CLUSTAL format seed alignment for MF_01347

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPB_TROWT       --------------------------MTGDAVGRIVRVTGSVVDVEFSR----NNLPGVF
ATPB_LEIXX       --------------MTTATAEAQASTAQPAGVGRIARVTGPVVDIEFPH----DSIPGIY
ATPB_BIFLO       -------------------MADNQTTAAEPTNGRVTRVQGSVIDVEFPV----GHLPDIY
ATPB_CUTAK       ---------------MTATTITPETKDEVVGVGRVVRVIGPVVDVEFPA----GQLPEIL
ATPB_THEFY       -----------------MTATAEGTAAPTTVTGRIARVIGPVVDVEFPV----GSLPPIY
ATPB_STRAW       ---------------------MTTTVETAVATGRVARVIGPVVDVEFPV----DAMPDMY
ATPB_FRACC       --------------MTVTTSSPATAPGRTPGIGRVARVIGPVVDVEFAP----DELPEIY
ATPB_CORJK       -------------MTTANQVQP--SAESA-VAGRVVRVIGPVVDVEFPR----GQQPALF
ATPB_CORGL       -------------MTTALEEQN--AQQAA-TAGRVVRVIGAVVDVEFPR----GELPALY
ATPB_RHOJR       -------------MTAAVTENNGAGSGSS-VAGRVVRVIGPVVDVEFPR----GAIPELF
ATPB_MYCLE       -------------MSTTKTTKMTVKTGSKGTSGRVVRVTGPVVDVEFPH----GFVPELF
ATPB_FERIS       --------------------------MSKKSVGKIVRIIGPVVDVKFQE----GDLPDIY
ATPB_THEMA       --------------------------MAKGSKGFIVSIMGPVVDVKFPE----EELPDIY
ATPB_AQUPY       --------------------------MAEVIKGRIVQVIGPVVDVEFEGV---KELPRIK
ATPB_NITWN       ------------------------MATAANQVGRITQVIGAVVDVQFEG-----HLPAIL
ATPB_BRADU       ---------------------------MAAQSGRVTQVIGAVVDVQFEG-----HLPAIL
ATPB_RHILO       -----------------------MAAKATGVVGKVRQVIGAVVDVQFGD-----HLPAIL
ATPB_AGRFC       ----------------MAKAATPKKTAAVNGAGKVTQVIGAVVDVAFEG-----ELPPIL
ATPB_MAGSA       --------------------------MANKNVGTITQVLGAVVDVRFDG-----QLPAIL
ATPB_PELUB       -----------------------------MSKGKITQIIGAVVDVKFDG-----ELPEIL
ATPB_RHORT       --------------------------MAKNNLGTITQVTGAVVDVKFEG-----ELPSIL
ATPB_RUEPO       ---------------------------MANAKGKVTQIIGAVVDVQFDD-----ALPEIL
ATPB_RUEST       ---------------------------MANAKGKVTQIIGAVVDVQFDG-----ELPAIL
ATPB_ROSDO       ---------------------------MANAVGKITQVIGAVVDVQFAD-----HLPEIL
ATPB_JANSC       ---------------------------MANAVGKITQVIGAVVDVQFND-----HLPEIL
ATPB_RHOCA       ----------------------------MASKGKVTQVIGAVVDVQFED-----GLPAIL
ATPB1_RHOS4      --------------------------MATASQGKVTQVIGAVVDVQFDG-----GLPPIL
ATPB_RHOBL       -----------------------MTMATTVSKGKVTQVIGAVVDVQFEG-----VLPAIL
ATPB_NOVAD       ----------------------MATVLS--STGKISQVIGAVVDVTFDG-----ELPAIL
ATPB_ZYMMO       ----------------------MATASSKKNIGRISQVIGPVVDVLFEE-----KLPPLL
ATPB1_GLUOX      ----------------MSETLTPSAGAANNVVGRVTQVRGPVVDVQFEG-----DLPFIL
ATPB_RICTY       ---------------------------MTQNIGKITQVISAVVDVKFTNN---SKLPEIL
ATPB_RICBR       ---------------------------MKKNIGKITQIISAVVDVKFTNK---GKLPQIL
ATPB_ANAMM       ---------------MKGKVAQKRAAASPSGVGEVIRVMPAVVDVEFPH----GGVPEVL
ATPB_ANAPZ       ----------------------MNQDSGCEGVGEVVRVMPAVVDVEFAH----GGLPDIL
ATPB_EHRCJ       MSSLANKAKSKGKSSKSKSNVNTQVDELSDSIGLVVRVMTAVVDIKFDG----GKVPKIL
ATPB_EHRCR       MSGLASKAKSRVKSSKGKNSTNIHADELNEDVGVVVRVMTAVVDVKFAS----GKIPKIL
ATPB_EHRRW       MSSLTGKVKGRAR--KIKGDADIRINESTENVGLVIRVMTAVVDIKFPS----GKVPKIL
ATPB_WOLTR       -----------------------------MNVGRTVKVTQAVVDLKFE-----GELPRIF
ATPB_NEOSM       ---------------------------MPVSIGKIVRVVGPTVDVKFED----GTLPKIE
ATPB_CAMJR       ------------------------------MQGFISQVLGPVVDVDFND-----YLPQIN
ATPB_SULDN       --------------------------MEKNMIGKISQVMGPVVDVDFDG-----YLPIIN
ATPB_HELHP       ------------------------------MQGKITQVMGPVVDVEFSS-----YLPMIN
ATPB_WOLSU       ------------------------------MEGRITQVMGPVVDVDFDS-----YLPAIN
ATPB_HELPJ       ---------------------------MKAMEGKIIQVLGPVVDVEFES-----YLPAIF
ATPB_DESPS       --------------------------MSEQKIGKITQVIGPVVDVEFEP----GQLPNIL
ATPB_SYNAS       -----------------------------MNIGRIVQVIGPVIDVVFEE----GQLPAIL
ATPB_DESAG       ----------------------------MSNIGKITQVIGAVVDVEFAD----GNLPNIL
ATPB_DESVH       ---------------------------MSANIGKIVQVIGAVVDVEFPS----GQLPNIL
ATPB_LAWIP       ---------------------------MSENIGKIVQVIGAVVDVSFPN----GKLPPIL
ATPB_MYXXD       ------------------------MSAQVPTAGRIIQVLGPVVDVEFPP----GGLPEVY
ATPB_STIAU       ------------------------MSAQVATVGKITQVLGPVIDVEFPP----GGLPEVY
ATPB_ANADE       -----------------------MPTATNVENGRITQVIGPVVDVEFPP----GTLPDIY
ATPB_GEOSL       ---------------------------MSQNFGKISQVIGAVIDVEFEP----GKLPPIY
ATPB_BDEBA       -----------------------------MAFGKVKQVMGPVVDVEFEG----GELPAIN
ATPB_CHLP8       -----------------------------MQEGKISQIIGPVVDVDFPE----GQLPSIL
ATPB_KORVE       ---------------------------MAENFGKVIQISGPAVDVQFSE----TTLPEIY
ATPB_OENEH       ------------MRINPTTSGPGVSTLEKKKSGRIAQIIGPVLDVTFPP----GKMPNIY
ATPB_ORYSA       ------------MRTNPTTSRPGVSTIEEKSTGRIDQIIGPVLDVTFPP----GKLPYIY
ATPB_PEA         ------------MTITPPPSDTEVSVLENKNLGRITQIIGPVLDVVFPP----GKMPYIY
ATPB_CUSRE       ------------MRINPPTYGSEISSIEKKNRGHIVQIIGPVLDVAFPP----GKMPNIY
ATPB_CUSPE       ------------MRLTP-NYDYEVSSIDKKKRGYIVQIIGPVLDVPFSP----GMXPSIY
ATPB_PTEAQ       ------------MVTKTSFLSFEISELVKKNVGYITQIIGPVLDVASSP----GKMPNIY
ATPB_HUPLU       --------------MEINPFALGVSTLVEKNVGYITQIIGPVLDVAFPP----GKMPNIY
ATPB_PSINU       --------------MKINLLTFGVSTLVERNIGYITQIIGPVLDAAFPP----GKMPNIY
ATPB_STAPU       --------------MKTSFFSLGASTVTTKNVGRITQIIGPVLDAAFLP----GQMPNIY
ATPB_ZYGCR       --------------MNNTHITLVASTVATKNVGRITQIIGPVLDASFPP----GKMPNIY
ATPB_CHAVU       --------------MTTVNLDLQNSLVAEKNRGKITQIIGPVMDISFLP----GQMPNIY
ATPB_PINKO       --------------MRTNPLVLGVSALVEKNVGYIAQIIGPVLDVSFSP----GYMPNIY
ATPB_MESVI       -----------------------MTAIETKRIGSITQIIGPVLDAKFPP----GQMPNIY
ATPB_CHLRE       ---------------------MSDSIETKNM-GRIVQIIGPVLDIVFAK----GQVPNIY
ATPB_TETOB       ----------------------MSDLNTKNV-GKISQIIGPVLDIAFGQ----GQVPNIY
ATPB_TUPAK       ---------------------MVLSIQTNKNVGSITQIIGPVIDAAFAP----GQLPNIY
ATPB_CHLVU       ---------------------MSVSTETKSS-GRITQIIGPVLDVSFPA----GKMPNIY
ATPB_OLTVI       ---------------------MNVSVEAKNI-GKVVQIIGPVLDVEFSA----DQMPNIY
ATPB_NEPOL       ---------------------MSQAGVKTKQAGKIVQIVGPVMDVAFQP----GSMPNIY
ATPB_OSTTA       ----------------------MTALKTEQNIGRITQIIGPVIDAVFSP----NKMPNIY
ATPB_EUGGR       -----------------------MKSSLRLNTGIILQIIGPVMDISFPS----GKMPNIY
ATPB_PROWI       ----------------------MTVFIETQNFGTITRIIGPVLDITFTG----NKMPKIY
ATPB_CYAPA       ----------------------MATTTSKTNTGYVTQVIGPVLDVSFPN----GQLPKIY
ATPB_GUITH       ------------------------MTNTATNIGYITQIIGPVVDVEFTT----GKLPQIY
ATPB_TRICV       ------------------------MVKTNINKGYVNQIIGPVLDIEFPS----GTLPPIY
ATPB_PYRYE       ------------------------MVSTTKSTGSVTQIIGPVLDIAFPN----GQLPKVF
ATPB_GRATL       -----------------------MQMVSIKNQGCVTQIIGPVLDIEFPN----GQLPKVF
ATPB_CYAM1       ------------------------------MSGKVVQIIGPVLDIEFPS----GQLPKLL
ATPB_GALSU       ------------------------MSTIAQNKGYISQIIGPVIDIEFPN----GTLPKIY
ATPB_EMIHU       ------------------------MVDTASKTGFISQIIGPVVDVEFPG----GELPTVY
ATPB_OCHNE       ------------------------MVDVASKTGIISQIIGPVVDVEFSS----GDLPKVY
ATPB_PYLLI       ------------------MTKKKTEKEKGINNGYITQVIGPVIDAVFSS----GILPKIY
ATPB_DICDH       ------------------MSENLN-REPELNIGYITQVIGPVIDAVFSA----GQLPKIY
ATPB_CYACA       -----------MKPCQLKQKQKTLAIAKVNNKGKVIQIIGPVLDIVFPD----GQLPKVF
ATPB_TRIV2       ----------------------MVTTAEKTNIGYITQIIGPVVDVKFPS----GKLPQIY
ATPB_SYNP1       ----------------------MVTTAERTNVGFITQVIGPVIDIEFPS----GKMPAIY
ATPB_PRODI       ----------------------MVATTETTNIGKITQIIGPVVDAEFPS----GKMPRIY
ATPB_SYNY3       ----------------------MVAVKEATNVGKITQVIGPVIDAQFPS----GKLPRIY
ATPB_PROMM       --------------------MAAAATATAGTKGVIRQVIGPVLDVEFPA----GKLPKIL
ATPB_SYNS9       --------------------MVASAPASAGTKGVIRQVIGPVLDVEFPA----GKLPKIY
ATPB_PROMP       --------------------MVATPSTSAPAKGVVRQVIGPVLDVEFPA----GKLPKIL
ATPB_SYNE7       ----------------------MVTTTEKTNIGYIRQVIGPVVDVEFPA----GKLPQIY
ATPB_SYNJA       ---------------------MVTATATATNVGYITQVIGPVIDAEFPS----GKLPEIY
