGRVVNPLGQP
ATPA_MYCBO       GG--ILGVALNLDEHSVGAVILGDFENIEEGQQVKRTGEVLSVPVGDGFLGRVVNPLGQP
ATPA_MYCLE       GG--ILGVALNLDEHNVGAVILGDFENIKEGQKVKRTGDVLSVPVGEAFMGRVVNPLGQP
ATPA_STRLI       DG--TLGLALNLEEREIGCVVLGEFSGIEEGQPVSRTGEVLSVAVAEGYLGRVVDPLGNP
ATPA_AQUAE       GG--QQGIAFNLEEDNVGIIILGSETGIEEGHIVKRTGRILDAPVGEGLVGRVIDPLGNP
ATPA_RHOBL       GG--IRGMALNLEVDNVGIVIFGDDRDIKEGDTVKRTKSIVDVPAGNGLLGRVVDALGNP
ATPA_RHOCA       GG--IRGMALNLEVDNVGIVIFGSDRDIKEGDTVKRTNAIVDVPAGEGLLGRVVDGLGNP
ATPA_RHORU       NG--VKGMALNLESDNVGIVIFGEDRGIKEGDVVKRTQTIVDVPVGKGLLGRVVDGLGNP
ATPA_RICCN       SG--VKGLVLNLENDSVGAVIMGDDNQVQQGDNVKRTKAVLEVPVGKALLGRVVDALGNP
ATPA_RICPR       SG--VKGLILNLENDSVGAVIMGDYSKVKQGDNVKRTKDVLKVLVGKALLGRTVDALGNP
ATPA_MYXXA       NG--VQGLVLNLEEDNVGVAIMGDFQAIREGDTVKRTQQIASVPVGKELLGRVVDPLGKP
ATPA_PROMO       NG--ITGMALNLEENNVGAVILGDPTGVKEGDEVRATGQIAAVGAGEALLGRVVNSLGEP
ATPA_CLOAB       ND--VYGMALNLEQDNVGCVLLGSEEGIKEGDIVKSTGKVVEVPVGEEMLGRVVNALGQP
ATPA_CLOPE       NQ--VFGMALNLEQDNVGCVLLGSEEGIKEGDIVKRTGKIVEVPVGEDLIGRVVNSLGQP
ATPA_ACEWD       NE--VYGMVLNLEEDNVGCVLLGYDDDIVEGDIVRCTGRIVEVPVGEAMIGRVVNALGFP
ATPA_BACHD       NG--VMGMAQNLEENNVGIIILGPYSEIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQP
ATPA_BACPE       NG--VMGMAQNLEENNIGIIILGPYTDIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQP
ATPA_BACMQ       NG--VMGMAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMEVPVGEQLIGRVVNSLGQP
ATPA_BACSU       NG--VLGMAQNLEESNVGIVILGPFSEIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQP
ATPA_BACP3       NA--VMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGETLIGRVVNPLGQP
ATPA_GEOSE       NA--VMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQP
ATPA_STAAM       NG--VLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQP
ATPA_STAAN       NG--VLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQP
ATPA_STAAR       NG--VLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQP
ATPA_STAAS       NG--VLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQP
ATPA_STAAW       NG--VLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQP
ATPA_STAAC       NG--VLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQP
ATPA_STAES       NG--VLGLAQNLEESNVGVVILGPYEEISEGDEVKRTGRIMEVPVGEEMIGRVVNPLGQP
ATPA_STAEQ       NG--VLGLAQNLEESNVGVVILGPYEEISEGDEVKRTGRIMEVPVGEEMIGRVVNPLGQP
ATPA_LACLA       NG--VLGMAQNLDATDVGIIVLGDFLSIREGDTVKRTGKIMEIQVGEELIGRVVNPLGQP
ATPA_LACLM       NG--ILGMAQNLDATDVGIIVLGDFLSIREGDTVKRTGKIMEIQVGEELIGRVVNPLGQP
ATPA_STRMU       NG--TFGMAQNLESSDIGIIILGDFNSIREGDTVKRTGKIMEVPVGQSLIGRVVNPLGQP
ATPA_ENTHA       NG--SYGMAQNLESNDVGIIILGDFESIREGDKVKRTGKIMEVPVGDALIGRVVNPLGQP
ATPA_BUCAI       NN--EYAIALNIERDTVGAVVMGPYIHISEGAKVRCTGKILEVPVGDNFLGRVVNALGFP
ATPA_BUCAP       DN--EYAIALNIERDTIGAVVMGPYIHITEGTKVRCTGKILEVPVGVALLGRIVNALGFP
ATPA_ECOLI       GN--RYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAP
ATPA_ECO57       GN--RYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAP
ATPA_ECOL6       GN--RYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAP
ATPA_SHIFL       GN--RYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAP
ATPA_HAEIN       GN--RYAMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLLGRVVNTLGQP
ATPA_PASMU       GN--RYAMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLLGRVVNTLGEP
ATPA_VIBAL       GG--RYALALNLERDSVGAVVMGPYADLKEGMKVTGTGRILEVPVGPELLGRVVNTLGEP
ATPA_VIBCH       GN--RYALALNLERDSVGAVVMGPYADLREGMKVTGTGRILEVPVGPELLGRVVNTLGEP
ATPA_BUCBP       GD--KYAIALNLEKNVVGAIVMGEYTHITEGTKIISTGRIFEIPVGSKFLGRVINALGVP
ATPA_ACIFR       GG--RFGLAMNLEQDNVGAVVLGEFSGLQEGDVVKCTGRVMQVPIGKALLGRVVNALGQP
ATPA_HELPY       TG--DKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEP
ATPA_HELPJ       TG--DKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEP
ATPA2_MYCPU      DD--VKGFCLSVDEKRTFLLIDGDTSKIKVGTEIIPLESRFIAKTYKDYFGKIIDIDGKV
                       ..  .:        : .    :  *                  .*: :.     

ATPA_MYCGE       IDGRGD-----IKA-TEYDQIEKIAPGVMKRKSVNQPLETGILTIDALFPIGKGQRELIV
ATPA_MYCPN       VDGRGP-----IKA-EEFDQVEKIAPGVMTRKTVNQPLETGILTIDALFPIGKGQRELIV
ATPA_MYCGA       IDGKGE-----LKNISGYAPIERLAYGVMQRKSVHQPLETGILAIDSMLPIGKGQRELII
ATPA_ANTAG       IDGKGQ-----IPA-YEFRLIESPAPGIISRRSVYEPMQTGLIAIDSMIPIGRGQRELII
ATPA_MARPO       IDGKGQ-----IPA-SEFRLIESPAPGIISRRSVYEPMQTGLIAIDSMIPIGRGQRELII
ATPA_ADICA       IDGKGQ-----IPA-SEFRLIESSAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_PINTH       IDGKGK-----ISA-SEFRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_SPIOL       IDGRGE-----ITA-SESRLIESPAPGIMSRRSVYEPLQTGLIAIDAMIPVGRGQRELII
ATPA_TOBAC       IDGRGE-----ISA-SEFRLIESAAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_ARATH       IDGRGK-----ISA-SESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_LOTJA       IDGRGE-----ISS-SESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_PEA         IDGRGE-----IST-SESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_OENEH       IDGRGE-----ISS-SESRLIESPAPGIISRRSVYEPLQTGLIAIDAMIPIGRGQRELII
ATPA_ORYNI       IDGRGE-----IVA-SESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_ORYSA       IDGRGE-----IVA-SESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_MAIZE       IDGRGE-----IVA-SESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_WHEAT       IDGKGE-----IIA-SESRLIESPAPSIISRRSVYEPLQTGLIAIDSMIPIGRGQRELII
ATPA_MESVI       IDGKGD-----IPS-SETRLIESPAPGIISRRSVYEPLQTGLVSVDAMIPIGRGQRELII
ATPA_CHLRE       VDGKGA-----VQT-KDSRAIESPAPGIVARRSVYEPLATGLVAVDAMIPVGRGQRELII
ATPA_CHLVU       IDGKGE-----IAT-KENRLIESPAPGIISRRSVHEPLQTGIVAIDAMIPIGRGQRELII
ATPA_NEPOL       IDGKGD-----IAS-KESRLLEGPAPGIIERRSVYEPMQTGLIAIDAMIPIGRGQRELII
ATPA_EUGGR       IDGKGD-----IAS-FTTRLIESPAPGIVSRRSVHEPLQTGLIAIDAMIPIGRGQRELII
ATPA_NOSS1       IDGKGD-----IKA-SESRLIESPAPGIIARRSVHEPMQTGITAIDSMIPIGRGQRELII
ATPA_SYNP6       LDGKGE-----IAA-TENRLIESPAPGIIARRSVHEPMQTGITAIDAMIPIGRGQRELII
ATPA_SYNY3       IDGKGP-----ISS-TATRLLESPAPGIIERKSVCEPMQTGITAIDAMIPIGRGQRELII
ATPA_ANTSP       IDAKGT-----PSV-QDTRLIESYAPGIIGRQSVCEPLQTGITAIDSMIPIGRGQRELII
ATPA_PORPU       IDNKGE-----PAS-NGTRLIESMAPGIIGRQSVCEPMQTGITAIDSMIPIGRGQRELII
ATPA_GALSU       IDGKVE-----PVC-SENRLIEMLAPGIIVRQSVCEPLQTGITAIDSMIPIGRGQRELII
ATPA_CYACA       IDGKPN-----PNS-TDYRLIEFNAPGIVSRRSVCEPIQTGITAIDAMIPIGRGQRELII
ATPA_GUITH       IDGKGD-----INC-SETRLIESIAPGIISRKSVCEPIQTGITAIDSMIPIGRGQRELII
ATPA_TRICV       IDGKGD-----IAN-TETRLLEAMAPGIISRKSVCEPLQTGITSIDAMIPIGRGQRELII
ATPA_SYNP1       IDGKGE-----IHA-TATRLLESPAPGIVQRKSVCEPLQTGITAIDAMIPIGRGQRELII
ATPA_CYAPA       IDGKGD-----IAT-TDTRLIESSAPGIISRKFVYEPLQTGITAIDAMIPIPRGQRELII
ATPA_MYCTU       IDGRGD-----VDS-DTRRALELQAPSVVHRQGVKEPLQTGIKAIDAMTPIGRGQRQLII
ATPA_MYCBO       IDGRGD-----VDS-DTRRALELQAPSVVHRQGVKEPLQTGIKAIDAMTPIGRGQRQLII
ATPA_MYCLE       IDGRGD-----IEA-EARRALELQAPSVVQRQSVKEPLQTGIKAIDAMTPIGRGQRQLVI
ATPA_STRLI       IDGLGE-----IET-SGRRALELQAPTVMQRKSVHEPMETGYKAVDAMTPIGRGQRQLII
ATPA_AQUAE       LDGKGP-----IQF-EYRSPVEKIAPGVVKRKPVHEPLQTGIKAIDAMIPIGRGQRELII
ATPA_RHOBL       IDGKGP-----IVA-SERRIADVKAPGIIPRKGVHEPMATGLKAVDAMIPIGRGQRELII
ATPA_RHOCA       IDGKGP-----IVA-KERRIADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELII
ATPA_RHORU       IDGKGD-----LVD-VERKRAEVKAPGIIPRKSVHEPVQTGIKAIDSLIPIGRGQRELII
ATPA_RICCN       IDGKGD-----IAS-KEYRHIEMKAPGIIERTSVSEPVQTGIKAIDSLIPIGRGQRELII
ATPA_RICPR       IDGKGD-----IVS-KEYRHIEMKAPGIIERMSVSEPVQTGIKAIDSLIPIGRGQRELII