ATPB_GLOVI       -----------------------MVTTTAKNVGYITQIIGPVVDAEFPE----GDLPAIY
ATPB_LEPIC       -----------------------------MNKGKIKQIIGSVLDIEFEN----GELPEIY
ATPB_FUSNN       -----------------------------MNKGTITQIISAVVDIAF-K----DELPAIY
ATPB_PROMO       ----------------------------MENKGVITQIIGPVVDVTF-E----NELPRIY
ATPB1_RHOFT      --------------------MAQDTQTNTAVQGKIVQCIGAVVDVEFPR----DQMPKIY
ATPB2_PARXL      ------------------------MSTTALVEGKIVQCIGAVIDVEFPR----DHMPKIY
ATPB1_NITMU      -----------------------------MNQGKIVQCIGAVVDVEFAR----EEMPKVY
ATPB_NITEU       ----------------------------MSHQGKIVQCIGAVIDVEFTP----GEIPKVY
ATPB_CUPPJ       -----------------------------MSIGNIVQCIGAVVDIEFPR----NAMPKVY
ATPB_BORA1       -----------------------------MSNGTIVQCIGAVVDIQFPR----DQMPKIY
ATPB_AROAE       -----------------------------MSQGTIVQCIGAVVDIQFPR----EAMPKVY
ATPB_DECAR       -----------------------------MSQGSIVQCIGAVVDIHFPR----DAMPKVY
ATPB_METFK       -----------------------------MSQGKVVQCIGAVVDVEFPR----DQMPKVY
ATPB_NEIMA       -----------------------------MSQGKIVQIIGAVVDVEFPR----DMIPRVY
ATPB_CHRVO       -----------------------------MSQGKIVQIIGAVIDVEFPR----DAMPKVY
ATPB_PSYCK       -----------------------------MSSGRIVQIIGAVLDVEFNR----NEVPKIF
ATPB_ACIAD       -----------------------------MSSGRIIQIIGAVIDVEFER----NSVPKIY
ATPB_XANC5       -----------------------------MSQGKIVQIIGAVVDVEFQR----NEVPKVY
ATPB_XYLFT       -----------------------------MNQGKIVQIIGAIVDVEFPR----NNVPKVY
ATPB_ALCBS       -----------------------------MSSGRIVQIIGAVIDVEFPR----EAVPKVY
ATPB_HAHCH       -----------------------------MSSGQIVQIIGAVIDVEFPR----DTVPKVY
ATPB_SACD2       -----------------------------MSSGRIVQIIGAVIDVEFPR----DSVPKVY
ATPB_CHRSD       ------------------------------MSGRIVQIIGAVIDVEFPR----DAVPKVY
ATPB_PSESM       -----------------------------MSSGRIVQIIGAVIDVEFPR----DSVPSIY
ATPB_PSEHT       -----------------------------MSLGKVVQIIGAVVDIEFPQ----NNVPAVY
ATPB_COLP3       -----------------------------MSTGKVVQIIGAVVDVEFPQ----DAVPQVY
ATPB_IDILO       -----------------------------MSQGKVVQIIGAVVDLEFPQ----DAVPKVY
ATPB_SHEON       -----------------------------MSTGTVVQVIGAVVDVEFPQ----DAVPQVY
ATPB_PASMU       -----------------------------MATGKIVQIIGAVIDVEFPQ----DAVPKVY
ATPB_MANSM       -----------------------------MSAGKIVQIIGAVIDVEFPE----NAVPKVY
ATPB_ECOLI       -----------------------------MATGKIVQVIGAVVDVEFPQ----DAVPRVY
ATPB_METCA       -----------------------------MSSGKIVQIIGAVVDAEFPR----ESLPKIY
ATPB_NITOC       -----------------------------MSTGKTVQIIGAVVDVEFPR----ESIPKVY
ATPB_LEGPH       -----------------------------MSLGTVVEVIGAVVDVEFPR----DSVPKVN
ATPB_COXBU       --------------------------MTTAKSGTTIEIIGAVVDVEFPR----HAVPKVY
ATPB_FRATT       -----------------------------MSTGKIIQVIGAVIDVEFAR----DNTPKVY
ATPB_THIDA       -----------------------------MSNGKIVQIIGAVVDVEFPR----DAMPKVM
ATPB_ACIFR       ----------------------MSERCKENAVGHIVQVIGPVIDVAFSR----GQVPEIM
ATPB_HYDCU       ------------------------------MNGKIVQIIGPVIDVEFKG----ADLPKIY
ATPB_VIBCH       -----------------------------MATGKIVQIIGAVVDVEFPQ----SEVPSVY
ATPB_ALIF1       -----------------------------MTTGKIVQIIGAVVDVEFPQ----GEVPRVY
ATPB1_PHOPR      -----------------------------MATGKIVQIIGAVVDVEFPQ----DSVPKVY
ATPB2_PHOPR      -----------------------------MSTGKIVKVIGAVVDVEFDQ----DSVPRVY
ATPB_BUCAI       -----------------------------MATGKIIQIIGAVVDVEFNQ----DSVPKIY
ATPB_BUCAP       ----------------------------MIATGKIIQIIGAVVDVEFDQ----NSVPKIY
ATPB_BUCBP       -----------------------------MITGKIVQIIGAVVDVEFSQ----QSVPKIF
ATPB_BAUCH       -----------------------------MTTGKIIQVIGAVVDVEFPQ----NIVPKVY
ATPB_BLOFL       -----------------------------MSIGKIIQVIGAVIDVEFQY----NDIPNLY
ATPB_BLOPB       -----------------------------MSSGKIVQVIGAVVDVAFNQ----DVVPTVY
ATPB_WIGBR       -----------------------------MDTGKIVQIIGPVIDVKFEI----SFIPKIN
ATPB_HERAU       -----------------------------MATGKILQITGVVIDAEFPA----DSLPQIY
ATPB_RHOBA       -------------------------MSTATATGRVTQVIGSTFDAEFPE----GQLPKIY
ATPB_DEHMC       -----------------------------MANGKVIQVIGSVVDVEFSA----DSMPALF
ATPB_ACEWD       ---------------------------MAQNIGKVVQVIGPVVDVKFQK----DKLPKLN
ATPB_SYMTH       ---------------------------MSEPTGKILAIMGAVVDVEFPD----GHLPKLN
ATPB_CALS4       -----------------------------MKKGYITQVIGPVVDIRFE-----GDLPPIN
ATPB_PARUW       -----------------------------MAVGKVKQIVGPTLDIEFPP----GQLPNIL
ATPB_PECFR       -----------------------------MAKGKIVQVIGPVVDIEFPA----EELPSIL
ATPB_CARHZ       -----------------------------MNVGRVVQVIGVVVDVEFEP----GKVPPIY
ATPB_MOOTA       -----------------------------MNEGQVVQVIGPVVDVEFAS----DRLPDLY
ATPB_DESHY       -----------------------------MNIGKIVQIMGAVVDVEFAS----EALPEIY
ATPB_CLOAB       ---------------------------MPEHVGKIVQVIGPVVDIKFD----AENLPDIY
ATPB_CLOPE       ---------------------------MSNNIGKVVQVIGPVVDIKFA----NDELPNIF
ATPB_BACTN       ---------------------------MSQIIGHISQVIGPVVDVYFEGTDAELMLPSIH
ATPB_CELLY       ---------------------------MSKVTGKVSQIIGPVIDVEFQ---AGVDLPKIY
ATPB_SALRD       -----------------------MEVGSNEVKGKIVEVLGPVVDAEFP----RDGVPDIL
ATPB_MYCMS       ----------------MVSKNTTDKKK-NQSIGKVIQVLGSVVDVKFSE----NSIPKIY
ATPB_MESFL       ----------------MAAKKTTSKNTVNSANGFVFQILGPVVDVKFSE----DNIPMIY
ATPB_UREPA       ---------------------MTEVKK-----GKINQILGPVVDVRFPS----EWLPEIN
ATPB_MYCGE       -----------------------MIKKENLTYGKVHQVIGPVVDVIFSES---KQLPRVY
ATPB_MYCPN       ------------------------MKKENITYGKVHQVIGPVVDVIFTES---SQLPRIY
ATPB_MYCGA       -------------------------MNTKYSYGKVYQVVGPVVDVVFEKQ---DDLPKIY
ATPB1_MYCPU      --------------------------MSQKNVGKIVQILGPVVDISFAG----QKIPAIY
ATPB_MYCS5       --------------------------MLEKNKGKIIQILGPVVDVRFTT----GKLPKLL
ATPB_MYCMO       ----------------------------MKNKGKIIQILGPIVDVKFNE----NQLPKLL
ATPB_MYCHJ       -------------------------MEKQKNVGHIVQIFGPVIDVQFPN----EHMPAIL
ATPB_STAHJ       -----------------------------MSNGRVTQVMGPVIDVRFE----HNEVPEIN
ATPB_STAS1       -----------------------------MGLGRVTQVMGPVIDVRFE----HNEVPEIN
ATPB2_LISIN      -----------------------------MSKGQVIQVMGPVVDVKFE----GGNLPEIY
ATPB_GEOSE       -----------------------------MTRGRVIQVMGPVVDVKFE----TGHLPAIY
ATPB_BACSU       -----------------------------MKKGRVSQVLGPVVDVRFE----DGHLPEIY
ATPB_BACMQ       -----------------------------MTKGRVTQIMGPVVDVKFD----NGHLPAIY
ATPB_BACCR       -----------------------------MNKGRVTQIMGPVVDVKFD----GGKLPEIY
ATPB_BACHD       -----------------------------MNTGHITQVMGPVVDVRFQ----SGQLPELN
ATPB_BACSK       -----------------------------MSTGRIIQITGPVVDVKFP----SGQLPEIN
ATPB_OCEIH       -----------------------------MSKGRVTQLMGPVVDVRFE----DAELPAVN
ATPB_STRMU       -----------------------------MSTGKIAQVVGPVVDVAFAT---DDKLPEIN
ATPB_STRR6       -----------------------------MSSGKIAQVIGPVVDVLFAA---GEKLPEIN
ATPB_ENTHA       -----------------------------MSSGKIVQVIGPVVDVEFSL---DQSLPDIN
ATPB_LACLA       -----------------------------MSSGKITQIIGPVVDVEFGS---DAKLPEIN
ATPB_LACAC       -----------------------------MSEGEIVQVIGPVVDVKFPI---DKNLPDIN
ATPB_LACDA       -----------------------------MSQGEIVQVIGLVVDVKFSI---GKDLPDIN
ATPB_LACJO       -----------------------------MSKGEIVQVIGPVVDVEFPL---DKDLPDIN
ATPB_LACCA       ---------------------------MPNSTGKIAQVIGPVVDVAFPI---NDNLPEIN
ATPB_LACSS       -----------------------------MSMGKVVQVIGPVVDVEFSL---DTDLPDIN
ATPB_LACPL       -----------------------------MSTGKVVQVIGPVVDVEFSL---NDKLPDIN
ATPB_LACS1       -----------------------------MSSGKVVQVIGPVVDVQFPL---SESLPDID
ATPB_RUBXD       ----------------MSQDGRRDGQPREGGVGRVVEVKGPVVDVRFPP----DQIPEIY
ATPB2_PELCD      ------------------------MKRQADRSGTVVAVRGGIVDARFDG-----EMPALH
ATPB2_MYCPU      -------------------------------MGKVKHLWSDVYDVEFSE----NELPNIG