ATPA_MYXXA       LDGKGP-----IAA-TETRRLEVKAPGIVSRKSVHEPLQTGIKALDALVPVGRGQRELII
ATPA_PROMO       IDGKGE-----LKT-EKMMPLDRKAYGIISRKPVHEPLQTGIKSIDGMVPIGRGQRELII
ATPA_CLOAB       IDGKGP-----IKA-EDSKPVDIKATGVIDRQSVNQPLQTGIKAIDSMIPIGKGQRELII
ATPA_CLOPE       IDGKGP-----IKN-DGYRAIEVPAPGILERSSVNEPLQTGIKAIDSMIPIGRGQRELII
ATPA_ACEWD       VDGKGP-----IVT-DHRRPVEVKAAGVIERESVNQPIQTGYKAIDSMIPIGRGQRELII
ATPA_BACHD       IDGRGP-----IET-SKTRPIESPAPGVMDRKSVHEPLQTGIKSIDSMIPVGRGQRELII
ATPA_BACPE       IDGLGP-----IAT-TKSRPIESPAPGVMDRKSVHEPLQTGIKSIDTMIPIGRGQRELII
ATPA_BACMQ       VDGLGP-----VET-TKTRPIEGAAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELII
ATPA_BACSU       VDGLGP-----ILT-SKTRPIESPAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELII
ATPA_BACP3       VDGLGP-----VET-TETRPIESRAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELII
ATPA_GEOSE       VDGLGP-----VET-TETRPIESPAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAAM       IDGQGP-----INT-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAAN       IDGQGP-----INT-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAAR       IDGQGP-----INT-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAAS       IDGQGP-----INT-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAAW       IDGQGP-----INT-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAAC       IDGQGP-----INT-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAES       IDGQGP-----INA-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_STAEQ       IDGQGP-----INA-TKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELII
ATPA_LACLA       VDGLGE-----LNT-GKTRPVEAKAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELII
ATPA_LACLM       VDGLGE-----LNT-GKTRPVEAKAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELII
ATPA_STRMU       VDGLGE-----IET-TATRPVEAAAPGVMQRQSVSEPLQTGIKAIDALVPIGRGQRELVI
ATPA_ENTHA       IDGLGE-----IVT-DKVRPVEAMAPGVMQRKSVNEPMQTGLKAIDALVPIGRGQRELVI
ATPA_BUCAI       IDGKDS-----IQN-DGFFPVEADAPGVIDRKSVNQPIQTGYKVIDSMIPIGRGQRELII
ATPA_BUCAP       IDGKGS-----IEH-DIYLPVEADAPGVIERESINEPIQTGYKAIDAMVPIGRGQRELII
ATPA_ECOLI       IDGKGP-----LDH-DGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELII
ATPA_ECO57       IDGKGP-----LDH-DGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELII
ATPA_ECOL6       IDGKGP-----LDH-DGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELII
ATPA_SHIFL       IDGKGP-----LDH-DGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELII
ATPA_HAEIN       IDGKGE-----IEN-DGFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRGQRELII
ATPA_PASMU       IDGKGE-----IEN-DGFSPVEVIAPGVIDRKSVDQPVQTGYKAVDSMVPIGRGQRELII
ATPA_VIBAL       IDGKGP-----IEA-KMTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELII
ATPA_VIBCH       IDGKGP-----IGA-KQTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELII
ATPA_BUCBP       IDGKGR-----IQE-EKFLPVEINAPGVIDRQKISEPLQTGYKSIDAMVPIGKGQRELII
ATPA_ACIFR       VDGKGA-----IDA-EEFDVLEKIAPGVIDRQSVDEPMQTGIKSIDAMVPIGRGQRELII
ATPA_HELPY       IDGKGE-----IET-NEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELII
ATPA_HELPJ       IDGKGE-----IET-NEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELII
ATPA2_MYCPU      LYSESEDQEISEKAYENENSAFKVASGIQDRVKLNEPLETGIFSIDILLPIGKGQRQLIL
                 :                       *  :  *  : :*: **   :* : *: :***:*::

ATPA_MYCGE       GDRQTGKTAIAIDTIINQK----------DKDVYCVYVAIGQKNSSVAQIVHQLEVNDSM
ATPA_MYCPN       GDRQTGKTSIAIDTIINQR----------GKDVYCVYVAMGQKNSSVAQIVHQLEVTDSM
ATPA_MYCGA       GDRQTGKTTIALDTIINQK----------GKNVNCIYVAIGQKNSSVAQITRLLEETGAM
ATPA_ANTAG       GDRQTGKTAVATDTILNQK----------GQNVICVYVAIGQKASSVAQVVNTFEERGAL
ATPA_MARPO       GDRQTGKTAVAIDTILNQK----------GQNVVCVYVAIGQKASSVAQVVNTFEDRGAL
ATPA_ADICA       GDRQTGKTAVATDTILNQK----------GQNVICVYVAIGQKASSVAQVVDTFRERGAL
ATPA_PINTH       GDRQTGKTAVATDTILNQK----------SQNVICVYVAIGQRASSVAQVVNTFRERGAM
ATPA_SPIOL       GDRQTGKTAVATDTILNQQ----------GQNVICVYVAIGQKASSVAQVVTNFQERGAM
ATPA_TOBAC       GDRQTGKTAVATDTILNQQ----------GQNVICVYVAIGQKASSVAQVVTTLQERGAM
ATPA_ARATH       GDRQTGKTAVATDTILNQQ----------GQNVICVYVAIGQKASSVAQVVTSLQERGAM
ATPA_LOTJA       GDRQTGKTAVATDTILNQQ----------GQNVICVYVAVGQKASSVAQVVNTLQERGAM
ATPA_PEA         GDRQTGKTAVATDTILNQQ----------GQNLVCVYVAIGQKASSVAQVVTTLQERGAM
ATPA_OENEH       GDRQTGKTAVATDTILNQQ----------GNNVICVYVAIGQKASSVAQVVNALQERGAM
ATPA_ORYNI       GDRQTGKTAVATDTILNQK----------GQDVICVYVAIGQRASSVAQVVTTFHEEGAM
ATPA_ORYSA       GDRQTGKTAVATDTILNQK----------GQDVICVYVAIGQRASSVAQVVTTFHEEGAM
ATPA_MAIZE       GDRQTGKTAVATDTILNQK----------GQDVICVYVAIGQRASSVAQVVTTFHEEGAM
ATPA_WHEAT       GDRQTGKTAVATDTILNQK----------GQGVICVYVAIGQRASSVAQVVTTFHEEGAM
ATPA_MESVI       GDRQTGKTAVAIDTILNQK----------GQNVICVYVAIGQKASSVAQVVSTLEENGAM
ATPA_CHLRE       GDRQTGKTAIAVDTILNQK----------GKGVICVYVAIGQKASSVAQVLNTLKERGAL
ATPA_CHLVU       GDRQTGKTAIAVDTILNQK----------GKDVVCVYVAIGQKASSIAQVVNTLQERGAM
ATPA_NEPOL       GDRQTGKTAIATDAIVNQK----------GSGVICVYVAIGQKASSVAQIVTTLQEKDAM
ATPA_EUGGR       GDRQTGKTAVATDTILNQK----------GQGVICVYVAIGQKASSVSQIVTTLEKRGAM
ATPA_NOSS1       GDRQTGKTAIAIDTIINQK----------GEDVVCVYVAIGQKASTVANVVQTLQEKGAM
ATPA_SYNP6       GDRQTGKTAIAIDTILNQK----------GEDVICVYVAIGQKASSVANIIEVLRERGAL
ATPA_SYNY3       GDRKTGKTAIAIDTIINQK----------SEDVICVYVAIGQKASTVAQIIDTLTEKGAM
ATPA_ANTSP       GDRQTGKTTVALDTIINQK----------GQDVVCVYVAIGQKASSVAQVVSTLEEKGAL
ATPA_PORPU       GDRQTGKTAVALDTIINQK----------GQDVVCVYVAIGQKASSVAQVVSSLQEKGAL
ATPA_GALSU       GDRQTGKTSIALDTIINQK----------DQDVICIYAAIGQKASSVAQVVSTLEEKGAL
ATPA_CYACA       GDRQTGKTSIALDTIINQK----------EENVICIYVAIGQKASSVAQAVTLLEEKDAL
ATPA_GUITH       GDRQTGKSSVAIDTIINQK----------GEDVVCVYVAVGQKAATVASIVTTLEEKGAL
ATPA_TRICV       GDRQTGKTAIAVDTIINQK----------TEDVVCVYVGVGQKASTVAQVVNVLEEKEAM
ATPA_SYNP1       GDRQTGKTAVAIDTILNQK----------GQDVICVYVAIGQKASSVAQVVNVLRERGAL
ATPA_CYAPA       GDRQTGKTAVAIDTILNQK----------GQGVVCVYVAIGQKASSVAQVVGVLQEKGAL
ATPA_MYCTU       GDRKTGKTAVCVDTILNQRQNWESGDP--KKQVRCVYVAIGQKGTTIAAVRRTLEEGGAM
ATPA_MYCBO       GDRKTGKTAVCVDTILNQRQNWESGDP--KKQVRCVYVAIGQKGTTIAAVRRTLEEGGAM
ATPA_MYCLE       GDRKTGKTAVCVDTILNQRQNWESGDP--KRQVRCVYVAIGQKGTTIASVRRALEEGGAM
ATPA_STRLI       GDRQTGKTALAVDTIINQRDNWRTGDP--NKQVRCIYVAIGQKGSTIASVRGALEENGAL
ATPA_AQUAE       GDRATGKTTVAIDTILAQK----------NSDVYCIYVAVGQKRAAIARLIELLEREGAM
ATPA_RHOBL       GDRQTGKTAVALDTILNQKVYNDAAGDDESKKLYCVYVAIGQKRSTVAQLVKKLEETGAM
ATPA_RHOCA       GDRQTGKTAIALDTILNQKSYNDAN---PGNKLHCFYVAIGQKRSTVAQLVKKLEEAGAM
ATPA_RHORU       GDRQTGKTAVILDTILNQKAVNDKAKD-DSEKLFCVYVAVGQKRSTVAQVVKVLADHGAL
ATPA_RICCN       GDRQTGKTAIAVDTIINQKQAHSLTN--ESDKIYCIYVAIGQKRSSVAQIVKKLEDAGAM
ATPA_RICPR       GDRQTGKTAIAVDTIINQKQAHSLTN--ESDKIYCIYVAIGQKRSSVAQIVKKLEDAGAM
ATPA_MYXXA       GDRQTGKTAVAIDTIINQK----------GLNVYCIYVAIGQKQSTVAQVVEKLNRYGAM
ATPA_PROMO       GDRQTGKTAVALDAIINQK----------DTGVKCIYVAIGQKRSTVAQIVKRLEDAGAL
ATPA_CLOAB       GDRQTGKTAIAIDTILNQK----------GKDVICIYVAIGQKQSTVAHIVNTFEEMGAM
ATPA_CLOPE       GDRQTGKTAIAIDTIINQK----------GKDVICIYVAIGQKQSTVANIVNTLTEEGAM
ATPA_ACEWD       GDRQTGKTALAIDTIINQK----------GEDVICIYVAIGQKDSTVAQIVGQLEENNAM
ATPA_BACHD       GDRQTGKTSIAIDTIINQK----------DQDMICIYVAIGQKESTVAGVVETLRQHGAL
ATPA_BACPE       GDRQTGKTAIAIDTILNQK----------DEDMICIYVAIGQKDSTVAGVVETLRQRGAL
ATPA_BACMQ       GDRQTGKTSVAIDTILNQK----------DQDMVCIYVAIGQKESTVRNVVETLRKHGAL