                                                 *          *            * : 

ATPB_TROWT       NALKTRVNRSG-------KEIEITLEVAQHLGDDLVRTVAMQS-TDGLIRGQEVLDTGGH
ATPB_LEIXX       NALKTTITIGD-------RSTEITLEVAQHLGDDLVRAISLKP-TDGLVRGGEVRDTGSL
ATPB_BIFLO       NALKVTIVNTSAKEEGEAKETEITLEVEQHLGDSTVRCVALKP-TDGLVRGASVSDTGAP
ATPB_CUTAK       NALHVDAEVMG-------ETHAITLEVALHIGENVVRAISLKP-TDGMRRGTEVRDTGAP
ATPB_THEFY       NALKTEVTLGG-------ETRTITLEVAQHLGDNLVRAISLNP-QDGLVRGAEVRDTGAP
ATPB_STRAW       NALHVEVADPANAG----EKKTLTLEVAQHLGDGLVRTISMQP-TDGLVRQAAVTDTGTG
ATPB_FRACC       QALQVDRTIGD-------ETLTLTLEVAQHIGDNTVRAISMQQ-TDGLVRGAPVHDTGAP
ATPB_CORJK       NALTVEVDLEA-------VAKTITLEVAQHLGDNLVRAVSMAP-TDGLIRGAEVTDTGKP
ATPB_CORGL       NALTVEVTLES-------VKKTVVLEVAQHLGDNLIRTIAMAP-TDGLVRGAAVTDTARP
ATPB_RHOJR       NALHAEITLPS-------VAKTLTLEVAQHLGDNLVRTVSMQP-TDGLIRGTSVSDTGKP
ATPB_MYCLE       NALNAKTTFSS-------LAKTLTLEVAQHLGDNLVRTISLQP-TDGLVRGVEVTDTGNS
ATPB_FERIS       DALVVINPQTGKK---------LILEVEQLIGDNIVRTVAMDS-TDGLVRGLEVENTGEP
ATPB_THEMA       NALEVVNPQTGQK---------VVLEVEQLIGDGVVRTVAMDS-TDGLTKGLEVVDTGAP
ATPB_AQUPY       DGLKTIRRAIDDRG--NWFEEVLFMEVAQHIGEHRVRAIAMGP-TDGLVRGQEVEYLGGP
ATPB_NITWN       NAIETKN-----------GENRLVLEVAQHLGESTVRTIAMDT-TEGLVRGQDVTDTGAP
ATPB_BRADU       NSLETKN-----------GGNRLVLEVAQHLGESTVRTIAMDT-TEGLVRGQEVTDTGSP
ATPB_RHILO       NALETTN-----------VGNRLVLEVAQHLGENTVRCIAMDS-TEGLVRGQEVRDTGAP
ATPB_AGRFC       NALETQN-----------NGNRLVLEVAQHLGENVVRTIAMDS-TEGLVRGQSVADTGAP
ATPB_MAGSA       SALHLEH-----------QGKKLVLEVAQHLGESTVRTIAMDS-TDGLTRGTEVVDTGAA
ATPB_PELUB       SALECKN-----------GDNRLVLEVAQHLGESSVRTIAMDA-TEGLKRGDEVTATGAP
ATPB_RHORT       SALETDN-----------HGNRLVLEVAQHLGESVVRTIAMDS-TEGLVRGQQVTSTGGP
ATPB_RUEPO       NALETEN-----------NGKRLVLEVAQHLGENTVRTIAMDA-TEGLVRGAVVTDTGGP
ATPB_RUEST       NALTTDN-----------NGKKLVLEVAQHLGENSVRTIAMDA-TEGLVRGQEVTDTGAP
ATPB_ROSDO       NALETNN-----------NGNRLVLEVAQHLGENTVRAIAMDA-TEGLVRGQTVTDTDGP
ATPB_JANSC       NALETEN-----------DGKRLVLEVAQHLGEGTVRTIAMDS-SEGLVRGQEVTDTDGP
ATPB_RHOCA       NALETTN-----------NGKRLVLEVAQHLGENTVRTIAMDA-TEGLVRGAAVSDTGGP
ATPB1_RHOS4      NALETEN-----------NGKRLVLEVAQHLGESTVRTIAMDA-TEGLVRGARVTDTGSP
ATPB_RHOBL       NALETTN-----------NGKKLILEVAQHLGENTVRCIAMDA-TEGLVRGAPVSDSGTP
ATPB_NOVAD       SALETDN-----------NGNRLVLEVAQHLGENTVRTIAMDS-TDGLTRGQPVTNTGAQ
ATPB_ZYMMO       TALETKN-----------QDATVVLEVAQHLGENVVRTISMDT-TDGLVRGQEVVDTGSE
ATPB1_GLUOX      NALHVQN-----------GDHTLVLEVAQEIGERQVRCIAMDT-TDGLVRGTEVRDTGKQ
ATPB_RICTY       NALECYN-----------AKQRIVLEVAQHIGDDTVRCISMGS-TEGLIRGLEVIDTGNP
ATPB_RICBR       NALECYN-----------DKQRIVLEIAQHIGDDTVRCIAMNS-TEGLVRGMEVVDTGSP
ATPB_ANAMM       GALESELEY---------AGEKLVLEVAQHLGDRMVRCVAMGS-TDSLSRGDKFISTGNQ
ATPB_ANAPZ       HALKSEKDY---------QGKQLVLEVAQHLGDGVVRCVAMGS-TDGLSRGDKFINTGSP
ATPB_EHRCJ       NALESKKFY---------NGKKLVLEVSQHISDNIVRCIALDS-TDGLSRNDEFIDTRAP
ATPB_EHRCR       NALESKEIY---------NGKKLVLEVSQHISDSIVRCIALDG-TDGLSRNDKFIDTGAP
ATPB_EHRRW       NALESKEIY---------NGKKLVLEVSQHISDSIVRCIALDS-TDGLSRNDEFIDTGAP
ATPB_WOLTR       NALKSKLEY---------RGKELILEVSQHIGDNIVRCIAMDS-TNGVSRNDEFVDTGAP
ATPB_NEOSM       NALTCDN-----------NGKILYLEVAQQLGDGIVRAVAMDS-TDGLTRDKVVKDTGKP
ATPB_CAMJR       EAIVVNFESE-G------KKHKLVLEVAAHLGDNRVRTIAMDM-TDGLVRGLKAEALGAP
ATPB_SULDN       EAIEVNINLE-G------TQTRLVLEVAAHLGDGRVRTIAMDM-SEGLVRGMNATATGSP
ATPB_HELHP       EAIDVNFDIE-G------RKNNLVLEVAAHLGDNRVRTIAMDM-TEGLIRGQEVKARGKP
ATPB_WOLSU       EALDVNYDIE-G------HPKKLVLEVAAHIGDSRVRTIAMDM-TEGLTRGTKVVARGKS
ATPB_HELPJ       EALDINFEVN-G------TQKALVLEVAAHLGGNRVRAIAMDM-TEGLVRNQAVKARGKM
ATPB_DESPS       NACTVTNPGIND------VPDNLVIEIAQHLGDNVCRCIAMDQ-TDGLVRGMVVRDTGLP
ATPB_SYNAS       NAITITNPVIND------EEDNLIVEVAQHLGDNNVRCIAMDV-TDGLVRGMPAKDTGAP
ATPB_DESAG       NALVIKNPNNAD------CPE-LICEVAQHLGDNVVRTIAMDA-TEGLVRGMEVTDTGNP
ATPB_DESVH       NALDIKNPNNTD------APD-LVCEVAQHLGDNIVRTIAMDA-TEGLVRGMEASDTGKP
ATPB_LAWIP       TALEIHNPNSID------APK-LICEVAQHLGDDIVRTIAMDA-TEGLKRGMDVLDTGHP
ATPB_MYXXD       TALKVTNANLSA------AADNLTLEVAQHLGENTVRTIAMDS-TEGLGRGMAVTNTGAP
ATPB_STIAU       TALKVTNTSISA------EADNLTIEVAQHLGENMVRCISMDS-TEGLARGQAVKNTGAP
ATPB_ANADE       TALKVTNPGVDE------RQDNLVIEVAQHLGENTARCIAMDS-TEGLVRGMPVKNTGAP
ATPB_GEOSL       NALRVTNPAIDD------KEYNLVLEVAQHLGENAVRTIAMDS-TDGLVRGQAVLDTGKQ
ATPB_BDEBA       SALRVSNKFISD------VEFNLVLEVAQHLGDGVVRTISMDQ-TEGLVRGEKVKALGTQ
ATPB_CHLP8       DALTVTRQDGS----------KLVLETQQHLGEERVRTISMEG-TDGLVRGMSVANTGRP
ATPB_KORVE       TALRVVSEGFDVP-----TPINVVLEIQQHLGEGRVRCVAMEP-TEGMVRGMKAIDMGGP
ATPB_OENEH       NALVVKGRDTGG------QEINVTCEVQQLLGNNRVRAVAMSA-TDGLTRGMEVIDTGAP
ATPB_ORYSA       NALVVKSRDTDG------KQINVTCEVQQLLGNNRVRAVAMSA-TDGLMRGMEVIDTGAP
ATPB_PEA         NALIVQGRDTVG------KQINVTCEVQQLLGNNRIRAVAMSA-TDGLKRGMEVIDTGAA
ATPB_CUSRE       NALIVKGRDT--------EQMNVTCEVQQLLGNNRVRAVAMND-TDGLMRGMEVIDTGTP
ATPB_CUSPE       NALVVQGRHK--------QEPNVTCEVQQLLGNNRVRAVAMSD-TDGLMRGMEVIDTGTP
ATPB_PTEAQ       NSLIIKGQNPAG------QEINVTCEVQQLLGNNEVRAVAMSA-TDGLTRGMGAVDTGAP
ATPB_HUPLU       NSSIIKGKNPAG------QEMNVTCEVQQLLGNNKVRAVAMSA-TDGLTREMKVVDTGAP
ATPB_PSINU       NSLIVKGQNPAG------QQINVTCEVQQLLGNNKVRAIAMSA-TDGLTRGMEVIDTGAP
ATPB_STAPU       NAIIVKGQNPAG------QEINVTCEVQQLLGDNRVRAVAMSA-TDGLTRGMEVFDTGAP
ATPB_ZYGCR       NALIIKGQNPAG------QEINITCEVQQLLGDNKVRAVAMSA-TDGLMRGMEVTDTGAP
ATPB_CHAVU       NCLTVKGKNASG------DFIDVTCEVQQLLGDNKVRAVAMSA-TDGLMRGMEVIDTGSP
ATPB_PINKO       NSLKVQGQGTAG------QEIQVTCEVQQLLGNHKVRAVAMSA-TDGLTRGMTVIDTGAP
ATPB_MESVI       NALIVKAKNEAG------EDLSVTCEVQQLLGDNQVRAVAMSA-TDGLMRGLEILDTGAP
ATPB_CHLRE       NALTIRAKNSAG------TEMAVTCEVQQLLGDNCVRAVSMNP-TEGLMRGMEVVDTGKP
ATPB_TETOB       NALTIKAKNAAG------LEMSVTCEVQQLLGDSCVRAVAMNP-TDGLMRGMEVLDTGKP
ATPB_TUPAK       NALVIKGTNQAG------QEVAVTCEVQQLLGDHCVRAVAMNA-TDGLMRGMNIVDTGKP
ATPB_CHLVU       NALTVGGKNEAG------QEISVTCEVQQLLGDHCVRAVAMSA-TDGLMRGMEVLDSGKP
ATPB_OLTVI       NAIVVEGENLAG------TKVSVTCEVQQLLGDHCVRAVSMSA-TDGLMRGMDVVDTGAP
ATPB_NEPOL       NALIVKGRNGAG------QEVSVVCEVQQLLGDGLVRAVSMSA-TDGLMRGMEVTDTGRA
ATPB_OSTTA       NSVVIEGKNDVG------DTIKCVAEVQQLLGDNVVRAVSMSA-TDGLMRGMTVVDTGAA
ATPB_EUGGR       NSLLIEGKTESG------DRLKVVCEVQQLLGDNVVRAIAMSA-TDGLQRGIKVIDTGAP
ATPB_PROWI       HALSIIDKNSEG------LDIFIVCEVQQLLGDHCVRAISMNA-TDGLKRGMTVFDTGDV
ATPB_CYAPA       NAITVKGKNEAG------QDITVTCEVQQLLGDNQVRAVSMST-TDGILRGMEVTDSGAA
ATPB_GUITH       NAIIIG-----S------GENAVTCEVQQLLGNNKVRAVSMTS-TDGLKRGMEVTDTQAP
ATPB_TRICV       SALKIE----TE------DGIGTVVEVQQLLGDNKVRAVSMRS-TDGLKRGVEARDLGGP
ATPB_PYRYE       NALKVQ-----S------SEGTITCEVQQLLGDNKVRAVSMSS-TEGLQRGVEVIDTGSP
ATPB_GRATL       NALKVK-----G------PENIITCEVQQLLGDNRVRAVAMSS-TEGLKRGIEVTDTGAP
ATPB_CYAM1       NAIVVR-----D------GEKSVTCEVQQLLGDNRVRAIAMSS-TDGLRRGIQAEDTGAP
ATPB_GALSU       NAISIK-----H------KNKTITCEVQQLLGDNRVRTVAMNS-TEGLQRGIEAIDTGSA
ATPB_EMIHU       SAIVVG-----E------GESSVTCEVQQLLGSNKVRAVSMTS-TDGLKRGAAVVNTGAP
ATPB_OCHNE       NAIVID-----A------GDKKVTCEVQQLLGNNKVRAVSMTS-TDGLKRGASVLDTGSP
ATPB_PYLLI       NALEVQ----SK------EGP-IICEVQQLLGDNRVRAIAMSA-TDGLQRGVTVIDTQAP
ATPB_DICDH       NALEVK----SK------DGTTIICEVQQLFNDNRVRAIAMSA-TDGLQRGVEVIDTQAP
ATPB_CYACA       NAIKIN----NS------NNNWITCEVQQLLGDNKVRAVAMST-TEGLKRGASAIDTGEP
ATPB_TRIV2       NALTIKGTNEAG------QELNLTVEVQQLLGDNQIRAVAMSS-TDGLVRGLEVVDTGAP
ATPB_SYNP1       NALRIQGKNAAG------LDVAVTCEVQQLLGDNRVRAVAMSS-TDGLVRGMEAVDTGAP
ATPB_PRODI       NALRVEGKNAAG------QDVAVTCEVQQLLGDNQVRAVSMSS-TDGLVRGMEITDTGAP
ATPB_SYNY3       NALKVQGRNSAG------NEVAVTCEVQQLLGDNQVRAVAMSS-TDGLVRGMDVVDTGAP
ATPB_PROMM       NALRIEGKNPSG------QDVAITAEVQQLLGDHRVRAVSMSS-TDGLVRGMEALDTGAA
ATPB_SYNS9       NALRVEAKNTSG------QDVALTAEVQQLLGDHRVRAVAMSG-TDGLVRGMEAVDTGAP
ATPB_PROMP       NALRIEAKNPAG------QDIALTAEVQQLLGDHRVRAVAMSG-TDGLVRGMEATDTGAP
ATPB_SYNE7       NALVIKGKNEAG------QDLSVTCEVQQLLGDRKVRAVSMST-TDGLVRGLEVIDTGAP
ATPB_SYNJA       NALKVEATTESG------LKVKVTFEVQQLLGDNRVRAVAMSS-TDGLVRGMPVVDTGAP