ATPA_BACSU       GDRQTGKTSVAIDAILNQK----------DQDMICVYVAIGQKESTVRGVVETLRKHGAL
ATPA_BACP3       GDRQTGKTSVAIDTIINQK----------DQNMICIYVAIGQKESTVATVVETLAKHGAP
ATPA_GEOSE       GDRQTGKTSVAIDTIINQK----------DQNMICIYVAIGQKESTVRTVVETLRKHGAL
ATPA_STAAM       GDRQTGKTTIAIDTILNQK----------DQGTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAAN       GDRQTGKTTIAIDTILNQK----------DQGTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAAR       GDRQTGKTTIAIDTILNQK----------DQGTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAAS       GDRQTGKTTIAIDTILNQK----------DQGTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAAW       GDRQTGKTTIAIDTILNQK----------DQGTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAAC       GDRQTGKTTIAIDTILNQK----------DQGTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAES       GDRQTGKTTVAIDSILNQK----------DQDTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_STAEQ       GDRQTGKTTVAIDSILNQK----------DQDTICIYVAIGQKDSTVRANVEKLRQAGAL
ATPA_LACLA       GDRQTGKTSVAIDAILNQK----------GQDMICIYVAIGQKESTVRTQVETLRKLGAM
ATPA_LACLM       GDRQTGKTSVAIDAILNQK----------GQDMICIYVAIGQKESTVRTQVETLRKLGAM
ATPA_STRMU       GDRQTGKTSIAIDAIINQK----------GQDMICIYVAIGQKESTVRSQVEVLRKYGAL
ATPA_ENTHA       GDRKTGKTSIAIDTILNQK----------GQDMICIYVAIGQKDSTVRTQVETLKKYGAM
ATPA_BUCAI       GDRQTGKTALAIDTIINQK----------QSGIKCIYVAIGQKLSTIINVVKKLEENNAL
ATPA_BUCAP       GDRQTGKTALAIDTIINQK----------KINLPCVYVAIGQKLSTIINVVKKLDEHDAL
ATPA_ECOLI       GDRQTGKTALAIDAIINQR----------DSGIKCIYVAIGQKASTISNVVRKLEEHGAL
ATPA_ECO57       GDRQTGKTALAIDAIINQR----------DSGIKCIYVAIGQKASTISNVVRKLEEHGAL
ATPA_ECOL6       GDRQTGKTALAIDAIINQR----------DSGIKCIYVAIGQKASTISNVVRKLEEHGAL
ATPA_SHIFL       GDRQTGKTALAIDAIINQR----------DSGIKCIYVAIGQKASTISNVVRKLEEHGAL
ATPA_HAEIN       GDRQTGKTALAIDAIINQR----------NSGIKCIYVAIGQKASTIANVVRKLEEHGAL
ATPA_PASMU       GDRQTGKTALAIDAIINQR----------DSGIKCIYVAIGQKASTIANVVRKLEEHSAL
ATPA_VIBAL       GDRQIGKTALAIDAIINQK----------DSGIFSIYVAIGQKASTIANVVRKLEEHGAL
ATPA_VIBCH       GDRQTGKTALAIDAIINQK----------NSGIYSIYVAIGQKASTIANVVRKLEEHGAL
ATPA_BUCBP       GDRQTGKTSLAIDTIINQR----------NTKIKCIYVAIGQKFSTIVNLVRQLEDNQAL
ATPA_ACIFR       GDRQTGKTAVAVDAILNQK----------GKDVQCIYVAIGQKASTVAGVVRKLEEYGAM
ATPA_HELPY       GDKQTGKTTVAIDAIINQK----------GQNVICIYVAIGQKESTVAQVVRKLEEYGAM
ATPA_HELPJ       GDKQTGKTTVAIDAIINQK----------GQNVICIYVAIGQKESTVAQVVRKLEEYGAM
ATPA2_MYCPU      GDSKTGKTSIALSTMINQK----------ENDIKIIYVSIGLKSNDLKRIYKTIVEQKIA
                 **   **:::  .::: *:                .*..:* :   :      :      

ATPA_MYCGE       KYTTVVCATASDSDSMVYLSPFTGITIAEYWLK-KGKDVLIVFDDLSKHAVAYRTLSLLL
ATPA_MYCPN       KYTTVVCATASDPASMIYLTPFTGITIAEYWLK-QGKDVLIVFDDLSKHAIAYRTLSLLL
ATPA_MYCGA       AYTTIVSATASELAALSYIAPFAGVTIGEEWMR-QGKDVLIVYDDLSKHAVAYRALSLLL
ATPA_ANTAG       EYTIVVAETADSPATLQYLAPYTGAALAEYFMY-RKQHTLIIYDDLSKQAQAYRQMSLLL
ATPA_MARPO       EYTIVVAETANSPATLQYLAPYTGAALAEYFMY-RKQHTLIIYDDLSKQAQAYRQMSLLL
ATPA_ADICA       EYTIVVSETANSPATLQYLAPYTGAALAEYFMY-RKQHTLIIYDDLSKQAQAYRQMSLLL
ATPA_PINTH       AYTIVVAETADSPATLQYLAPYTGATLAEYFMY-KKQHTSIIYDDLSKQAQAYRQMSLLL
ATPA_SPIOL       EYTIVVAETADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_TOBAC       EYTIVVAETADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_ARATH       EYTIVVAETADSPATLQYLAPYTGAALAEYFMY-REQHTLIIYDDLSKQAQAYRQMSLLL
ATPA_LOTJA       EYTIVVAETADSPATLQYLAPYTGAALAEFFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_PEA         EYTIVVAETADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDPSKHAQAYRQMSLLL
ATPA_OENEH       EYTIVVAEAADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDPSKQAQAYRQMSLLL
ATPA_ORYNI       EYTIVVAEMADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_ORYSA       EYTIVVAEMADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_MAIZE       EYTIVVAEMADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_WHEAT       EYTIVVAEMADSPATLQYLAPYTGAALAEYFMY-RERHTLIIYDDLSKQAQAYRQMSLLL
ATPA_MESVI       AYTIIVAENANAPATLQYLAPYTGATLAEFFMY-SGRHTLVIYDDLSKQAQAYREMSLLL
ATPA_CHLRE       DYTIIVMANANEPATLQYLAPYTGATLAEYFMY-TGRPTLTIYDDLSKQAQAYREMSLLL
ATPA_CHLVU       DYTIIVAATADSPATLQYLSPYTGAALAEYFMY-TGRHTLVIYDDLTKQAQAYREMSLLL
ATPA_NEPOL       RYTIIVSETADSPATLQYLAPYTGAALAEYFMY-SGRHTLVIYDDLSKQAQAYREMSLLL
ATPA_EUGGR       EYTIIVAENADSSATLQYLAPYTGAALAEYFMY-NGKHTLVIYDDLSKQAQAYRQMSLLL
ATPA_NOSS1       DYTVVVAAGASEPATLQFLAPYTGATIAEYFMY-KGKATLVIYDDLSKQAQAYRQMSLLL
ATPA_SYNP6       DYTVVVAANASEPATLQYLAPYAGAAIAEYFMY-KGKATLVIYDDLTKQAQAYRQMSLLL
ATPA_SYNY3       AYTIVVAANANDPATLQYLAPYTGATLAEHFMY-QGKSTLVIYDDLSKQAQAYRQMSLLM
ATPA_ANTSP       EYTIVVAANADEPATLQYIAPYTGAALAEYFMY-KGKATLVIYDDLTKQAQAYRQMSLLL
ATPA_PORPU       DYTIIVTANADSPATLQYIAPYTGAALAEYFMY-KGKATLVIYDDLTKQAQAYRQMSLLL
ATPA_GALSU       GYTIIVAANADEPASLQYIAPYTAASLAEYFMY-KGKATLVIYDDLTKQAQAYRQMSLLL
ATPA_CYACA       KYTVVIAANANEPATLQYIAPYTGAAIAEHFMY-KGLATLIIYDDLTKQAQAYRQMSLLL
ATPA_GUITH       DYTCIVAANADDPATLQYIAPYTGAAIAEYFMY-NGQATLVIYDDLSKQASAYREMSLLL
ATPA_TRICV       AYTIIVCASANDPATLQYIAPYAGAALAEYFMY-NGKATLVIYDDLTKQAMAYRQMSLLL
ATPA_SYNP1       DYTIVVAANASDPAALQYLAPYTGASIAEYFMY-QGKHTLVIYDDLSKQAQAYRQMSLLL
ATPA_CYAPA       DYTVIVAANADDPATLQYLAPYTGASIAEYFMY-KGQHTLVIYDDLSKQAQAYRQMSLLL
ATPA_MYCTU       DYTTIVAAAASESAGFKWLAPYTGSAIAQHWMY-EGKHVLIIFDDLTKQAEAYRAISLLL
ATPA_MYCBO       DYTTIVAAAASESAGFKWLAPYTGSAIAQHWMY-EGKHVLIIFDDLTKQAEAYRAISLLL
ATPA_MYCLE       DYTTIVAALASDSAGFKWLAPYTGSAIAQHWMY-DGKHVLIVFDDLTKQAEAYRAISLLL
ATPA_STRLI       EYTTIVAAPASDPAGFKYLAPYTGSAIGQQWMY-EGKHVLIIFDDLSKQADAYRAVSLLL
ATPA_AQUAE       EYTTVVVASASDPASLQYLAPFVGCTIGEYFRD-NGKHALIIYDDLSKHAEAYRQLSLLM
ATPA_RHOBL       AYTVVVAATASDPAPMQFLAPFSGTAIGEFFRD-NGRHALMIYDDLSKQAVAYRQMSLLL
ATPA_RHOCA       EYTTVVAATASDPAPMQFLAPYSATAMAEYFRD-NGMHALIIYDDLSKQAVAYRQMSLLL
ATPA_RHORU       DYTIVVAATASEPAPLQFLAPYTGCTMGEFFRD-NGMHAVIFYDDLTKQAVAYRQMSLLL
ATPA_RICCN       DYTLIVSATASEAAALQFIAPYSACSMGEYFRD-NGMHALIIYDDLSKHAVAYRQISLLL
ATPA_RICPR       DYTIVVLATASEAASLQFIAPYSACSMGEYFRD-NGMHALIIYDDLSKHAVAYRQISLLL
ATPA_MYXXA       EYTTVVASNASDPAPMQFFAPYAGVAMGEYFRD-NKMHALIVYDDLSKQAVAYRQLSLLL
ATPA_PROMO       EYTIVVAATASESAPLQYMAPYTGVSMGEYFMD-KGEHVLIVYDDLSKHAVAYREMSLLL
ATPA_CLOAB       DYSIVVAATASDSAPLQYLAPYSGVTIAENFMF-KGKDVLIVYDDLSKHAVAYRTMSLLL
ATPA_CLOPE       DYSIVVTASASESAPLQYIAPYSGCTMGEYFMN-KGKHVLIIYDDLSKHAVAYRTMSLLI
ATPA_ACEWD       DYTIIVSAGAAQLAPLQYIAPYSGVTMAEYFMNEQQKDVLIIYDDLSKHAVAYRAMSLIL
ATPA_BACHD       DYTIVVSASASEPAPLLFLAPYAGVSMGEEFMY-NGKHVLVVYDDLTKQAAAYRELSLLL
ATPA_BACPE       DYTIVVSASASDPAPMLFLAPYAGVSMGEEFMY-NGKHVLVIYDDLSKQASAYRELSLLL
ATPA_BACMQ       DYTIVVTASASQPAPLLFLAPYAGVTMGEEFMY-NGKHVLVIYDDLTKQASAYRELSLLL
ATPA_BACSU       DYTIVVTASASQPAPLLYLAPYAGVTMAEEFMY-NGKHVLVVYDDLSKQAAAYRELSLLL
ATPA_BACP3       DYTIVVTASASQPAPLLFLAPYAGVAMGEYFMI-MGKHVLVVIDDLSKQAAAYRQLSLLL
ATPA_GEOSE       DYTIVVTASASQPAPLLFLAPYAGVAMGEYFMY-KGQHVLVVYDDLSKQAAAYRELSLFV
ATPA_STAAM       DYTIVVAASASEPSPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAAN       DYTIVVAASASEPSPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAAR       DYTIVVAASASEPSPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAAS       DYTIVVAASASEPSPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAAW       DYTIVVAASASEPSPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAAC       DYTIVVAASASEPSPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAES       DYTIVVSASAADPAPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_STAEQ       DYTIVVSASAADPAPLLYIAPYSGVTMGEEFMF-NGKHVLIVYDDLTKQAAAYRELSLLL
ATPA_LACLA       DYTIVVTASASQPSPLLYIAPYAGAAMGEEFMY-NGKHVLVVYDDLSKQAVAYRELSLLL
ATPA_LACLM       DYTIVVTASASQPSPLLYIAPYAGAAMGEEFMY-NGKHVLVVYDDLSKQAVAYRELSLLL
ATPA_STRMU       DYTIVVTASASQPSPLLYIAPYAGVAMAEEFMY-NGKHALIVYDDLSKQAVAYRELSLLL
ATPA_ENTHA       DYTIVVNAGASQPAPLLYIAPYAGTAMGEEFMY-NGKHVLIIFDDLSKQAVAYRELSLLL
ATPA_BUCAI       FNTIIVVASASEAASLQYLAPYSGCAMAEFFRN-KGEDSLIIYDDLSKHAVAYRQISLLL
ATPA_BUCAP       LNTIVVVASASEAASLQYLAPYSGCAMGEYFRD-RGKDALIVYDDLSKHAVAYRQISLLL
ATPA_ECOLI       ANTIVVVATASESAALQYLAPYAGCAMGEYFRD-RGEDALIIYDDLSKQAVAYRQISLLL
ATPA_ECO57       ANTIVVVATASESAALQYLAPYAGCAMGEYFRD-RGEDALIIYDDLSKQAVAYRQISLLL
ATPA_ECOL6       ANTIVVVATASESAALQYLAPYAGCAMGEYFRD-RGEDALIIYDDLSKQAVAYRQISLLL
ATPA_SHIFL       ANTIVVVATASESAALQYLAPYAGCAMGEYFRD-RGEDALIIYDDLSKQAVAYRQISLLL
ATPA_HAEIN       ANTIVVAASASESAALQYLAPYAGCAMGEYFRD-RGEDALIVYDDLSKQAVAYRQISLLL
ATPA_PASMU       QNTIVVVASASESAALQYLAPYSGCAMGEYFRD-RGEDALIIYDDLSKQAVAYRQISLLL
ATPA_VIBAL       QNTIVVVASASESAALQYLAPYAGCAMGEYFRD-RGEDALIVYDDLSKQAVAYRQISLLL
ATPA_VIBCH       KNTIVVVASASESAALQYLAPYSGCAMGEYFRD-RGEDALIVYDDLSKQAVAYRQISLLL
ATPA_BUCBP       NHTIVIVASASESAALQYLVPYSGCSLGEFFRD-QGKDALIVYDDLSKHAIAYRQISLLL
ATPA_ACIFR       EYTTVIAANASESAAMQYLAPYAGCTMGEYFRD-RGMNALIVYDDLTKQAWAYRHISLLL
ATPA_HELPY       EYSVVINASASDSAAMQYLAPYSGVAMGEYFRD-HARHALIIYDDLSKHAVAYREISLIL
ATPA_HELPJ       EYSVVINASASDSAAMQYLAPYAGVAMGEYFRD-HARHALIVYDDLSKHAVAYREISWIL
ATPA2_MYCPU      HKTILMHASSDN-SFQQFLIPYVAMAHAENIMQ-SGEDVLIIFDDLTNHANVLREIALLT
                   : ::   :       :: *: . : .:            . ** :::* . * :: : 

ATPA_MYCGE       KRPPGREAFPGDVFYLHSRLLERACKLNDEN-----------GGGSITALPIIETQAGDI
ATPA_MYCPN       RRPPGREAFPGDVFYLHSRLLERACRLNEEH-----------GGGSITALPIIETQAGDI
ATPA_MYCGA       RRPPGREAYPGDIFYLHSRLLERAGKLSDEL-----------GAGSITALPIIETQAGDI
ATPA_ANTAG       RRPPGREAYPGDVFYLHSRLLERAAKLSSQL-----------GEGSMTALPIVETQAGDV
ATPA_MARPO       RRPPGREAYPGDVFYLHSRLLERAAKLSSNL-----------GEGSMTALPIVETQAGDV
ATPA_ADICA       KRPPGREAYPGDVFYLHSRLLERAAKLSTQL-----------GEGSMTALPIVETQAGDV
ATPA_PINTH       RRPPGREAYPGDVFYLHSRLLERAAKLSSQL-----------GEGSVTALPIVETQAGDV
ATPA_SPIOL       RRPPGREAYPGDVFYLHSRLLERAAKLSSLL-----------GEGSMTALPIVETQAGDV
ATPA_TOBAC       RRPPGREAYLGDVFYLHSRLLERAAKLSSSL-----------GEGSMTALPIVETQSGDV
ATPA_ARATH       RRPPGREAYPGDVFYLHSRLLERAAKLSSQL-----------GEGSMTALPIVETQSGDV
ATPA_LOTJA       RRPPGREAYPGDVFYLHSRLLERAAKLSSQL-----------GEGSMTALPIVETQSGDV
ATPA_PEA         RRPPGREAYPGDVFYLHSRLLERVAKLSSQL-----------GEGSMTALPIVETQSGDV
ATPA_OENEH       RRPPGREAYPGDVFYLHSRLLERAAKLSSRL-----------GEGSMTALPIVETQSGDV
ATPA_ORYNI       RRPPGREAYPGDVFYLHSRLLERAAKLNSLL-----------GEGSMTALPIVETQSGDV
ATPA_ORYSA       RRPPGREAYPGDVFYLHSRLLERAAKLNSLL-----------GEGSMTALPIVETQSGDV
ATPA_MAIZE       RRPPGREAYLGDVFYLHSRLLERAAKLNSLL-----------GEGSMTALPIVETQSGDV
ATPA_WHEAT       RRPPGREAYPGDVFYLHSRLLERAAKLNSLL-----------GEGSMTALPIVETQSGDV
ATPA_MESVI       RRPPGREAYPGDVFYLHSRLLERAAKLSNAL-----------GEGSMTALPIIETQAGDV
ATPA_CHLRE       RRPPGREAYPGDVFYLHSRLLERAAKLNNAL-----------GEGSMTALPIVETQEGDV
ATPA_CHLVU       RRPPGREAYPGDVFYLHSRLLERAAKLNDKL-----------GSGSMTALPVVETQEGDV
ATPA_NEPOL       RRPPGREAYPGDVFYLHSRLLERAAKLSDAL-----------GEGSMTALPVIETQGGDV
ATPA_EUGGR       RRPPGREAYPGDVFYLHSRLLERAAKLSDEL-----------GQGSMTALPIVETQAGDV
ATPA_NOSS1       RRPPGREAYPGDVFYIHSRLLERAAKLSDEL-----------GKGSMTALPIIETQAGDV
ATPA_SYNP6       RRPPGREAYPGDVFYLHSRLLERAAKLSDAL-----------GGGSMTALPVIETQAGDV
ATPA_SYNY3       RRPPGREAYPGDVFYIHSRLLERAAKLSDAL-----------GGGSMTALPVIETQAGDV
ATPA_ANTSP       RRPPGREAYPGDVFYLHSRLLERAAKLNQDL-----------GGGSMTALPIIETQAGDV
ATPA_PORPU       RRPPGREAYPGDVFYLHSRLLERAAKLNSDL-----------GGGSMTALPIIETQAGDV
ATPA_GALSU       RRPPGREAYPGDVFYLHSRLLERAAKLNQKL-----------GGGSMTALPIIETQAGDV
ATPA_CYACA       KRPPGREAYPGDVFYLHSRLLERAAKLNNEL-----------GGGSMTALPIIETQAGDV
ATPA_GUITH       RRPPGREAFPGDVFYLHSRLLERAAKLSDKL-----------GGGSMTALPVIETQAGDV
ATPA_TRICV       RRPPGREAYPGDVFYLHSRLLERAAKLSDAL-----------GGGSMTALPVIETQASDV
ATPA_SYNP1       RRPPGREAYPGDVFYLHSRLLERAAKLNDAL-----------GGGSMTALPIVETQAGDV
ATPA_CYAPA       RRPPGREAYPGDVFYLHSRLLERAAKLSPQL-----------GEGSMTALPIVETQAGDV
ATPA_MYCTU       RRPPGREAYPGDVFYLHSRLLERCAKLSDDL-----------GGGSLTGLPIIETKANDI
ATPA_MYCBO       RRPPGREAYPGDVFYLHSRLLERCAKLSDDL-----------GGGSLTGLPIIETKANDI
ATPA_MYCLE       RRPPGREAYPGDVFYLHSRLLERCAKLADHL-----------GGGSLTGLPIIETKANDI
ATPA_STRLI       RRPPGREAYPGDVFYLHSRLLERCAKLSDAE-----------GAGSMTGLPIVETKANDV
ATPA_AQUAE       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GAGSLTALPIIETKAGDV
ATPA_RHOBL       RRPPGREAYPGDVFYLHSRLLERSAKMNGDF-----------GAGSLTALPIIETQAGDI
ATPA_RHOCA       RRPPGREAYPGDVFYLHSRLLERSAKLNEDF-----------GSGSLTALPVIETQGGDV
ATPA_RHORU       RRPPGREAFPGDVFYLHSRLLERAAKLNDDN-----------GAGSLTALPVIETQANDV
ATPA_RICCN       RRPPGREAYPGDVFYLHSRLLERAAKMSEEK-----------GSGSLTALPIIETQAGDV
ATPA_RICPR       RRPPGREAYPGDVFYLHSRLLERAAKMSKEK-----------GGGSLTALPIIETQAGDV
ATPA_MYXXA       RRPPGREAYPGDVFYVHSRLLERAAKLSDEE-----------GAGSLTALPIIETQAGDV
ATPA_PROMO       KRPPGREAFPGDVFYLHSRLLERAAKLSDEI-----------GAGSITALPIIETQAGDV
ATPA_CLOAB       RRPPGREAYPGDVFYLHSRLLERAAKLSQKL-----------GGGSITALPIIETLAGDV
ATPA_CLOPE       RRPPGREAYPGDVFYIHSRLLERAAKLSKEN-----------GGGSLTALPIIETLAGDV
ATPA_ACEWD       RRPPGREAYPGDVFYLHSRLLERAAKLK--------------AGGSITALPIIETQAGDV
ATPA_BACHD       RRPPGREAYPGDVFYLHSRLLERAAKLSDAK-----------GGGSITALPFIETQAGDV
ATPA_BACPE       RRPPGREAFPGDVFYLHSRLLERAAKLSDAK-----------GGGSITALPFIETQAGDV
ATPA_BACMQ       RRPPGREAYPGDVFYLHSRLLERAAKLSDAK-----------GGGSLTALPFIETQAGDV
ATPA_BACSU       RRPPGREAFPGDVFYLHSRLLERAAKLSDAK-----------GAGSITALPFVETQAGDI
ATPA_BACP3       RRPPGREAYPGDIFYLHSRLLERAAKLSDAK-----------GGGSLTALPFVETQAGDI
ATPA_GEOSE       RRPPGREAYPGDIFYLHSRLLERAAKLSDAK-----------GGGSLTALPFVETQAGDI
ATPA_STAAM       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAAN       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAAR       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAAS       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAAW       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAAC       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAES       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_STAEQ       RRPPGREAYPGDVFYLHSRLLERAAKLNDDL-----------GGGSITALPIIETQAGDI
ATPA_LACLA       RRPPGREAYPGDVFYLHSRLLERAAKLSDDL-----------GGGSMTALPFIETQAGDI
ATPA_LACLM       RRPPGREAYPGDVFYLHSRLLERAAKLSDDL-----------GGGSMTALPFIETQAGDI
ATPA_STRMU       RRPPGREAYPGDVFYLHSRLLERSAKLSDEL-----------GGGSITALPFIETQAGDI
ATPA_ENTHA       RRPPGREAYPGDVFYLHSRLLERAAKLSDDL-----------GGGSMTALPFVETQAGDI
ATPA_BUCAI       RRPPGREAFPGDIFYLHSRLLERASRVSMEYVQKITKNKITGKTGSITALPIIETQSGDV
ATPA_BUCAP       RRPPGREAFPGDVFYLHSRLLERASRVSKEHVKNVTKGKITGKTGSLTALPIIETQSGDV
ATPA_ECOLI       RRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_ECO57       RRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_ECOL6       RRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_SHIFL       RRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_HAEIN       RRPPGREAYPGDVFYLHSRLLERASRVNEDYVEKFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_PASMU       RRPPGREAFPGDVFYLHSRLLERASRVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDV
ATPA_VIBAL       KRPPGREAFPGDVFYLHSRLLERAARVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDV
ATPA_VIBCH       RRPPGREAFPGDVFYLHSRLLERAARVNEEYVERFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_BUCBP       RRPPGREAFPGDIFYLHARLLERACRVNSNYLKNILGTVNKFSTGSLTALPIIETQDGDV
ATPA_ACIFR       RRPPGREAYPGDVFYLHSRLLERAARVNADFVEKFTKGEVKGKTGSLTALPIIETQAGDV
ATPA_HELPY       RRPPGREAFPGDVFYIHSRLLERAAKLCDE-----------KGAGSLTALPIVETQAGDV
ATPA_HELPJ       RRPPGREAFPGDVFYIHSRLLERAAKLCDE-----------KGAGSLTALPIVETQAGDV
ATPA2_MYCPU      GKPVGKEAFPGDLFYSHSKLLERAGKFKNGY--------------SITCFPIVRTINNDM
                  :* *:**: **:** *::****  :.                  *:* :*.:.*  .*:

ATPA_MYCGE       SAYIPTNVISITDGQLFMVSSLFNAGQRPAIQIGLSVSRVGSAAQTKAIKQQTGSLKLEL
ATPA_MYCPN       SAYIPTNVISITDGQLFMVSNLFNSGQRPAIHVGLSVSRVGSAAQIKAIKQQTGSLKLEL
ATPA_MYCGA       SAYIPTNVISITDGQLFTTTSLFNSGQRPAIHVGLSVSRVGSAAQLKSIKQVSGSLKLEL
ATPA_ANTAG       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_MARPO       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_ADICA       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_PINTH       SAYIPTNAISITDGQIFSSADLFNAGIRPAINVGISVSRVGSAAQIKAMKKVAGKLKLEL
ATPA_SPIOL       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKKVAGKLKLEL
ATPA_TOBAC       SAYIPTNVISITDGQIFLSADLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_ARATH       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_LOTJA       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_PEA         SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_OENEH       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_ORYNI       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKSKLEL
ATPA_ORYSA       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKSKLEL
ATPA_MAIZE       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKSKLEL
ATPA_WHEAT       SAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKSKLEL
ATPA_MESVI       AAYIPTNVISITDGQIFLSADLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_CHLRE       SAYIPTNVISITDGQIFLAAGLFNSGLRPAINVGISVSRVGSAAQPKAMKQVAGKLKLEL
ATPA_CHLVU       SAYIPTNVISITDGQIFLSADIFNAGIRPAINVGISVSRVGSAAQPKAMKQVAGKLKLEL
ATPA_NEPOL       SAYIPTNVISITDGQIFLSADIFNAGIRPAINVGISVSRVGSAAQVKAMKQVASKLKLEL
ATPA_EUGGR       SAYIPTNVISITDGQVFLSADIFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_NOSS1       SAYIPTNVISITDGQIFLSSDLFNAGIRPAVNPGISVSRVGSAAQTKAMKKVAGKIKLEL
ATPA_SYNP6       SAYIPTNVISITDGQIFLSSDLFNSGLRPAINVGISVSRVGSAAQTKAIKKIAGTLKLEL
ATPA_SYNY3       SAYIPTNVISITDGQIFLSTDLFNAGFRPAINAGISVSRVGSAAQTKAMKKVAGKLKLEL
ATPA_ANTSP       SAYIPTNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_PORPU       SAYIPTNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_GALSU       SAYIPTNVISITDGQIFLSSDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_CYACA       SAYIPTNVISITDGQIFLSSDLFNAGIRPSINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_GUITH       SAYIPTNVISITDGQIFLSGDLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_TRICV       SAYIPTNVISITDGQIFLSNDLFNSGIRPAINVGISVSRVGSAAQTKAMKQVAGKLKLEL
ATPA_SYNP1       SAYIPTNVISITDGQIFLSSDLFNAGLRPAINAGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_CYAPA       CAYIPTNVISITDGQIFLSADLFNSGLRPAINVGISVSRVGSAAQIKAMKQVAGKLKLEL
ATPA_MYCTU       SAYIPTNVISITDGQCFLETDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDL
ATPA_MYCBO       SAYIPTNVISITDGQCFLETDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDL
ATPA_MYCLE       SAYIPTNVISITDGQCFLETDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDL
ATPA_STRLI       SAFIPTNVISITDGQCFLESDLFNAGQRPALNVGISVSRVGGSAQHKAMKQVSGRLRVDL
ATPA_AQUAE       AAYIPTNVISITDGQIYLEADLFNKGIRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLEL
ATPA_RHOBL       SAYIPTNVISITDGQIFLESELFYQGIRPAVNTGLSVSRVGSSAQTSAMKSVAGKVKLEL
ATPA_RHOCA       SAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNSMKSVAGPVKLEL
ATPA_RHORU       SAYIPTNVISITDGQIFLETDLFFKGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKLEL
ATPA_RICCN       SAYIPTNVISITDGQIFLESELFYKGVRPAVNVGISVSRVGSAAQIKAMKQVAGSVKLEL
ATPA_RICPR       SAYIPTNVISITDGQIFLESDLFYKGIRPAVNVGISVSRVGSAAQIKAMKQVAGSVKLEL
ATPA_MYXXA       SAYIPTNVISITDGQIFLETDLFFAGVRPAINVGLSVSRVGSAAQIKAMKQVAGTMKLEL
ATPA_PROMO       SAYIPTNVISITDGQIFLDSQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVAAQVKLEL
ATPA_CLOAB       AGYIPTNVISITDGQIFLESELFYAGQRPAVNSGISVSRVGGSAQIKAMKKLSGTLRLEL
ATPA_CLOPE       TAYIPTNVISITDGQIFLETELFNAGQRPAVNPGISVSRVGGNAQIKAMKQVSGTLRLEL
ATPA_ACEWD       SAYIPTNVISITDGQIFLEAELFRSGIRPAVNPGISVSRVGGSAQIKSMKKVAGPLRIEY
ATPA_BACHD       SAYIPTNVISITDGQIFLQSDLFYSGVRPAVNAGLSVSRVGGSAQIKAMKKVSGTLRLDL
ATPA_BACPE       SAYIPTNVISITDGQIFLQSDLFYSGIRPAVNAGLSVSRVGGSAQIKAMKKVSGTLRLDL
ATPA_BACMQ       SAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_BACSU       SAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVSGTLRLDL
ATPA_BACP3       SAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDL
ATPA_GEOSE       SAYIPTNVISITDGQIFLQSDLFFSRVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDL
ATPA_STAAM       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_STAAN       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_STAAR       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_STAAS       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_STAAW       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_STAAC       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQINAMKKVAGTLRLDL
ATPA_STAES       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_STAEQ       SAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_LACLA       SAYIATNVISITDGQIFLENDLFYSGVRPAIDAGSSVSRVGGAAQIKAMKKVAGTLRLDL
ATPA_LACLM       SAYIATNVISITDGQIFLENDLFYSGVRPAIDAGSSVSRVGGAAQIKAMKKVAGTLRLDL
ATPA_STRMU       SAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_ENTHA       SAYIPTNVISITDGQIFLESDLFYAGTRPAVDAGLSVSRVGGSAQIKAMKKVAGTLRLDL
ATPA_BUCAI       SAFVPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGSAAQTTIIKKLSSGIRTAL
ATPA_BUCAP       SAFVPTNVISITDGQIFLESNLFNSGIRPAVNAGISVSRVGSAAQTKIIKKLSSGIRTAL
ATPA_ECOLI       SAFVPTNVISITDGQIFLETNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTAL
ATPA_ECO57       SAFVPTNVISITDGQIFLETNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTAL
ATPA_ECOL6       SAFVPTNVISITDGQIFLETNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTAL
ATPA_SHIFL       SAFVPTNVISITDGQIFLETNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTAL
ATPA_HAEIN       SAFVPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTAL
ATPA_PASMU       SAFVPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTAL
ATPA_VIBAL       SAFVPTNVISITDGQIFLQTELFNAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTAL
ATPA_VIBCH       SAFVPTNVISITDGQIFLQTELFNAGVRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTAL
ATPA_BUCBP       SSFIPTNVISITDGQIFLESNLFNSGIRPAINPGISVSRVGGAAQCQIIRKLSSGIRTSL
ATPA_ACIFR       SAFVPTNVISITDGQIYLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGIRLDL
ATPA_HELPY       SAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDL
ATPA_HELPJ       SAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDL
ATPA2_MYCPU      TSLLASNIASITDGQIVTNSEIKDQGILPAIDIGLSVSRTGSSVQSVSLSKIAIEISKIY
                  . :.:*  ******      :      *::. * ****.*. .*     .         