ATPB_GLOVI       NALLIEGKTDSG------LDIRLTCEVQQLLGDKKVRAVSMST-TDGMVRGMKAIDTGAP
ATPB_LEPIC       NALEIE-TNVSG------KKETIIAEVQTHIGGKAVRAIALSS-TDGLIRGQEVSNTGKP
ATPB_FUSNN       NALKVK----LE------DKE-LVLEVEQHLGNNVVRTVAMDS-TDGLKRGMEVIDTGKP
ATPB_PROMO       NALKID----RG------NGEYLVAEVQQHLGNSVVRAVAMDA-TDGLQRGMEVVDTGPA
ATPB1_RHOFT      DALKLE-------------GSALTLEVQQQLGDGIVRTIALGS-SDGLRRGLMVSNTANP
ATPB2_PARXL      DALILE-------------GSELTLEVQQQLGDGVVRTICLGA-SDGLRRGTTVKNTGKP
ATPB1_NITMU      DALVLE-------------GSELTLEVQQQLGDGVVRTIALGS-SEGLRRGMMVTNTGDQ
ATPB_NITEU       DALVME-------------GSELTLEVQQQLGDGVVRTIALGS-SDGLRRGMMVTNTQKQ
ATPB_CUPPJ       DALVLEDSSETS-----FAEKGLTFEVQQQLGDGVVRTIALGS-SDGLRRGMAVKNTEAP
ATPB_BORA1       EALTLADEG-SS-----FAEQGLTFEVQQQLGDGVVRTIALGS-SDGLRRGMPVSRTGAP
ATPB_AROAE       DALKLE-NAAGS-----FAEEGLTFEVQQQLGDGVVRTIAMGS-SDGLRRGMKVASTGKG
ATPB_DECAR       DALKLDASEANG-----MAEDGLTFEVQQQLGDGVVRTIAMGS-SDGLRRGMKVNNTGAG
ATPB_METFK       DALILD--EDSP-----TVEAGLTLEVQQQLGDGVVRTIAMGS-SDGLSRGMKVKNTGSQ
ATPB_NEIMA       DALKLD-------------ENGLTLEVQQLLGDGVVRTIAMGS-SDGLKRGMTVSNTGAP
ATPB_CHRVO       DALKLV-------------DADLTLEVQQQLGDGVVRTIAMGS-SDGLKRGMAVANTGAP
ATPB_PSYCK       DALLVD-------------GTETTLEVQQQLGDGIVRTIAMGS-TEGLKRNLPVTNTGGP
ATPB_ACIAD       DALQVD-------------GTETTLEVQQQLGDGVVRTIAMGS-TEGLKRGLNVTSTNAP
ATPB_XANC5       DALKVE-------------GTAITLEVQQQLGDGVVRTIALGS-TDGLKRNLVATNTERA
ATPB_XYLFT       NALKID-------------GTAIILEVQQQLGDGIVRTIALGS-TDGLKRNLIATDTGHA
ATPB_ALCBS       DALSV-------------DGTETTLEVQQQLGDGVVRTIAMGS-TEGLKRGLGVTDNGEP
ATPB_HAHCH       DALKV-------------EGGATTLEVQQQLGDGIVRTIAMGS-TEGLRRGLQVENTNAP
ATPB_SACD2       DALTV-------------ADKGLTLEVQQQLGDGVVRAIAMGG-SEGVSRGLAVENTGAP
ATPB_CHRSD       DALKV-------------SDTETILEVQQQLGDGVVRAIAMGT-TEGLKRGLDVVNSGSA
ATPB_PSESM       NALEVK------------SAAGTTLEVQQQLGDGVVRTIAMGS-TEGLKRGLEVTDSGAA
ATPB_PSEHT       DALRVT-----D-----GDLTGLTLEVQQQLGGGVVRTIAMGT-TDGLRRGASVMNTGES
ATPB_COLP3       DALKIT-----E-----GDLEGLVLEVQQQLGGGVVRTIAMGT-SDGLRRGLNVVNTGQG
ATPB_IDILO       DALKVT-----E-----GGLEGLVLEVQQQLGGGIVRAIAMGT-TDGLRRGITAKNTGES
ATPB_SHEON       DALKITG----E-----GSCNGLVLEVQQQLGGGVVRTIAMGT-SDGLRRGLEVVNSGSP
ATPB_PASMU       DALNV--------------ETGLVLEVQQQLGGGVVRCIAMGS-SDGLKRGLSVTNTNNP
ATPB_MANSM       DALKVA-------------EGGLTLEVQQQLGGGIVRCIAMGS-SDGLKRGLSVSNTGKP
ATPB_ECOLI       DALEVQ-----------NGNERLVLEVQQQLGGGIVRTIAMGS-SDGLRRGLDVKDLEHP
ATPB_METCA       DALRVD-------------EVGLVLEVQQQLGDGVVRCIAMGS-TDGVRRGVTVTNTGAP
ATPB_NITOC       HALRID-------------DVGLTLEVQQQLGDGVVRTIAMGG-SDGLRRGMAVTNTGAP
ATPB_LEGPH       DALKLV-------------DSDLVFEVQQQLGDGVVRTIAMGT-TDGLKRGLKAENTGHP
ATPB_COXBU       DALQVD-------------ENNLTLEVQQQLGDGVVRTIAMGS-TEGLKRDIAVKNTEKP
ATPB_FRATT       DALNVV-------------EAGLVLEVQQQIGDGVVRTIAMGS-SDGLRRGMEVKNTNAP
ATPB_THIDA       EALKMQ-------------APELTFEVQQQLGDGVVRTIAMGS-TDGLRRGMDVLSTGNP
ATPB_ACIFR       EAIVVD-------------ANNLTIEVQAQLGDGVARGIAMGP-SEGLKRGLAVTRTGAP
ATPB_HYDCU       DALKVD-------------ELDLTLEVQQQVGDNVVRAIAMGS-SDGLKRGMAVSNTGEA
ATPB_VIBCH       DALNVVD----------SKE-RLVLEVQQQLGGGVIRAIVMGS-SDGLRRGMTVQNTGAP
ATPB_ALIF1       DALNVVD----------AQE-RLVLEVQQQIGGGVVRCIVMGS-SDGLRRGLTVENTGAP
ATPB1_PHOPR      DALKVDA----------KEKGTLVLEVQQQLGGGVVRCIAMGT-SDGLRRGLSVENTDRP
ATPB2_PHOPR      DALNIID----------GNNSSLVLEVQQQIGSGIVRCIAMGS-SDGMRRGLVAVNTGEP
ATPB_BUCAI       NALEVK-----------NKQYKLILEVQQQLGSGVVRTIAMGS-SNGLKRGLIVTDLGHY
ATPB_BUCAP       NALEVK-----------NKKIQLILEVQQQLGAGIVRTIAMGS-TNGLKRGLIVIDLGHY
ATPB_BUCBP       NALKVD-----------NQGSILILEVQQQLGSGIVRTIAMGS-SNGLKRGLLVVDLEHG
ATPB_BAUCH       NALEVT-----------NGKNKLILEVEQQLGSGIVRCIAMGV-SEGLRRGLTVIDLGHA
ATPB_BLOFL       HALEVNIDN--G-----NSHQVLILEVVQQLGRSIVRCIAMGS-TNGLKRGLDVTNLKHG
ATPB_BLOPB       HALEVHIDS--F-----N--KKLILEVAQQLGGGIVRCIAMGN-TDGLRRGLVVINLKHS
ATPB_WIGBR       FALEIK-----------IKNKKLIMEVMQQIGDGIVRCILMGS-SDGLKRGLKVFNLNKG
ATPB_HERAU       NALEIPL--GQG-----RPS--LICEVQQQLGDSVVRAVAMST-TDGLVRGMDVINTGAP
ATPB_RHOBA       NALTIQS--EHK-----GVTIDLTGEVQQHLGGGRVRAIALGS-TEGMMRGMNVVDTGKP
ATPB_DEHMC       NALEIPR--ENG-----K----MVLEVQSHVGNNRVKCLSFTP-TDGLERGAEVIDTTRP
ATPB_ACEWD       NAVNIELNGH-----------TLVIEVAQQLGDDIVRCIAMDS-TDGLMRNQEAVDTGSA
ATPB_SYMTH       HALVIRNGGERGDI-------NLTLEVAQHLGNNQVRCIAMDS-TDGLRRGETVYDTQAP
ATPB_CALS4       NAIKI--PMGDRE---------LVVEVAQHIGDNTVRCVAMAS-TDGLRRGMECIDTGGP
ATPB_PARUW       NAIKIIDPKDQRE---------LIAEVAMHLGDNQVRCIALSS-TDGLVREAQAVDTEAP
ATPB_PECFR       NAITIKGKSGDIDI-------NLTVEVMQHLGDGITRCIAMSS-TDGLTRGMEAVDTGSP
ATPB_CARHZ       NALKIRSEDQDTPTE---VPINLTLEVAQHLGNNRVRAVAMSS-TDGLVRGMKVVDTGAP
ATPB_MOOTA       NAITIKTDK-----------INITMEAMQHLGNNTVRCVALSS-TDGLQRGMKAVDTGQP
ATPB_DESHY       SAVKVTVPEQK---------IDLTLEVAQHLGNNTVRCVAMSS-TDGLQRGMAALNTGAP
ATPB_CLOAB       NSIEIDMG----------DNKKLIAEVEQHVGDDIVRTIAMEG-TDGLKRGMEAVNTGKP
ATPB_CLOPE       NAIHIKMD----------DGKILVCEVEQHVGDDIVRTIAMEA-TEGLRRGVEAVDTGAP
ATPB_BACTN       DALEIKRP----------NGKILVVEVQQHIGENTVRTVAMDS-TDGLQRGMKVYPTGGP
ATPB_CELLY       DSLEIKKA----------DGSILVLEVQSHIGENTVRTISMDS-SDGLSRGAEVNATGSA
ATPB_SALRD       DALRIERE----------DSRDLILEVQQHLGERRVRAIAMDS-TDGLQRGQAIAATNQP
ATPB_MYCMS       DALIVDNN----------GKK-LVLEVEQNIGDEIVRTIAMGP-TEGLKRGLDVINTNSP
ATPB_MESFL       DALVVDNN----------GVE-LVLEVEQHMGDEVVRTIAMGP-TEGLAKGLPVINTNAP
ATPB_UREPA       TALELNNH----------GSK-LVLEVSQLVGDNIARCIAMDT-TDGLVRGQEVINTQKP
ATPB_MYCGE       DCLSVQLK----------KSE-LFLEATQLIGDDIVRCIALGP-TEGLARNVKVTNYNHP
ATPB_MYCPN       DCLSVKLA----------GEE-LFLEAAQLIGDDIVRCIALGP-TEGLARNEKVTNYNHP
ATPB_MYCGA       DCLIIDEP----------NMK-LHLEVAQLIGDDIARCIAMGP-TEGLARNVKVTSTNQP
ATPB1_MYCPU      NNLELVFE----------NNK-YNFEVAQHIGDEVVRTISMVS-TNGLSRGLEVIDTGAP
ATPB_MYCS5       NALRVELP----------TKEVFTFEVAQHIGDDTVRCISMVS-TNGLRRGLTVEDTGKA
ATPB_MYCMO       NALTIEFE----------KTK-ITLEVAQHIGNDVVRTIAMSS-TEGLVRNLEVIDTEAP
ATPB_MYCHJ       SALEVKIN----------DES-IIFEVAQHLGEGIVRAIAMSM-TYNLSKGLEVYDTGSQ
ATPB_STAHJ       NALIIEVPKEDG-------TFELTLEVALQLGDDVVRTIAMDS-TDGVQRGMEVQNTGKD
ATPB_STAS1       NALVVDVERDEG-------TVSLTLEVALQLGDDVVRTIAMDS-TDGVKRGTEVRDSGDS
ATPB2_LISIN      NALVIEYKSDAE----EAPTSQLTLEVAIQLGDDVVRTIAMAS-TDGVQRGMEVIDTGSP
ATPB_GEOSE       NALKIQHQARNE----NEVDIDLTLEVALHLGDDTVRTIAMAS-TDGLIRGMEVIDTGAP
ATPB_BACSU       NAIKISQPAASE----NEVGIDLTLEVALHLGDDTVRTIAMAS-TDGVQRGMEAVDTGAP
ATPB_BACMQ       NALKISHKPSSA----SEVAIELTLEVAIHLGDNTVRTVAMSS-TDGLVRGLEVEDTGAA
ATPB_BACCR       NALTVKQSNENG----S---MNLTFEVALHLGDDTVRTVAMSS-TDGLVRGTEVEDTGKA
ATPB_BACHD       NALRVEQKGADQ----NAVDVNVTLEVALHLGDDTVRTIAMGS-TDGLVRGTEVVDTGAA
ATPB_BACSK       NALTVNQQGAAD----GAVDVKVTLEVALHLGNDTVRTVAMGS-TDGLMRGTEVLDTGGP
ATPB_OCEIH       NALVVRSDSGEE----------LTLEVALHLGDNSVRTIAMSS-TDGFKRGAEVENLGRP
ATPB_STRMU       NALVVYKD--------GDKSQRIVLEVALELGDGLVRTIAMES-TDGLTRGLEVFDTGRA
ATPB_STRR6       NALVVYKN--------DERKTKIVLEVALELGDGMVRTIAMES-TDGLTRGMEVLDTGRP
ATPB_ENTHA       NALVVYKN--------DEKKSKVVLETALELGDGVIRTIAMES-TDGLQRGMEVIDTGKA
ATPB_LACLA       NALIVYKD----V---NGLKTKITLEVALELGDGAVRTIAMES-TDGLTRGLEVLDTGKA
ATPB_LACAC       NALRVIKS----------EDESIVLEVTLELGDGVLRTIAMES-TDGLRRGMKVEDTGAP
ATPB_LACDA       NALKVIKS----------DDDSIILEVILEQGDGVLRCIAMES-TDGLRRGMKVEDTGSS
ATPB_LACJO       NALRVTNN----------NGDTLVLEVTLELGDGVLRTISMES-TDGLRRGMEVEDTGAP
ATPB_LACCA       NALTITRK----------DGSQLVLEVALELGDGVMRTIAMDS-TDGLQRGMAVEDTGGP
ATPB_LACSS       NALTVDKG----------NDETVVLEVALELGDGVMRTISMES-TDGLRRGMPVEDAGRA
ATPB_LACPL       NALIIQKD----------NDDTLTVEVSLELGDGVVRTVAMDG-TDGLRRGMTVEDTGSS
ATPB_LACS1       DALKVKRE----------DGTELVIEVALELGDGIMRTVAMDS-TDGLKRGAEVEGTGAS
ATPB_RUBXD       NALTCKIETEEG-------EHTLTLEVQQLLGDDMVRTVAMSS-TDGLRRGVEVQDTGRP
ATPB2_PELCD      SLLLAGA------------QDEIVVEVMLHLDGGHVRGNALTP-TQGLACGDTIKDSGAP
ATPB2_MYCPU      NILSLQ-------------DGKCFLMVERILSNTLVRAILIKIGEEQIKINDIAIDTKES
                                                .    :   :      .            