ATPA_MYCGE       AQYSELDSFSQFGSDLDENTKKVLEHGKRVMEMIKQPNGKPYSQVHEALFLFAINK----
ATPA_MYCPN       AQYSELDSFSQFGSDLDENTKQILERGKRVMEMIKQPNGKPYSQTHEALFLFAIAK----
ATPA_MYCGA       AQYRELDTFSQFSSDLDAETKIVLEHGARVMEMFKQPQAKPIDQTSEAVLLFGIKN----
ATPA_ANTAG       AQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQSQSAPLAVEEQVATIYTGVN----
ATPA_MARPO       AQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQSQSAPLSVEEQIATIYTGVN----
ATPA_ADICA       AQFAELEAFAQFASDLDKTTQNQLARGQRLRELLKQSQSAPLAVEEQVATIYTGVN----
ATPA_PINTH       AQFAELEAFAQFASDLDKATQDQLARGQRLRELLKQSQSAPLTVEEQIATIYTGTN----
ATPA_SPIOL       AQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQPQSAPLTVEEQVMTIYTGTN----
ATPA_TOBAC       AQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQSQSAPLTVEEQIMTIYTGTN----
ATPA_ARATH       AQFAELEAFSQFSSDLDKATQNQLARGQRLRELLKQSQSAPLTVEEQIMTIYTGTN----
ATPA_LOTJA       AQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQSQSAPLTVEEQVITIYTGTN----
ATPA_PEA         AQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQSQSAPLTVEEQIITIYTGTN----
ATPA_OENEH       AQFAELEAFAQFSSDLDKATQNQLARGQRLRELLKQSQAKPLTVAEQILTIYTGTN----
ATPA_ORYNI       AQFAELQAFAQFASALDKTSQNQLARGRRLRELLKQSQANPLPVEEQIATIYIGTR----
ATPA_ORYSA       AQFAELQAFAQFASALDKTSQNQLARGRRLRELLKQSQANPLPVEEQIATIYIGTR----
ATPA_MAIZE       AQFAELQAFAQFASALDKTSQNQLARGRRLRELLKQSQSNPLPVEEQVATIYTGTR----
ATPA_WHEAT       AQFAELQAFAQFASALDKTSQNQLARGRRLRELLKQSQANPLPVEEQIATIYTGTR----
ATPA_MESVI       AQFAELEAFAQFASDLDKATQNQLARGRRLRELLKQAQSSPLPVAQQVLTIYAGVN----
ATPA_CHLRE       AQFAELEAFSQFASDLDQATQNQLARGARLREILKQPQSSPLSVEEQVASLYAGTN----
ATPA_CHLVU       AQFAELEAFSQFASDLDQATQNQLARGQRLRELLKQSQSSPLSLEDQVASIYAGTN----
ATPA_NEPOL       AQFSELEAFAQFSSDLDAATQAQLARGVRLRELLKQAQSEPLSVADQVATIYTGTN----
ATPA_EUGGR       AQFAELEAFSQFASDLDQATQNQLARGARLRELLKQPQASPLSVADQVATIYTGIN----
ATPA_NOSS1       AQFDDLQAFAQFASDLDKATQDQLARGQRLRELLKQSQNQPLSVAEQVAILYAGIN----
ATPA_SYNP6       AQFDELAAFAQFASDLDKATQNQLARGQRLRELLKQPQFSPLILAEQVAVVYAGVK----
ATPA_SYNY3       AQFAELEAFSQFASDLDAATQAQLARGQRLRQLLKQPENSPLSVWEQVAISYAGLN----
ATPA_ANTSP       AQFAELEAFSQFASDLDKATQNQLARGQRLREILKQAQNSPIPVEEQTAIIYAGIN----
ATPA_PORPU       AQFAELEAFSQFASDLDKATQNQLARGQRLREILKQAQNSPIPVEEQTAIIYTGIN----
ATPA_GALSU       AQFAELEAFSQFASDLDKATQNQLARGQRLREMLKQSQNSPIPVEEQIAIIYSGIN----
ATPA_CYACA       AQFDELQAFSQFASDLDKSTQAQLARGQRLRELLKQPQASPISVYEQIPMIYAGIN----
ATPA_GUITH       AQFAELEAFSQFASDLDQATRNQLARGQRLREILKQPQNSPISVEEQVAIIYTGIN----
ATPA_TRICV       AQFAELEAFSQFASDLDEATQKQLARGTRLREVLKQPQNSPLSVAEQVALIYTGIN----
ATPA_SYNP1       AQFDELQAFAQFASDLDKATQNQLARGQRLREILKQPQYSPIPVEYQVATIYAGTN----
ATPA_CYAPA       AQFDELKAFSQFSSDLDKATQLQLARGERLRELLKQQQYAPLPVEEQVAVIYTGIN----
ATPA_MYCTU       SQYRELEAFAAFASDLDAASKAQLERGARLVELLKQPQSQPMPVEEQVVSIFLGTG----
ATPA_MYCBO       SQYRELEAFAAFASDLDAASKAQLERGARLVELLKQPQSQPMPVEEQVVSIFLGTG----
ATPA_MYCLE       SQYRELEAFAAFASDLDATSKAQLERGARLVELLKQPQYQPMPVEEQVISLFLGTG----
ATPA_STRLI       AQFRELEAFAAFGSDLDAASKSQLERGQRMVELLKQNQYQPMSTEDQVVSVWAGTT----
ATPA_AQUAE       AQFRELEAFVQFASELDKATQQQINRGLRLVELLKQEPYNPIPVEKQIVLIYAGTH----
ATPA_RHOBL       AQYREMAAFAQFGSDLDASTQALLNRGARLTELMKQPQYSPLTNAEIVCIIFAGTN----
ATPA_RHOCA       AQYREMAAFAQFGSDLDAATQKLLNRGARLTELMKQPQYSPLTNAEIVAVIFAGTN----
ATPA_RHORU       AQYREMAAFAQFASDLDPATQKLLARGARLTELLKQAQYSPLAVEEQVCVIYAGTR----
ATPA_RICCN       AQFRELESFSQFGSDLDPATKAQIDHGKRLVEILKQAQYHPFPVEEQIVSIYVGTK----
ATPA_RICPR       AQFRERESFSQFGSDLDPATKAQIEHGKRLVEILKQDQYHPCPVEEQIVSIYVGTK----
ATPA_MYXXA       AQYRELAAFAQFGSDLDKATQETLARGARMVELLKQGQYEPMPVEKQVMQIYAATNRDDP
ATPA_PROMO       AQYNELLTFAQFGSDLDKATLAQLERGHRIMEILKQEQYKPFVVEEQVVSFFTVIN----
ATPA_CLOAB       AQYRELAAFAQFGSDLDKESKKRLEKGKRLTEMMKQPQYKPMPVEKQIMILYAVVN----
ATPA_CLOPE       AQYRELASFAQFGSDLDKDTQARLEKGKRLIEILKQDQYKPMAVEKQIMIIYAAVN----
ATPA_ACEWD       AQYRELASFAQFGSDLDDETKAQLAKGERIVEILKQDQYDPMNVEDQVLILYAATN----
ATPA_BACHD       AAYRELEAFAQFGSDLDKATQAKLNRGQRTVEVLKQGLHEPLPVEKQVAIIYALIN----
ATPA_BACPE       AAYRELEAFAQFGSDLDKATQAKLNRGQRTVEVLKQDLHNPLPVEKQVAIIYALTK----
ATPA_BACMQ       ASYRELESFAQFGSDLDQATQAKLNRGARTVEILKQGLHKPLRVEKQVAVLYALTK----
ATPA_BACSU       ASYRELEAFAQFGSDLDQATQAKLNRGARTVEVLKQDLNKPLPVEKQVAILYALTK----
ATPA_BACP3       AAYRELEAFAQFGSDLDKATQANVARGARTVEVLKQDLHQPIPVEKQVLIIYALTR----
ATPA_GEOSE       AAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVLIIYALTR----
ATPA_STAAM       ASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTK----
ATPA_STAAN       ASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTK----
ATPA_STAAR       ASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTK----
ATPA_STAAS       ASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTK----
ATPA_STAAW       ASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTK----
ATPA_STAAC       ASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTK----
ATPA_STAES       ASYRELESFAQFGSDLDEFTAKKLARGERTVEVLKQGQNNPLPVEHQVLIIFALTK----
ATPA_STAEQ       ASYRELESFAQFGSDLDEFTAKKLARGERTVEVLKQGQNNPLPVEHQVLIIFALTK----
ATPA_LACLA       ASFRELEAFTQFGSDLDEATQAKLNRGRRTVEVLKQPLHKPLAVEKQVLILYALTH----
ATPA_LACLM       ASFRELEAFTQFGSDLDEATQAKLNRGRRTVEVLKQPLHKPLAVEKQVLILYALTH----
ATPA_STRMU       ASYRELEAFTQFGSDLDSATQAKLNRGRRTVEVLKQGLHKPLAVEKQVLILYALTH----
ATPA_ENTHA       ASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQKLHAPLAVEKQVVILYALTH----
ATPA_BUCAI       AQYQELAAFSQFSSDLDDTTRKQLNHGQKITELLKQKQYSPISIAEQALILFVAEN----
ATPA_BUCAP       AQYHELAAFSQFASDLDQTTRKQLIYGQKITELLKQKQYRPMSISEQGLMFFIAEN----
ATPA_ECOLI       AQYRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAER----
ATPA_ECO57       AQYRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAER----
ATPA_ECOL6       AQYRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAER----
ATPA_SHIFL       AQYRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAER----
ATPA_HAEIN       AQYRELAAFAQFASDLDDATRKQLSHGEKVTELLKQKQFTPLSVAEQAVILFAVEF----
ATPA_PASMU       AQYRELAAFAQFASDLDDATRKQLSHGQKVTELLKQKQYSPLSVAQQALVLFAVEF----
ATPA_VIBAL       AAYRELAAFAQFSSDLDEATKKQLDHGQKVTELMKQKQYAPMSVFDQALTIFAAER----
ATPA_VIBCH       AAYRELAAFAQFSSDLDEATKRQLTHGQKVTELMKQKQYAPMSVFDQALVIFAAER----
ATPA_BUCBP       AQYQELIAFSQFSSELDEITRNQLIHGKKLIEILKQKQYHPMSIAEQAIILFAAEN----
ATPA_ACIFR       AQYRELAAFAQFASDLDEITRKQIERGKRVTELLKQDQFSPMSVADEGAALFAASS----
ATPA_HELPY       AQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAK----
ATPA_HELPJ       AQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAK----
ATPA2_MYCPU      SKYKQNEKFSDTNFDLNDSVRDIIKKGKILLKILNQKEFQAYSRSFNLIIAYIVVW----
                 : : :   *      *:      :  *    ::::*    .          :        

ATPA_MYCGE       ---AFIKFIPVDEIAKFKQRITEEFNGSHPLFKELSNK--KEFTEDLESKTKTAFKMLVK
ATPA_MYCPN       ---SFIKFIPLDYIAKFKQRIMEEFDKEHPIYKEIATQ--KSFSEALEAQTNTAFKALVK
ATPA_MYCGA       ---RFIKWIPTDHIIKFKEFILDKIKQDQ-VYKKIEEK--KAFDDEIEKELTAFFKDVVK
ATPA_ANTAG       ---GYLDVLEVEQVKKFLVQLREYLITNKPQFVEIIRS-TKVFTEQAEIILKEAIKEHTE
ATPA_MARPO       ---GYLDVLETGQVKKFLIQLREYLVTNKPQFAEIIRS-TKVFTEQAENLLKEAITEHIE
ATPA_ADICA       ---GYLDVLDVEQVKRFLVQLREYVATSKPSFGEIIRS-TKVFTEQAEALLKEAIKESTE
ATPA_PINTH       ---GYLDIFEIAQVRKFLLGLRFYLIKNKPQFGEIIRS-TGTFTEEAKALLEEAL-----
ATPA_SPIOL       ---GYLDSLELDQVRKYLVELRTYVKTNKPEFQEIISS-TKTFTEEAEALLKEAIQEQME
ATPA_TOBAC       ---GYLDSLEVGQVRKFLVELRTYLKTNKPQFQEIISS-TKTFTEEAEALLKEAIQEQMD
ATPA_ARATH       ---GYLDGLEIGQVRKFLVQLRTYLKTNKPQFQEIIAS-TKTLTAEAESFLKEGIQEQLE
ATPA_LOTJA       ---GYLDSLEIRQVRKFLVELRAYLKTNKPQFNEIISS-TKTFTGEAEALLKEAIQEQME
ATPA_PEA         ---SYLDSVEIAQVRKFIVELRAYLKTKKPKFNEIISS-TKTFTGEAEAILKEAIQEQME
ATPA_OENEH       ---GYLDSFEIAQVRKFLDELRDYVKTRKPQFEEIISS-TKIFTEEAQALLKDAIQEQKE
ATPA_ORYNI       ---GYLDSLEIGQVKKFLDELRKHLKDTKPQFQEIISS-SKTFTEEAEILLKEAIQEQLE
ATPA_ORYSA       ---GYLDSLEIGQVKKFLDELRKHLKDTKPQFQEIISS-SKTFTEEAEILLKEAIQEQLE
ATPA_MAIZE       ---GYLDSLEIEQVKKFLDELRKHLKDTKPQFQEIISS-SKTFTEQAETLLKEAIQEQLE
ATPA_WHEAT       ---GYLDSLEIEQVNKFLDELRKHLKDTKPQFQEIISS-SKTFTEQAEILLKEAIQEQLE
ATPA_MESVI       ---GYLDSIAIEDVKKFLAGLRNYVITSKAAIINNINS-SKAVTPETEGMMKEAINEYKK
ATPA_CHLRE       ---GYLDKLEVSQVRAYLSGLRSYLANSYPKYGEILRS-TLTFTPEAEGLVKQAINEYLE
ATPA_CHLVU       ---GYLDVLPADRVRAFLVGLRQYLATNKAKYGEILRS-TNALTDEAQTLLKEALKEYTE
ATPA_NEPOL       ---GYLDDLAPTQVRAFLSALRSYLATSKPKYAQIM-A-ANVFTPEAESLVKEAIAETKA
ATPA_EUGGR       ---GYLDDINLEDVRGFLIELREHINNEKPTFKEIINK-TKTFTQEAELLLKFTIIDLKK
ATPA_NOSS1       ---GYLDDIPVDKVTTFTKGLRDYLKSGVNPYFQDVQS-KKALGDDEEKALKAALEDYKK
ATPA_SYNP6       ---GLIDEIPVNQVTAFVSELRSYLKTSKPEFIEKVQS-SKQLDDAAEALLKEAIAEVKK
ATPA_SYNY3       ---GYIDTIPVDKVTEFAQGLRDYLKANKAKYVEIINS-SKALTDEAETLLKEGIKEFTQ
ATPA_ANTSP       ---GYLDEVELSQVKDFVLALREDLRNSKPEFGESILS-TKKLNPDSEEILKKAISDVAQ
ATPA_PORPU       ---GYLDDIAVNKVPDFIIKLREDLKNSKPEFGESIRS-SKKLDTASEELLKKAIEDVKQ
ATPA_GALSU       ---GYLDEIPLQKVSSFIKALREYIVNSKSKFIELIKS-NKQLVSEAEEILKQSIQETKA
ATPA_CYACA       ---GFLDDIKIDRISLFIKKLQECLSNSYPHFYEAIKE-SKQLSKENEEVLKKAITEVKK
ATPA_GUITH       ---GYLDDIAVDKVRRFVTNLRTNLKNSKPQYAEIIRN-TKTFNSDAENLLKSAIADTKQ
ATPA_TRICV       ---GFLDELEVASVKKYCASLLSFLNTSNNSYIGIVSS-TNQFTAEAETALKEAISESKA
ATPA_SYNP1       ---GYLDDIPVEAVAKFVAGLRDYLATSKPQYGEAVRS-SQKLDETAEALLKEAIAEYKA
ATPA_CYAPA       ---GFLDNIETKQVSAFISNLRENLSVKRAKFGEIIRS-EKALTAEAENLLKDAISDCKQ
ATPA_MYCTU       ---GHLDSVPVEDVRRFETELLDHMRASEEEILTEIRD-SQKLTEEAADKLTEVIKNFKK
ATPA_MYCBO       ---GHLDSVPVEDVRRFETELLDHMRASEEEILTEIRD-SQKLTEEAADKLTEVIKNFKK
ATPA_MYCLE       ---GHLDSVPVGDVRRFETELLDHIRVAQEEILTEIRE-SQKLTDEAADSLTEVIKSFKK
ATPA_STRLI       ---GKMDEVPVADIRRFEKELLEYLHRQEQGLMTSIRE-GGKMSDDTLQAVAEAIAAFKK
ATPA_AQUAE       ---GYLDDIPVESVRKFEKELYAYLDNERPDILKEISE-KKKLDEELEKKIKEALDAFKQ
ATPA_RHOBL       ---GYLDKVAVRDVGRFEAGLLKHLRTKGKALLDDMTKNDRKVAGDLEKAIRAELDAFAK
ATPA_RHOCA       ---GFLDAVPVKEVGRFEKGLLAYLRSTRKDVLEWLTKEDPKIKGDAEKKLKDAIAEFAK
ATPA_RHORU       ---GYLDKLKTTDVVRYEASLLGALRTSGADLLESIRT-GKALSKEIEQKLVKFLDDFGK
ATPA_RICCN       ---KYLNDVPLQKVKEFEDKMLTEIRLNKKDILESIKN-EQRITEETEQKLKAFLENFVK
ATPA_RICPR       ---KYLNDIPIQKVKEFEEAMLAEIRLNKKDILESIKT-EQCITEEIEQKLKAFLENFIQ
ATPA_MYXXA       KKRGWIRDIPTADVVRWMREFLEFADGKHPNVAKDLAS-KRELTADIKTALSKAITEFNE
ATPA_PROMO       ---GYLDDIAIDQVRRFEKELLEELKDNTTILAEIVEK--KAIKEDLDAKLRKAIEDFKK
ATPA_CLOAB       ---EYVMDIDVSKLSAFESGLFEYVDAHYRDLGKQILE-KKELTDDISSQLTKAINEYKK
ATPA_CLOPE       ---NFLLDIKVSDIKRFEKEFLEYMDTHHREIGKAILD-KKVLDDELKSALESAIVEFKK
ATPA_ACEWD       ---GFLLDIEVKDIREFEKGLIKFAQKKYPEIMTKVKG-KDGLSDEVVAAFAECIEAYKK
ATPA_BACHD       ---GFLDDIPVGDVRRFESELFTFLDHNKKELLDHIRT-TGNLPDD--SEFKAAITEFKQ
ATPA_BACPE       ---GFMDDIPVEDVQRFESEFFTFLDHNKKDLLDHIRT-TGNLPED--ADFKAAIEEFKK
ATPA_BACMQ       ---GFLDDVPVSDITRFEDEYLTWLESNRKEVLESIRT-TGGLPEA--GLFESALEEFKK
ATPA_BACSU       ---GYLDDIPVADIRRFEEEYYMYLDQNHKDLLDGIAK-TGNLPAD--EDFKAAIEGFKR
ATPA_BACP3       ---GFLDDIPVEDVRRFEKEFYLWLDQNGQHLLEHIRT-TKDLPNE--DDLNQAIEAFKK
ATPA_GEOSE       ---GFLDDIPVKDVRRFEKEFYLWLDQNGQHLLEHIRT-TKDLPNE--DDLNQAIEAFKK
ATPA_STAAM       ---GYLDDIPVVDITRFEDELNHWAESNATELLNEIRE-TGGLPDA--EKFDTAINEFKK
ATPA_STAAN       ---GYLDDIPVVDITRFEDELNHWAESNATELLNEIRE-TGGLPDA--EKFDTAINEFKK
ATPA_STAAR       ---GYLDDIPVVDITRFEDELNHWAESNATELLNEIRE-TGGLPDA--EKFDTAINEFKK
ATPA_STAAS       ---GYLDDIPVVDITRFEDELNHWAESNATELLNEIRE-TGGLPDA--EKFDTAINEFKK
ATPA_STAAW       ---GYLDDIPVVDITRFEDELNHWAESNATELLNEIRE-TGGLPDA--EKFDTAINEFKK
ATPA_STAAC       ---GYLDDIPVVDITRFEDELNHWAESNATELLNEIRE-TGGLPDA--EKFDTAINEFKK
ATPA_STAES       ---GYLDDIPVQDINRFEEEFNHWAESNATELLNEIRE-TGALPDA--DKFDSAITEFKK
ATPA_STAEQ       ---GYLDDIPVQDINRFEEEFNHWAESNATELLNEIRE-TGALPDA--DKFDSAITEFKK
ATPA_LACLA       ---GHLDDVPVDDVLDFETKMFDFFDANYAELLNVITE-TKDLPEE--AKLDEAIKAFKN
ATPA_LACLM       ---GHLDNVPVDDVLDFETKMFDFFDANYADLLNVITD-TKDLPEE--AKLDEAIKAFKN
ATPA_STRMU       ---GFLDSVPVDDILTFQDDMFDYIDSHDADIFETIRT-TKDLPEE--AVLDKAIQTFKD
ATPA_ENTHA       ---GFLDSIPVDSILDFEHELFEYLDTNHADIFETIRT-TKDLPEE--ERLNQAIQEYKD
ATPA_BUCAI       ---NFLDDISIDKITKFEKEILIYAHNYYFDLMEEINK-TGDFNIVIKDKFIKLITEFKK
ATPA_BUCAP       ---NFLDDISVENIIQFEKEILTYAYNYHLDLMEEINK-DGNFNDIIKKKFIELINNFKN
ATPA_ECOLI       ---GYLADVELSKIGSFEAALLAYVDRDHAPLMQEINQ-TGGYNDEIEGKLKGILDSFKA
ATPA_ECO57       ---GYLADVELSKIGSFEAALLAYVDRDHAPLMQEINQ-TGGYNDEIEGKLKGILDSFKA
ATPA_ECOL6       ---GYLADVELSKIGSFEAALLAYVDRDHAPLMQEINQ-TGGYNDEIEGKLKGILDSFKA
ATPA_SHIFL       ---GYLADVELSKIGSFEAALLAYVDRDHAPLMQEINQ-TGGYNDEIEGKLKGILDSFKA
ATPA_HAEIN       ---GYLDDVELSKIASFETALLDYSNRNHAEFMQELNK-TGNYNDEIKDTLKSILDGFKA