ATPB_TROWT       ITVPVGDATKGRVFNVVGEVLNSN-GEDIKFD---EYWSIHRKPPEFSLLESKTQLFETG
ATPB_LEIXX       ITVPVGDVTKGKVFDVTGEILNAEPGEKIEIA---ERWPIHRQPPSFDHLESKTQLFETG
ATPB_BIFLO       ISVPVGDVTKGHVFDVSGNILNKKPDETITVS---ERWPIHRNPPAFDQLESKTQMFETG
ATPB_CUTAK       ISVPVGDVTKGHVWNVTGDVLNAD-PSTIEVT---ERWPIHRDPPAFDDLEPETEMLETG
ATPB_THEFY       IRVPVGDGVKGHVFNALGEPQDIP-KSELQVK---EYWPIHRPAPAFDQLEAKTEMLVTG
ATPB_STRAW       ITVPVGDFTKGKVFNTLGEVLNVD---EKYDG---ERWSIHRKAPRFDELESKTEMFETG
ATPB_FRACC       ISVPVGDATKGHVFNVLGTPLDVK---QIEAE---TYWPIHRSAPAFDQLESKTEMFTTG
ATPB_CORJK       ISVPVGDVVKGHVFNALGDCLDEPGLGRDG-----EQWGIHREPPAFDQLEGKTEILETG
ATPB_CORGL       ISVPVGDVVKGHVFNALGDCLDDVSLNNNPEI---ERWGIHREPPSFDQLEGKTEILETG
ATPB_RHOJR       ISVPVGDVVKGHVFNALGDCLDAPGTGRDG-----EQWGIHRKPPAFDQLEGKTEILETG
ATPB_MYCLE       ISVPVGEGVKGHVFNALGYCLDEPGYGDEF-----EHWSIHRKPPSFEELEPRTEMLETG
ATPB_FERIS       IKAPVGRGVLGRMFNVIGEPIDEQGEL--KD---IEYWPIHRPAPSMTEQKTEIEILETG
ATPB_THEMA       ITAPVGKEVLGRILNVIGEPVDEAGEI--KA---KERWPIHRPAPELVEQSTEIEILETG
ATPB_AQUPY       IKIPVGKEVLGRIFNVAGQPIDEQGPV--EA---KEYWPMFRNPPELVEQSTKVEILETG
ATPB_NITWN       IRVPVGAGTLGRIMNVIGEPVDEQGPV--KA---DDLRPIHAEAPSYTDQSTEAEILVTG
ATPB_BRADU       IRVPVGEGTLGRIINVIGEPIDEAGPV--KS---EGLRAIHQEAPTYTDQSTEAEILVTG
ATPB_RHILO       ITVPVGPGMLGRIINVIGEPVDEEGPV--DA---IEMRSIHQPAPTYVEQSTEAQILITG
ATPB_AGRFC       IEVPVGLETLGRIMNVIGEPVDEAGPI--VT---AKKRAIHQDAPSYVEQSTEGQILVTG
ATPB_MAGSA       IQMPVGPETLGRIINVIGEPIDERGPI--GN---KTTLPIHADAPEFVDQSTETEILVTG
ATPB_PELUB       IQVPVGPETLGRIINVIGEPIDEKGEV--KT---KEKWPIHRAAPEFSDQSTETEILVTG
ATPB_RHORT       ITVPVGPQVLGRIMNVIGEPVDERGPV--VT---AQRYPIHRQAPTFAEQATETEILVTG
ATPB_RUEPO       ISVPVGAATLGRILNVIGEPVDEKGPV--NA---TETRAIHQPAPSFDEQSTSSDILVTG
ATPB_RUEST       ISIPVGNATLGRILNVVGEPVDEGEPI--VA---KETRAIHQPAPEFNDQSTESEVLVTG
ATPB_ROSDO       ISIPVGNATLGRIMNVVGEPIDEKGPV--AT---DETRSIHQEAPAFAEQSTSSEVLETG
ATPB_JANSC       ITVPVGPGTLGRILNVVGEPVDEGGPV--DA---EERRGIHQDAPEFADQSTEAEVLVTG
ATPB_RHOCA       ITVPVGNATLGRILNVIGEPVDERGDV--SK---AEARAIHQPAPDFAAQSTESQILVTG
ATPB1_RHOS4      ISVPVGDATLGRILNVIGEPIDEKGDL--GE---ASTRAIHQPAPTFAEQSTTSEILVTG
ATPB_RHOBL       ISVPVGNATLGRILNVVGEPIDERGPI--AA---TEKRAIHQKAPDFQSQSTESQILVTG
ATPB_NOVAD       ISVPVGPKTLGRIMNVIGEPIDERGPV--GA---EQTAPIHAKAPEFIEQSTEAAILVTG
ATPB_ZYMMO       IRVPVGPETLGRIMNVVGRPVDERGPI--GS---KQTMPIHADAPPFTEQSTDTAILTTG
ATPB1_GLUOX      IMVPVGPATLGRILNVVGEPIDERGPI--SS---ELRFPIHRPAPSFEEQAAASEILVTG
ATPB_RICTY       IHIPVGIATLGRIMNVVGEPIDGKGEI--KS---STISSIYKPAPDFINQSTERDILVTG
ATPB_RICBR       ISIPVGIETLGRIMNVVGEPIDGKGKI--KG---SSISSIYKSAPSFTQQSTDRNILVTG
ATPB_ANAMM       MMAPVGRGTLGRVFDVLGRPIDGLGSV-SSD---VEFRPIHAKAPSLSEQRVAAEVLVTG
ATPB_ANAPZ       ISVPVGRKTLGRVFDVLGEPIDGVGDV-GAD---VEYHSIHAHAPKLSEQKVATEVLVTG
ATPB_EHRCJ       ISVPVGRGTLGRVFDVLGNTIDDCGPLEESK---YIIKPIYSEIPKLTDQKIATEILVTG
ATPB_EHRCR       ISVPVGRGTLGRVFDVLGNTIDECGPLEESS---YFIKQIYSEIPKLTDQKIATEILVTG
ATPB_EHRRW       ISVPVGRATLGRVFDVLGNPIDNCGPLTKSD---YSIKPIYSEVPKLTDQKVTTEILVTG
ATPB_WOLTR       ISVPVGRSTLGRIFNVVGEVIDECGPL-KGK---YDLESIHRVPPSFTEQKIQEEVLVTG
ATPB_NEOSM       ICVPVGRQTLGRIFNVVGEIIDGGGPVPEPN---K-VSSIYAEPPRFDMQSTSSEILETG
ATPB_CAMJR       ISVPVGEKVLGRIFNVTGDLIDEGEEI--SF---DKKWAIHRDPPAFEDQSTKSEIFETG
ATPB_SULDN       IKVPVGEKVLGRIFNVIGETIDDGEQV--TD---APMWSIHRQPPALVEQSTTTEMFETG
ATPB_HELHP       IEVPVGEAVLGRIFNVTGDVIDGGKPL--ES---DLKWPIHREAPSFENQSTRTEMFETG
ATPB_WOLSU       IEVPVGEQVLGRIFNVVGDVIDGGDEL--KE---PVKWSIHRTAPTFENQSTKTEMFETG
ATPB_HELPJ       IEVPVGEEVLGRIFNVVGESIDNLEPL--KP---SLTWPIHRKAPSFEQQSTKTEMFETG
ATPB_DESPS       ITIPVGEGALGRIMNVVGRPVDGLGPI--PA---KTSMSIHRDAPLFTEQDTEVRVLETG
ATPB_SYNAS       ITVPVGKECLGRILNVVGKPVDGLGPI--EA---KNTMPIHREAPSFLEQDTSVHVLETG
ATPB_DESAG       IMVPVGSASLGRIMNVVGRPVDEMGDI--DA---AKSLPIHRPAPEFNEQNTNVELLETG
ATPB_DESVH       IMVPVGKASLGRIMNVVGRPVDELGPI--NA---DKSLPIHRAAPEFTEQNTKVELLETG
ATPB_LAWIP       IMAPVGKASLGRIMNVVGQPIDGLGVI--DT---KTYLPIHRKPPSFLDQNTSVEPLETG
ATPB_MYXXD       IQVPVGKATLGRILNVTGEPVDEMGPV--KA---QEYWSIHRAPPPFTEQDVRVQMFETG
ATPB_STIAU       IQVPVGQGTLGRILNVIGEPVDERGPI--TS---SQTWPIHRPAPTFVDQDVRVQAFETG
ATPB_ANADE       ISVPVGQEVLGRILNVVGEPVDERGPV--AA---TKTLPIHRSAPLLTDLNVKVESFETG
ATPB_GEOSL       ISVPVGRKTLGRILNVIGEPVDEMGPV--NA---EKEYGIHREAPAFVDQSTKVEAFTTG
ATPB_BDEBA       ITAPVGREALGRIINVVGEPIDEMGPV--NA---KEQWGIHRTAPKFEDQATAAAMLMTG
ATPB_CHLP8       IQAPVGAEVLGRMLNVVGEPIDGKGPV--PS---KKSYPIHRSAPKFDELSTKAEMFETG
ATPB_KORVE       ISVPVGRGTLGRVMNVIGEPVDQLGPI--MV---EKRNPIHRQAPAFDEQATTAEMFETG
ATPB_OENEH       LSVPVGGATLGRIFNVLGEPVDELGPVDT-----RTTSPIHRSAPAFIQLDTKLSIFETG
ATPB_ORYSA       LSVPVGGATLGRIFNVLGEPVDNLGPVDT-----SATFPIHRSAPAFIELDTKLSIFETG
ATPB_PEA         LSVPVGGATLGRIFNVLGEPIDNLGPVDT-----RTTSPIHRSAPAFIQLDTQLSIFETG
ATPB_CUSRE       ITVPVGGSTLGRIFNVLGEPVDNLGPVDT-----NTTFTIHRSAPAFIQLDTKLSIFETG
ATPB_CUSPE       ISVPVGGSTLGRIFNVLGEPVDQLGPVET-----NQLSPIHRSAPPFLKLDTRLSIFETG
ATPB_PTEAQ       LSVPVGETTLGRISNVLGEPVDNLGPVQS-----STTFPIHRSAPAFIQLDTKLSIFETG
ATPB_HUPLU       LSVPVGEATLGRIFNVLGEPVDNLGSVDA-----GTTSPIHRSAPAFAQSDTKLSIFETG
ATPB_PSINU       LSVPVGQATLGRIFNVLGEPVDNLGPINA-----DKKSSIHEPAPAFTQLDTKLSIFETG
ATPB_STAPU       LSVPVGEVTLGRIFNVLGEPVDELGPVNA-----TITSVIHRSAPAFTQLDTKLSIFETG
ATPB_ZYGCR       LSVPVGESTLGRIFNVLGEPIDNLGPVDA-----ATTLPIHRSAPAFTQLDTKLSIFETG
ATPB_CHAVU       LSVPVGETTLGRIFNVLGEPVDNLGPVDT-----SITFPIHRAAPAFTQLDTKLSIFETG
ATPB_PINKO       LSVPVGGATLGRIFNVLGEPVDNLGPVDA-----RITSPIHRTAPAFTELDTKLSIFETG
ATPB_MESVI       LSVPVGEITLGRIFNVLGEPVDGLGDVVA-----KTKSPIHRNSPTFIELDTKLSIFETG
ATPB_CHLRE       LSVPVGKVTLGRIFNVLGEPVDNMGNVKV-----EETLPIHRTAPAFVDLDTRLSIFETG
ATPB_TETOB       LNVPVGKSTLGRIFNVLGEPVDNLGPVKN-----EESLPIHRTAPAFVDLDTRLSIFETG
ATPB_TUPAK       LTVPVGKVTLGRIFNVLGEPVDGLEAVDS-----KESLPIHRKAPAFVDLDTKLAIFETG
ATPB_CHLVU       LNVPVGAATLGRIFNVLGEPVDNLGPVNT-----KDQLPIHRSAPAFVDLDTKLSIFESG
ATPB_OLTVI       LTVPVGTSTLGRIFNVLGEPVDNLGDVSN-----EGGLPIHRPAPLFVDLDTQLSIFKTG
ATPB_NEPOL       LSVPVGPTTLGRIFNVLGEPVDNMGPVGN-----EKTLPIHREAPAFVDLDTKLSIFETG
ATPB_OSTTA       LSVPVGKNTLGRIFNVLGEPVDELGAVST--P--EGMLPIHRAAPAFVDLDTNLSIFETG
ATPB_EUGGR       LSVPVGVTTLGRIFNVLGESVDKMGLIDY-----SITLPIHRAAPSFVELDTQLSIFETG
ATPB_PROWI       LKVPVGRSTLGRIFNVLGETIDNLGPADT-----SNQLPIHRSAPKFIDLDTKLSIFETG
ATPB_CYAPA       ISVPVGTPTLGRIFNVLGEPVDELGAVVC-----DSTLPIHRPSPAFTQLETKSSIFETG
ATPB_GUITH       ISVPVGKATLGRIFNVLGQPVDNMGDVAL-----DQTLPIHRGSPAFTQLETKPSIFETG
ATPB_TRICV       ISVPVGISTLGRIFNVIGEPVDEQGDVSY-----DETLPIHREAPAFTELETKPSIFETG
ATPB_PYRYE       ISVPVGTDTLGRIFNVLGEPVDNLGPVDS-----ESTLPIHRPAPAFTKLETKPNIFETG
ATPB_GRATL       ITVPVGIPTLGRIFNVLGEPVDNLGDIQS-----EDSLPIHRAAPSFTQLETKPSIFETG
ATPB_CYAM1       ISVPVGKVTLGRIFNVLGDCVDNLGTVTR-----QAVQPIHKQAPSFVQLETKPSVFETG
ATPB_GALSU       ITVPVGKCTLGRIFNVLGEPVDELGAIST-----DRKLPIHRASPLFTQLETKPSIFETG
ATPB_EMIHU       ITVPVGVPTLGRIFNVLGEPVDEMGPCEA-----TAGLPIHRAAPAFTDLDTKPSVFETG
ATPB_OCHNE       ITVPVGVPTLGRIFNVLGEPVDELGPCNA-----ESGLPIHRPAPSFTELETKPSVFETG
ATPB_PYLLI       IAVPVGKATLGRIFNVLGQPVDNLSDSVG-----EDTLPIHRSAPAFTDLETKPAIFETG
ATPB_DICDH       ILVPVGKATLGRIFNVLGQTVDNIEIGTG-----EDRLPIHRPAPSFTDLETKPAIFETG
ATPB_CYACA       ISIPVGKETLGRIFNVLGEPIDEKGPVIS-----NDKLPIHRPAPKFTQLETKPSIFETG
ATPB_TRIV2       ISVPVGKATLGRIFNVLGEPVDNRGPVNN-----QETLPIHRPAPKLTELETKPSVFETG
ATPB_SYNP1       ISVPVGTATLGRIFNVLGEPVDEKGEVNI-----SETLPIHRPAPSFTELETKPSVFETG
ATPB_PRODI       INVPVGKATLGRIFNILGEPVDNQGPVYT-----AETSPIHRAAPKFTDLDTKPTVFETG
ATPB_SYNY3       ISVPVGTGTLGRIFNVLGEPVDNKGPVPA-----GETFPIHRPAPKLVDLETKPQVFETG
ATPB_PROMM       ISVPVGEATLGRIFNVLGEPVDEQGPVTT-----DATAPIHRPSPKLTELETKPTVFETG
ATPB_SYNS9       ISVPVGEATLGRIFNVLGEPVDEQGPVKT-----KTTAPIHREAPKLTELETKPKVFETG
ATPB_PROMP       ISVPVGEATLGRIFNVLGEPVDEQGPVNT-----SDIAPIHRSAPKLTDLETKPKVFETG
ATPB_SYNE7       ISVPVGEATLGRIFNVLGEPVDELGPVNA-----ATTSPIHRDAPKLTDLETKPKVFETG
ATPB_SYNJA       ITVPVGEATLGRIFNVLGEPVDQGEPVQA-----KEFAPIHRSAPPFVELTVKPEPFETG
ATPB_GLOVI       ITVPVGKSTLGRIFNVLGEPIDELGPVEI-----VDKFSIHRSAPKFTDLVTQPEIFETG
ATPB_LEPIC       ISVPVGDATLGRIFNVLGKTIDE-GPAIT--V--KETRPIHRAAPSFDELTSKTEVFETG
ATPB_FUSNN       ITIPVGKAVLGRILNVLGEPVDNQGPLNA-----ETFLPIHREAPEFDDLETETEIFETG
ATPB_PROMO       ITVPVGKAVLGRILNVLGEPVDEAGEVKA-----EEYAPIHREAPAFEDQGTEKEVFETG
ATPB1_RHOFT      IMVPVGTATLGRIMDVLGTPIDERGPVSTE-----KYASIHRKAPTYDELSPSQELLETG
ATPB2_PARXL      ISVPVGKPTLGRIMDVLGRPIDEAGPINSD-----VVRGIHQKAPAFDELSPSTELLETG
ATPB1_NITMU      IRVPVGTKTLGRIMDVLGTPIDEMGPIGAE-----QNRSIHQKAPAFDELSASTELLETG
ATPB_NITEU       ISVPVGTKTLGRIMDVLGRPIDEMGEIGAN-----SLMPIHRAAPAFDELSASTELLETG
ATPB_CUPPJ       ISVPVGQGTLGRIMDVLGRPIDEAGPIASD-----ERRAIHQKAPKFDELSPSTDLLETG
ATPB_BORA1       ISVPVGHGTLGRIMDVLGRPIDEAGPINAD-----EKRAIHQHAPKFDELSPSVELLETG
ATPB_AROAE       ISIPVGHGTLGRIMDVLGRPIDEAGPIEAD-----ELRPIHAKAPKFDELSPSVDLLETG
ATPB_DECAR       ISVPVGMGTLGRIMDVLGRPIDEAGPIDST-----ELRVIHQPAPKFDELSSSVDLLETG
ATPB_METFK       IQVPVGHGTLGRIMDVLGRPIDEAGPIEAD-----EKRSIHQKAPTFEELSPSVDLLETG
ATPB_NEIMA       ITVPVGKGTLGRIVDVLGTPVDEAGPIDTD-----KSRAIHQAAPKFDELSSTTELLETG
ATPB_CHRVO       ISVPVGAATLGRIMDVLGNPVDEAGPVATD-----ARRAIHQAAPKFDELSAAADILETG
ATPB_PSYCK       ISVPVGIGTLGRIMDVLGRPIDEEGPVQAD-----ERWSIHREAPSYAEQSNSTELLETG
ATPB_ACIAD       ISVPVGPATLGRIMDVLGRPIDEAGPVATE-----ERLPIHRQAPSYAEQAASTDLLETG
ATPB_XANC5       ISVPVGAGTLGRIMDVLGRPIDEAGDVQAS-----DHWEIHRSAPSYEDQASTTELLETG
ATPB_XYLFT       ITVPVGTGTLGRIMDVLGNPIDEAGPITYT-----DQWEIHRNAPSYEDQASTTELLETG
ATPB_ALCBS       IQVPVGTKTLGRIMDVLGRPIDEAGPIGEE-----ERMPIHRAAPTYADQAATNELLETG
ATPB_HAHCH       ISVPVGTQTLGRIMDVLGNPIDEKGPIGEE-----ERMPIHRTAPGYADQSSSRDLLETG
ATPB_SACD2       INVPVGTATLGRIMDVLGNPIDEKGPINET-----ERASIHRKAPKYDELAASEELLATG
ATPB_CHRSD       ISVPVGKATLGRIMNVLGEPIDEAGEIGED-----ERMPIHRKAPSYAEQAASNELLETG
ATPB_PSESM       ISVPVGKATLGRIMDVLGNPIDEAGPIATE-----ERWGIHRPAPSFAEQAGGNDLLETG
ATPB_PSEHT       IQVPVGKATLGRIMNVLGEPIDEAGPIGEE-----DRMSIHRAAPTYEEQSSSVELLETG
ATPB_COLP3       IQVPVGVETLGRIMNVLGEPIDEAGPIGEK-----DRWSIHREAPAYAEQSMSNELLETG
ATPB_IDILO       IMVPVGKKTLGRIMDVLGNPIDEAGPIGEE-----EKMSIHRAAPSYEEQSNTNELLETG
ATPB_SHEON       ISVPVGTATLGRIMNVLGDPIDEAGAIGEE-----ERYVIHRAAPSYEEQSNTTELLETG
ATPB_PASMU       ISVPVGTKTLGRIMNVLGEPIDEQGEIGAE-----ENWSIHRAPPSYEEQSNSTELLETG
ATPB_MANSM       ISVPVGTKTLGRIMNVLGEPVDEQGPIGAE-----EEWAIHREAPSYEEQSNSTELLETG
ATPB_ECOLI       IEVPVGKATLGRIMNVLGEPVDMKGEIGEE-----ERWAIHRAAPSYEELSNSQELLETG
ATPB_METCA       ISVPVGTETLGRIMNVLGDPIDEKGPIGEK-----ERWGIHRKAPSYQDQAAANELLETG
ATPB_NITOC       ISVPVGTKTLGRIMDVLGEPVDEAGPVGEE-----ERWSIHRKAPAYEELSPATELLETG
ATPB_LEGPH       IQVPVGKKTLGRIMDVLGRPVDDAGPIDAE-----ETWAIHRKAPSYEEQAGSQELLETG
ATPB_COXBU       IEVPVGKETLGRIMNVLGEPIDELGPINSK-----EKLPIHRPAPSFIEQSGATELLETG
ATPB_FRATT       ISVPVGHGTLGRIMNVLGEPIDEAGPIEYT-----EKRSIHQAPPAYDELALSTEILETG
ATPB_THIDA       IMVPVGQKTLGRIMNVLGDPVDEAGPIGAE-----TTMPIHRKAPAYADQAATVEILETG
ATPB_ACIFR       ISVPVGHATLGRIMNVLGEPVDGKGPVQTE-----DRQAIHRPAPAFDELAASTEVLETG
ATPB_HYDCU       ISVPVGKPTLGRIFDVLGNPIDNAGPVESE-----EKMTIHRPAPAFDELAASQELLETG
ATPB_VIBCH       ISVPVGTKTLGRIMNVLGDAIDERGDIGAE-----EVYSIHRPAPSYEEQSSATELLETG
ATPB_ALIF1       ISVPVGTKTLGRIMNVLGDAIDECGDIDAE-----EHYAIHREAPSYEEQSNSTELLETG
ATPB1_PHOPR      IEVPVGIATLGRIMNVLGEPIDECGEIGEE-----QRYAIHREAPSYEEQSNETSLLETG
ATPB2_PHOPR      ITVPVGEETLGRIMNVLGQPIDECGEIGQK-----TSYPIHREPPSYEDQANSTELLETG
ATPB_BUCAI       IKVPVGEATLGRIINVLGETIDNKGALKNNQSDKIEYWEIHRSPPSYRDQASCREILETG
ATPB_BUCAP       IKVPVGQATLGRIINVLGKTIDNKGPLKNLDNSKLEYWEIHRSAPSYQEQASSQEILETG
ATPB_BUCBP       IKVPVGTATLGRIVNVLGQPIDMKGPLKNHDNSDIEYWEIHRKAPSYSEQLTSYEVLETG
ATPB_BAUCH       IKVPVGKSTLSRIMNVLGEPIDMKGIINAE-----EHWSIHRSAPRYEELALSQEILETG
ATPB_BLOFL       IQVPVGKETLGRVMDVLGNPIDMKGPINSI-----EKWSIHRSAPLYEELSSNQELLITG
ATPB_BLOPB       IEVPVGKETLGRVMNVLGEPIDMKGPIKEK-----EKWSIHRSAPLYSELSTDQDLLVTG
ATPB_WIGBR       IEVPVGKPTLGRIMNVLGDPIDRKGKILSS-----EYRPIHNKSPSYNEISSSDELLETG
ATPB_HERAU       ISVPVGPETLGRVFDVQGRPIDGEGPVGTT-----KTMPIHRPAPTFEEQSNRAELFETG
ATPB_RHOBA       VSVPVGKATLGRVFNVLGQPIDKRGDVQAD-----DYWPIHRQAPPVNELSTNTELFETG
ATPB_DEHMC       LSVPVGRGTLGRIFNVLGEALDNRGDVKSE-----KTMPIHRLAPGMDELESSAQVLETG
ATPB_ACEWD       IQVPVGKATLGRMFNVLGEPIDGKPFDTKDVV----MHPIHRHPPSFEEQQTQPEMFETG
ATPB_SYMTH       ITVPVGEPVLGRIFNVLGETIDGK-GPVNSPV----SLPIHREPPGVANVDPATEMLPTG
ATPB_CALS4       IMVPVGKGVLGRMFNVLGQPIDELGE-VKDVK----YMPIHKKPPSFEEQNPATEILETG
ATPB_PARUW       ISIPVGSPTLGRLLNVLGQPIDEMGA-IENAE----ISPIHKASPTFEEQDTQGVIFETG
ATPB_PECFR       IKVPVGEETLGRVFNVLGQTVDHNPAPVGNKE----FWPIHRPAPKFDEQETSTQILETG
ATPB_CARHZ       ITVPVGRPVLGRLLNVLGEPIDGKGP-VESDH----YYPIHRPAPPLEEQSTRAEILETG
ATPB_MOOTA       ITVPVGRATLGRLFNVLGEPIDNQGP-VETTE----RLPIHRPAPSFEEQQPSTEVLETG
ATPB_DESHY       ITVPVGPATLGRIFNVLGKAIDNGEE-VHTDT----SYPIHRPAPAFVDQDPSTVMLETG
ATPB_CLOAB       ISVPVGENVLGRLFNVLGQTIDEAGDMNADK----Y-YPIHRPAPTFEEQSVQPEMFETG
ATPB_CLOPE       ISVPVGECVLGRIFNVLGKPLDSGAEVNNEE----K-YPIHRPAPSFEEQSVVPQMFETG
ATPB_BACTN       ITMPIGEQIKGRLMNVVGDSIDGMKSLDRTG----A-YSIHRDPPKFEDLTTVQEVLFTG
ATPB_CELLY       IQMPVGDDVYGRLFNVIGDAIDGLGNLPKSGKD--G-LPIHREAPKFEDLSTSTEVLFTG
ATPB_SALRD       ISVPIGEEIRGRLFNVVGQPIDGLPEPDVDE----R-RAIHQDPPEYNELTGSQEVLETG
ATPB_MYCMS       ITAPTGMEVLGRMFNVLGDPIDEKP--DLDVK----REPIHKDAPKYEELVTTTEILETG
ATPB_MESFL       ILAPVGDDVLGRMFNVTGHAIDEKP--EFTGK----RMPIHRDAPAYEELITNAEILETG
ATPB_UREPA       ITMPVGKQVLGRMFNVTGDPIDEQP--APTGK----RMPIHRPAPSFAEQAESIEILETG
ATPB_MYCGE       IEVPVGKNVLGRMFNVLGEPIDGKEPLPKKPK-----LSIHRNPPAFDEQPNTVDIFETG
ATPB_MYCPN       IEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQ-----LPIHRKPPSFDDQSNTLEIFETG
ATPB_MYCGA       ISVPVGTEVLGRMFNVIGEPIDEKKPIDASVK----RMSIHRPAPSFADQSNELEIFETG
ATPB1_MYCPU      IMVPVGKEVLSRMFNVLGQTIDNKGEIEAKEF-----RSIHASAPSYEEQNDSSEILETG
ATPB_MYCS5       IMVPVGKQVLGRMFDVLGNPIDELPLEEGGEK-----SSIHGPIPTYEQQKTTSEILETG
ATPB_MYCMO       ISVPVGKNVLSHMFNVIGENIDNQSIDPNTEK-----WSIHRKAPSYEEQTATSEILETG
ATPB_MYCHJ       ISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIK-----NPIHAKAPTYLEQKATSEILVTG
ATPB_STAHJ       ISVPVGEVTLGRVFNVLGDTIDLEDKLDGSVR----RDPIHRQSPNFDELSTEVEILETG
ATPB_STAS1       ISVPVGDATLGRVFNVLGDTIDLDEKLDTSVK----RDPIHREAPAFDQLSTKVEILETG
ATPB2_LISIN      ITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIK----RNKIHREAPTFDQLATTTEILETG
ATPB_GEOSE       ISRPVGEVTLGRVFNVLGEPIDLEGDIPADAR----RDPIHRPAPKFEELATEVEILETG
ATPB_BACSU       ISVPVGDVTLGRVFNVLGENIDLNEPVPADAK----KDPIHRQAPSFDQLSTEVEILETG
ATPB_BACMQ       ISVPVGDVTLGRVFNVLGEKIDLDAPIDAGAR----RDPIHRQAPKFENLSTQAEILETG
ATPB_BACCR       ISVPVGDATLGRVFNVLGDAIDLDGELPADVH----RDPIHRQAPAFEELSTKVEILETG
ATPB_BACHD       ISVPVGEVTLGRVFNVLGESIDLDEPIPADAE----RSPIHREAPKFEELSTKTEILETG
ATPB_BACSK       ISVPVGEATLGRVFNVLGEEIDLQEPVAEGTR----RDPIHREAPSFEELTTTTEILETG
ATPB_OCEIH       ISVPVGDVTLGRVFNVLGEKIDLDEPLEEGVR----RDPIHREAPDFENLSTETEILETG
ATPB_STRMU       ISVPVGKETLGRVFNVLGDTIDLDKPFAEDAE----RQPIHKKAPSFDDLSTSTEILETG
ATPB_STRR6       ISVPVGKETLGRVFNVLGDTIDLEAPFTEDAE----RQPIHKKAPTFDELSTSSEILETG
ATPB_ENTHA       ISVPVGKDTLGRVFNVLGDTIDLGSSFPEDAE----RSEIHKKAPSFDELSTSTEILETG
ATPB_LACLA       VSVPVGEATLGRVFNVLGDVIDGGEEFAADAE----RNPIHKKAPTFDELSTANEVLVTG
ATPB_LACAC       ISVPVGEDTLGRVFNVLGQPIDGGPAFPKDHP----REGIHKEAPKYEDLTTSREILETG
ATPB_LACDA       ISVPVGPDTLGRVFNVLGQPIDGGPEFPADHP----RSGIHKEAPKYDELTTSREILETG
ATPB_LACJO       ISVPVGKDTLGRVFNVLGDPIDGGPALGKDVK----REGIHKEAPKYDELSTSEEILETG
ATPB_LACCA       ISVPVGKDTLGRVFNVLGDPIDDGEALDLNHR----RDSIHRDAPKFEDLNTSSEILETG
ATPB_LACSS       INVPVGKETLGRVFNVLGETIDGGEEFPADFR----RDSIHRSAPKFEELNTSSEILETG
ATPB_LACPL       ITVPVGKETLGRVFNVLGETIDGGPEFGPDAE----RNPIHRDAPKYDELTTSTEVLETG
ATPB_LACS1       ISVPVGKDTLGRVFNVLGNTIDNGPEFDEDHP----RNPIHRDAPKYDQLSTGIEILETG
ATPB_RUBXD       IAVPVGEAVLGRVLDVLGEPVDEQGPVEGEA----DRWPIHRPAPKFEDLSTKAEQFVSG
ATPB2_PELCD      LQAPVGQAILGRVFNVFGQPIDRREPPDG-----CRWRSVLTKPAGLTERSSKTEMFITG
ATPB2_MYCPU      FNVPVGSATNGAIFDVLGNLLNEHPGDFKK-------VEVDSTISTEKHFNSDNEIINTG
                 .  * *    . : :  *   :                 :    .           : :*

ATPB_TROWT       IKVIDLLTPYVQGGKIGLFGGAGVGKTVLIQEMI--QRVAQDHGG---VSVFAGVGERTR
ATPB_LEIXX       IKVIDLLTPYVQGGKIGLFGGAGVGKTVLIQEMV--QRVAQDHGG---VSVFAGVGERTR
ATPB_BIFLO       IKVIDLLTPYVQGGKIGLFGGAGVGKTVLIQEMI--QRVAQNHGG---VSVFAGVGERTR
ATPB_CUTAK       IKVLDLLTPYVKGGKIGLFGGAGVGKTVLIQEMI--YRIAHNFGG---TSVFAGVGERTR
ATPB_THEFY       IKVIDLLTPYVRGGKIGLFGGAGVGKTVLIQEMI--TRIARNFGG---VSVFAGVGERTR
ATPB_STRAW       VKVIDLLTPYVKGGKIGLFGGAGVGKTVLIQEMI--YRVANNHDG---VSVFAGVGERTR
ATPB_FRACC       IKVIDLLAPYVRGGKIGLFGGAGVGKTVIIQEMI--RRVAKEFGG---VSVFAGVGERTR
ATPB_CORJK       IKVIDLLTPYVKGGKIGLFGGAGVGKTVLIQEMI--TRIAREFSG---TSVFAGVGERTR
ATPB_CORGL       IKVIDLLTPYVKGGKIGLFGGAGVGKTVLIQEMI--TRIAREFSG---TSVFAGVGERTR
ATPB_RHOJR       IKVIDLLTPYVKGGKIGLFGGAGVGKTVLIQEMI--TRIAREFSG---TSVFAGVGERTR
ATPB_MYCLE       LKVVDLLTPYVRGGKIALFGGAGVGKTVLIQEMI--NRIARNFGG---TSVFAGVGERTR