ATPA_PASMU       ---GYLEEVDLDRIGSFESALLEYANHNYADFMRELTQ-SGNYNDEIKESLKGILDSFKA
ATPA_VIBAL       ---GYLDDVELNKVLDFEAALLSYARGQYAELAAEIDK-SGAYNDEIEAQLKKLTDDFKA
ATPA_VIBCH       ---GYLTDVELNKVLDFEAALLSYARAHYAELAAQIDK-TGAYNDEIEAQLKKLVDDFKA
ATPA_BUCBP       ---NFLNDVSVEQIIKFEKMLLLFFNTNNSELVLSINN-YKRINDVVENQLSDVINAFKL
ATPA_ACIFR       ---GALDDVEVANVRPFEKALLAYLNSNNKELMAGIEE-KKDLTDDLKKQLDAAVKQFKS
ATPA_HELPY       ---GFLDSVSVKKVVDFEEQLHPFLEAKYPQVLEEIHT-KKALDKDLEAMLRKVLEEFKL
ATPA_HELPJ       ---GFLDSVSVKKVVDFEEQLHPFLEAKYPQVLEEIHT-KKVLDKDLEAMLRKVLEEFKL
ATPA2_MYCPU      ---GIFEDEEKIYDKLIYLYFVLRYDYIGKILVNVVDKKSGVDGMVDEGVLKAEIMRLLA
                      .                                                      

ATPA_MYCGE       RFISTLTDYDITKFGSIEELN----------------------------
ATPA_MYCPN       RFVSALPDYDITKYGTMEELE----------------------------
ATPA_MYCGA       KYTSTLVDYNGSLYGDLKELE----------------------------
ATPA_ANTAG       FFLLQEQK-----------------------------------------
ATPA_MARPO       LFLFQEEK-----------------------------------------
ATPA_ADICA       LFLLQER------------------------------------------
ATPA_PINTH       -------------------------------------------------
ATPA_SPIOL       RFLLQEQA-----------------------------------------
ATPA_TOBAC       RFILQEQA-----------------------------------------
ATPA_ARATH       RFLLQEKV-----------------------------------------
ATPA_LOTJA       LFLLQEQVEKN--------------------------------------
ATPA_PEA         LF-----------------------------------------------
ATPA_OENEH       LFLVQE-------------------------------------------
ATPA_ORYNI       RFSLQEQT-----------------------------------------
ATPA_ORYSA       RFSLQEQT-----------------------------------------
ATPA_MAIZE       RFSLQEQT-----------------------------------------
ATPA_WHEAT       RFSLQ--------------------------------------------
ATPA_MESVI       VFAAGA-------------------------------------------
ATPA_CHLRE       EFKSQAKAA----------------------------------------
ATPA_CHLVU       EFLASAK------------------------------------------
ATPA_NEPOL       SFK----------------------------------------------
ATPA_EUGGR       NFKKRIK------------------------------------------
ATPA_NOSS1       TFKATA-------------------------------------------
ATPA_SYNP6       NILAAV-------------------------------------------
ATPA_SYNY3       GFAA---------------------------------------------
ATPA_ANTSP       AFSL---------------------------------------------
ATPA_PORPU       GFVKA--------------------------------------------
ATPA_GALSU       TFLASE-------------------------------------------
ATPA_CYACA       NLSFI--------------------------------------------
ATPA_GUITH       SFV----------------------------------------------
ATPA_TRICV       VFMK---------------------------------------------
ATPA_SYNP1       GFTA---------------------------------------------
ATPA_CYAPA       AFLSNI-------------------------------------------
ATPA_MYCTU       GFAATGGGSVVPDEHVEALDEDKLAKEAVKVKKPAPKKKK---------
ATPA_MYCBO       GFAATGGGSVVPDEHVEALDEDKLAKEAVKVKKPAPKKKK---------
ATPA_MYCLE       GFAATGGASVVPNEHVAALDEEKLDKESVKVHQAIPAKTSEKSKNSTPR
ATPA_STRLI       QFETSDG--------------KLLGEDAPSAAK----------------
ATPA_AQUAE       KFVP---------------------------------------------
ATPA_RHOBL       DFA----------------------------------------------
ATPA_RHOCA       TFA----------------------------------------------
ATPA_RHORU       KFA----------------------------------------------
ATPA_RICCN       EFVK---------------------------------------------
ATPA_RICPR       AYCVML-------------------------------------------
ATPA_MYXXA       VFQPTPGAKV---------------------------------------
ATPA_PROMO       KFS----------------------------------------------
ATPA_CLOAB       IFLAEEQ------------------------------------------
ATPA_CLOPE       IFLM---------------------------------------------
ATPA_ACEWD       VFSKSV-------------------------------------------
ATPA_BACHD       GFVTTK-------------------------------------------
ATPA_BACPE       GFSASK-------------------------------------------
ATPA_BACMQ       TFIASE-------------------------------------------
ATPA_BACSU       TFAPSN-------------------------------------------
ATPA_BACP3       TFVVSQ-------------------------------------------
ATPA_GEOSE       TFVVSQ-------------------------------------------
ATPA_STAAM       SFSKSE-------------------------------------------
ATPA_STAAN       SFSKSE-------------------------------------------
ATPA_STAAR       SFSKSE-------------------------------------------
ATPA_STAAS       SFSKSE-------------------------------------------
ATPA_STAAW       SFSKSE-------------------------------------------
ATPA_STAAC       SFSKSE-------------------------------------------
ATPA_STAES       GFNKSEE------------------------------------------
ATPA_STAEQ       GFNKSEE------------------------------------------
ATPA_LACLA       TTNY---------------------------------------------
ATPA_LACLM       TTNY---------------------------------------------
ATPA_STRMU       QSQFS--------------------------------------------
ATPA_ENTHA       IFLATKGNTSSTEDKLKSIQNA---------------------------
ATPA_BUCAI       NQF----------------------------------------------
ATPA_BUCAP       S------------------------------------------------
ATPA_ECOLI       TQSW---------------------------------------------
ATPA_ECO57       TQSW---------------------------------------------
ATPA_ECOL6       TQSW---------------------------------------------
ATPA_SHIFL       TQSW---------------------------------------------
ATPA_HAEIN       NSAW---------------------------------------------
ATPA_PASMU       NSAW---------------------------------------------
ATPA_VIBAL       TQTW---------------------------------------------
ATPA_VIBCH       TQTW---------------------------------------------
ATPA_BUCBP       TKCWS--------------------------------------------
ATPA_ACIFR       GSTY---------------------------------------------
ATPA_HELPY       TYSE---------------------------------------------
ATPA_HELPJ       TYSE---------------------------------------------
ATPA2_MYCPU      HFKDIHNIKTKSYNDGKFNLSTRVLHKVKDRIWEK--------------