ATPB_FERIS       LKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMEMI--RNIAIEHHG---FSIFAGVGERTR
ATPB_THEMA       IKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELI--RNIAIEHKG---FSVFAGVGERTR
ATPB_AQUPY       IKVIDLLQPIIKGGKVGLFGGAGVGKTVLMQELI--HNIARFHEG---YSVVVGVGERTR
ATPB_NITWN       IKVVDLLAPYAKGGKIGLFGGAGVGKTVLIQELI--NNVAKAHGG---YSVFAGVGERTR
ATPB_BRADU       IKVVDLLAPYAKGGKIGLFGGAGVGKTVLIQELI--NNVAKAHGG---YSVFAGVGERTR
ATPB_RHILO       IKVLDLLAPYAKGGKIGLFGGAGVGKTVLIQELI--NNIAKAHGG---YSVFAGVGERTR
ATPB_AGRFC       IKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELI--NNVAKAHGG---YSVFAGVGERTR
ATPB_MAGSA       IKVIDLLAPYCKGGKIGLCGGAGVGKTVLIMELI--NNIAKAHGG---YSVFAGVGERTR
ATPB_PELUB       IKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELI--NNVAKAHGG---FSVFAGVGERTR
ATPB_RHORT       IKVIDLIAPYTKGGKVGLFGGAGVGKTVLIQELI--NNVAKGHGG---YSVFAGVGERTR
ATPB_RUEPO       IKVIDLLAPYSKGGKIGLFGGAGVGKTVLIMELI--NNIAKVHSG---YSVFAGVGERTR
ATPB_RUEST       IKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELI--NNIAKVHSG---YSVFAGVGERTR
ATPB_ROSDO       IKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELI--NNIAKVHSG---FSVFAGVGERTR
ATPB_JANSC       IKVVDLLAPYSKGGKIGLFGGAGVGKTVLIMELI--NNIAKVHSG---VSVFAGVGERTR
ATPB_RHOCA       IKVIDLLAPYSKGGKIGLFGGAGVGKTVLIMELI--NNIAKVHSG---FSVFAGVGERTR
ATPB1_RHOS4      IKVIDLLAPYSKGGKIGLFGGAGVGKTVLIMELI--NNIAKVHSG---YSVFAGVGERTR
ATPB_RHOBL       IKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELI--NNIAKVHSG---YSVFAGVGERTR
ATPB_NOVAD       IKVIDLLAPYARGGKIGLFGGAGVGKTVLIQELI--NNIAKGHGG---VSVFAGVGERTR
ATPB_ZYMMO       IKVIDLLAPYSKGGKVGLFGGAGVGKTVLIQELI--NNIAKGHGG---FSVFAGVGERTR
ATPB1_GLUOX      IKVVDLLCPYLKGGKIGLFGGAGVGKTVIIQELI--NNIAKAHGG---VSVFAGVGERTR
ATPB_RICTY       IKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELI--NNVAKAHGG---YTVFAGVGERTR
ATPB_RICBR       IKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELI--NNVAKAHGG---YTVFAGVGERTR
ATPB_ANAMM       IKVVDLLAPYLKGGKVGLFGGAGVGKTVLIMELI--SNVARAHKG---FSVFAGVGERTR
ATPB_ANAPZ       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIMELI--SNIARAHKG---FSVFAGVGERTR
ATPB_EHRCJ       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIMELI--HNIAKAHRG---VSVFAGVGERTR
ATPB_EHRCR       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIMELI--HNIAKAHKG---VSVFAGVGERTR
ATPB_EHRRW       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIMELI--HNIAKAHKG---VSVFAGVGERTR
ATPB_WOLTR       IKVIDLLAPYLKGGKIGLFGGAGVGKTVLIMELI--NNIAKAHKG---FSVFAGVGERTR
ATPB_NEOSM       IKVIDLLAPYSKGGKVGLFGGAGVGKTVLIMELI--NNIAKAYGG---FSVFAGVGERTR
ATPB_CAMJR       IKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELI--HNVAFKHSG---YSVFAGVGERTR
ATPB_SULDN       IKVVDLLAPYSKGGKVGLFGGAGVGKTVIIMELI--HNVAMGHDG---LSVFAGVGERTR
ATPB_HELHP       IKVVDLIAPYSKGGKVGLFGGAGVGKTVVIMELI--HNVAYKHSG---YSVFAGVGERTR
ATPB_WOLSU       IKVVDLLAPYSKGGKVGLFGGAGVGKTVVIMELI--HNVAFKHSG---YSVFAGVGERTR
ATPB_HELPJ       IKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELI--HNVAYKHNG---YSVFAGVGERTR
ATPB_DESPS       IKVIDLLVPFPLGGKMGLFGGAGCGKTVIMMEMV--NNIAMHHGG---ISVFCGVGERTR
ATPB_SYNAS       VKVIDLLVPFPRGGKMGLFGGAGCGKTVVMMEMI--HNIAMHHGG---ISVFAGVGERTR
ATPB_DESAG       IKVVDLLIPFPKGGKMGLFGGAGVGKTVILMEMI--NNIAKQHGG---ISVFAGVGERTR
ATPB_DESVH       IKVVDLLIPFPKGGKMGLFGGAGVGKTVILMEMI--NNIAKQHGG---ISVFAGVGERTR
ATPB_LAWIP       IKVIDLLVPFPKGGKMGLFGGAGVGKTVILMEMI--NNIARQHGG---ISVFAGVGERTR
ATPB_MYXXD       IKVIDLLAPYTRGGKIGLFGGAGVGKTVLLQELI--RNVAVERGG---FSVFAGVGERTR
ATPB_STIAU       IKVIDLLGPYTRGGKIGLFGGAGVGKTVLLMELI--VNVAKERGG---FSVFAGVGERTR
ATPB_ANADE       IKVIDLLAPYLRGGKIGLFGGAGVGKTVLLMELV--NNVAKKRGG---FSVFGGVGERTR
ATPB_GEOSL       IKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELI--NNIAKQHGG---FSVFAGVGERTR
ATPB_BDEBA       IKVVDLLAPYAKGGKIGLFGGAGVGKTVLIQELI--RNIATEHGG---FSVFAGVGERTR
ATPB_CHLP8       IKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELI--NNIAKEQSG---YSVFAGVGERTR
ATPB_KORVE       IKVIDLIQPFLKGGKIGLFGGAGVGKTVVIQELI--NNVAKQHGG---FSVFGGVGERTR
ATPB_OENEH       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_ORYSA       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_PEA         IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CUSRE       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CUSPE       IKVVDLLAPYRRGGKVGLFGGAGVGKTVLIMELI--NNIAKAYGG---VSVFGGVGERTR
ATPB_PTEAQ       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVSGGVGERTR
ATPB_HUPLU       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_PSINU       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_STAPU       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_ZYGCR       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CHAVU       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_PINKO       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_MESVI       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CHLRE       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFAGVGERTR
ATPB_TETOB       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFAGVGERTR
ATPB_TUPAK       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CHLVU       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_OLTVI       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_NEPOL       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_OSTTA       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELIVNNNIAKAHGG---VSVFAGVGERTR
ATPB_EUGGR       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_PROWI       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKTHGG---VSVFGGVGERTR
ATPB_CYAPA       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_GUITH       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_TRICV       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_PYRYE       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_GRATL       IKVVDLLAPYRKGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CYAM1       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFAGVGERTR
ATPB_GALSU       IKVIDLLAPYKRGGKIGLFGGAGVGKTVLIMELI--NNIAKSHGG---VSVFGGVGERTR
ATPB_EMIHU       IKVVDLLAPYKRGGKIGLFGGAGVGKTVLIMELI--NNIARAHGG---VSVFGGVGERTR
ATPB_OCHNE       IKVVDLLAPYKRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_PYLLI       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_DICDH       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNIAKAHGG---VSVFGGVGERTR
ATPB_CYACA       IKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELI--NNVAKAHGG---VSVFGGVGERTR
ATPB_TRIV2       IKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELI--NNIATQHGG---VSVFAGVGERTR
ATPB_SYNP1       IKVIDLLTPYRRGGKIGLFGGAGVGKTVIMMELI--NNIATQHGG---VSVFAGVGERTR
ATPB_PRODI       IKVIDLLTPYRRGGKIGLFGGAGVGKTVIMMELI--NNIAINHGG---VSVFGGVGERTR
ATPB_SYNY3       IKVIDLLTPYRQGGKIGLFGGAGVGKTVIMMELI--NNIAIQHGG---VSVFGGVGERTR
ATPB_PROMM       IKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELI--NNIAKEHGG---VSVFGGVGERTR
ATPB_SYNS9       IKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELI--NNIAKEHGG---VSVFGGVGERTR
ATPB_PROMP       IKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELI--NNIAKEHGG---VSVFGGVGERTR
ATPB_SYNE7       IKVIDLLAPYRQGGKIGLFGGAGVGKTVLIQELI--NNIAKEHGG---VSVFGGVGERTR
ATPB_SYNJA       IKVIDLLAPFKRGGKVGLFGGAGVGKTVLIQELI--HNIAEEHSG---LSVFAGVGERTR
ATPB_GLOVI       IKVIDLLAPYRKGGKIGLFGGAGVGKTVLIQELI--HNIAKEHSG---VSVFGGVGERTR
ATPB_LEPIC       IKVIDLLAPYIKGGKTGLFGGAGVGKTVLIQELI--NNIAKQHGG---FSVFAGVGERTR
ATPB_FUSNN       IKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELI--NNIAKGHGG---ISVFAGVGERTR
ATPB_PROMO       IKVVDLLAPYVKGGKIGLFGGAGVGKTVLIMELI--NNIAQGHGG---LSVFAGVGERTR
ATPB1_RHOFT      IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB2_PARXL      IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKEHGG---YSVFAGVGERTR
ATPB1_NITMU      IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_NITEU       IKVIDLVCPFAKGGKIGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_CUPPJ       IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKQHSG---LSVFAGVGERTR
ATPB_BORA1       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKQHSG---LSVFAGVGERTR
ATPB_AROAE       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKQHSG---LSVFAGVGERTR
ATPB_DECAR       IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKQHAG---LSVFAGVGERTR
ATPB_METFK       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKQHSG---LSVFAGVGERTR
ATPB_NEIMA       IKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB_CHRVO       IKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB_PSYCK       IKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIALKHEG---LSVFAGVGERTR
ATPB_ACIAD       IKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB_XANC5       IKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB_XYLFT       IKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB_ALCBS       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---FSVFAGVGERTR
ATPB_HAHCH       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKEHSG---LSVFAGVGERTR
ATPB_SACD2       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIATEHSG---LSVFAGVGERTR
ATPB_CHRSD       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIATEHSG---YSVFAGVGERTR
ATPB_PSESM       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_PSEHT       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_COLP3       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_IDILO       IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_SHEON       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFAGVGERTR
ATPB_PASMU       IKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_MANSM       IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---FSVFAGVGERTR
ATPB_ECOLI       IKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_METCA       IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_NITOC       IKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--RNIATEHSG---YSVFAGVGERTR
ATPB_LEGPH       IKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_COXBU       IKVVDLLCPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_FRATT       IKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELI--NNIAKEHSG---YSVFAGVGERTR
ATPB_THIDA       IKVIDLIMPIAKGGKVGLFGGAGVGKTVTLMELI--RNIAVQHSG---FSVFAGVGERTR
ATPB_ACIFR       IKVIDLVCPFAKGGKVGLFGGAGVGKTVLMMELI--RNIAIEHTG---YSVFAGVGERTR
ATPB_HYDCU       VKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFAGVGERTR
ATPB_VIBCH       VKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELI--NNIALQHSG---LSVFAGVGERTR
ATPB_ALIF1       VKVIDLVCPFAKGGKIGLFGGAGVGKTVNMMELI--NNIALQHSG---LSVFAGVGERTR
ATPB1_PHOPR      VKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELI--NNIALQHSG---LSVFAGVGERTR
ATPB2_PHOPR      VKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELI--NNIAKAHSG---LSVFTGVGERTR
ATPB_BUCAI       IKVIDLICPFSKGGKVGLFGGAGVGKTVNMMELI--RNIAVEHSG---YSVFTGVGERTR
ATPB_BUCAP       IKVIDLICPFSKGGKVGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFTGVGERTR
ATPB_BUCBP       IKVIDLICPFSKGGKVGLFGGAGVGKTVNMMELI--RNIATEHSG---YSVFTGVGERTR
ATPB_BAUCH       IKVIDLMCPLVKGGKAGLFGGAGVGKTVNMMELI--RNIAIEHAG---YSVFTGVGERTR
ATPB_BLOFL       IKVIDLMCPFIKGGKIGLFGGAGVGKTVNIMELI--RNIAIEHAG---YSVFVGVGERIR
ATPB_BLOPB       IKVIDLMCPFSKGGKIGLFGGAGVGKTVNMMELI--RNIAVEHSG---YSVFVGVGERTR
ATPB_WIGBR       IKIIDLICPFAKGGKIGLFGGAGVGKTVNMMELI--RNIAIEHSG---YSVFSGVGERTR
ATPB_HERAU       IKVIDLIAPFTKGGKTGVFGGAGVGKTVIIQELI--SNIAKEQSG---YSVFAGVGERSR
ATPB_RHOBA       IKVVDLLTPFVRGGKAGLFGGAGLGKTVILTELI--ARIASSHGG---YSVFAGVGERTR
ATPB_DEHMC       IKVIDLIAPFARGGKIGALGGAGVGKTVLIQELI--RNIATEHEG---FSVFAGVGERSR
ATPB_ACEWD       IKVVDLICPYVRGGKIGLFGGAGVGKTVLIQELI--NNIATQHGG---LSVFAGVGERTR
ATPB_SYMTH       IKVIDLLCPYARGGKIGLFGGAGVGKTVMIQELI--HNIAYKFGG---YSIFAGVGERTR
ATPB_CALS4       IKVIDLLTPYPKGGKIGLFGGAGVGKTVLIMELI--RNVAIEHGG---YSIFAGVGERSR
ATPB_PARUW       IKVIDLLCPYTKGGKVGLFGGAGVGKSVIVMELI--HNIATHHGG---YSVFCGIGERTR
ATPB_PECFR       IKVVDLIAPYSRGGKIGLFGGAGVGKTVLIMELI--HNIATQHGG---YSVFSGVGERTR
ATPB_CARHZ       IKVIDLLVPFLKGGKIGLFGGAGVGKTVIVMELI--NNIAKQHGG---ISVFAGVGERTR
ATPB_MOOTA       IKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELI--RNIAYEHGG---FSVFSGVGERTR
ATPB_DESHY       IKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELI--NNIAMEHGG---LSVFAGVGERTR
ATPB_CLOAB       IKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELI--NNIAKEHGG---LSVFTGVGERTR
ATPB_CLOPE       IKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELI--NNIAKEHGG---LSVFTGVGERSR
ATPB_BACTN       IKVIDLLEPYAKGGKIGLFGGAGVGKTVLIQELI--NNIAKKHNG---FSVFAGVGERTR
ATPB_CELLY       IKVIDLIEPYAKGGKIGLFGGAGVGKTVLIQELI--NNIAKGHGG---LSVFAGVGERTR
ATPB_SALRD       IKVMDLIQPVPKGGKVGLFGGAGVGKTVLIMELI--NNIAKAHEG---LSVFSGVGERTR
ATPB_MYCMS       IKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELI--NNIAKAHNG---VSVFAGVGERTR
ATPB_MESFL       IKVIDLMIPFAKGGKIGLFGGAGVGKTVLIQELI--NNIAKAHSG---VSVFAGVGERTR
ATPB_UREPA       IKVVDLLVPFAKGGKIGLFGGAGVGKTVLMQELI--HNIAKNHGG---LSVFAGVGERTR
ATPB_MYCGE       IKVIDLLTPYVRGGKIGLFGGAGVGKTVLVQELI--HNIAKEHSG---LSVFAGVGERTR
ATPB_MYCPN       IKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELI--HNIAKEHSG---LSVFAGVGERTR
ATPB_MYCGA       IKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELI--HNIATGHGG---LSVFAGVGERTR
ATPB1_MYCPU      IKVIDLLVPYSKGGKIGLFGGAGVGKTVLVQELI--NNIATQHGG---LSVFAGVGERTR
ATPB_MYCS5       IKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELI--NNIATQHNG---LSVFTGVGERTR
ATPB_MYCMO       IKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELI--NNIAVHHGG---LSVFAGVGERTR
ATPB_MYCHJ       IKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELI--NNIASKHGG---LSVFAGVGERSR
ATPB_STAHJ       IKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB_STAS1       IKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB2_LISIN      IKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELI--HNIAQEHGG---ISVFAGVGERTR
ATPB_GEOSE       IKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--HNIAQEHGG---ISVFAGFGERTR
ATPB_BACSU       IKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB_BACMQ       IKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB_BACCR       IKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB_BACHD       IKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB_BACSK       IKVVDLLAPYTKGGKIGLFGGAGVGKTVLIQELI--NNVALEHGG---ISVFAGVGERTR
ATPB_OCEIH       IKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--NNIAQEHGG---ISVFAGVGERTR
ATPB_STRMU       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELI--HNIAQEHGG---ISVFTGVGERTR
ATPB_STRR6       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELI--HNIAQEHGG---ISVFAGVGERTR
ATPB_ENTHA       IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELI--HNIAQEHGG---ISVFTGVGERTR
ATPB_LACLA       IKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELI--HNIAQEHGG---ISVFTGVGERTR
ATPB_LACAC       IKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELI--HNIAQEHGG---ISVFTGVGERTR
ATPB_LACDA       IKVIDLLEPYLRGGKVGLFGGAGVGKTTIIQELI--HNIAQEHNG---ISVFTGVGERTR
ATPB_LACJO       IKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELI--HNIAQEHGG---ISVFTGVGERTR
ATPB_LACCA       IKVIDLLEPYLRGGKVGLFGGAGVGKTVLIQELI--HNIAEEHGG---ISVFTGVGERTR
ATPB_LACSS       IKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELI--HNIAEEHGG---ISVFTGVGERTR
ATPB_LACPL       IKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELI--HNIAQEHNG---ISVFTGVGERTR
ATPB_LACS1       IKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELI--HNIAQEHNG---ISVFTGVGERTR
ATPB_RUBXD       IKVIDLLCPVRRGGKVGLFGGAGVGKTVLITELI--NNIALQYEG---TSVFTGVGERTR
ATPB2_PELCD      IKAIDVLAPLERGGKAGLFGGAGVGKTVLITELI--HNMVGQHEG---VSLFCGIGERCR
ATPB2_MYCPU      IKIIDFFVPIIKGSKIGIFGGAGVGKTIIIKELI--FNISRQRDSNDVKVFFVGTGERTR
                 :* :*.. *   *.* .  **** **:  : *::   .:     .     .  * *** *

ATPB_TROWT       EGNDLIREMQDAGVFD----------------------------KTALVFGQMDEPPGTR
ATPB_LEIXX       EGNDLIHEMEEAGVFD----------------------------KTALVFGQMDEPPGTR
ATPB_BIFLO       EGNDLIGEMAEAGVLE----------------------------KTALVFGQMDEQPGTR
ATPB_CUTAK       EGNDLINEMDEAGVLK----------------------------DTALVFGQMDEPPGTR
ATPB_THEFY       EGTDLFLEMQEMGVLP----------------------------DTALVFGQMDEPPGTR
ATPB_STRAW       EGNDLIEEMSDSGVID----------------------------KTALVFGQMDEPPGTR
ATPB_FRACC       EGNDLFLEMTEAGVIE----------------------------DTALVFGQMDEPPGTR
ATPB_CORJK       EGTDLFLEMEEMGVLQ----------------------------DTALVFGQMDEPPGVR
ATPB_CORGL       EGTDLFLEMEEMGVLQ----------------------------DTALVFGQMDEPPGVR
ATPB_RHOJR       EGTDLHLEMEEMGVLQ----------------------------DTALVFGQMDEPPGTR
ATPB_MYCLE       EGNDLWVELQEVNVLK----------------------------DTALVFGQMDEPPGTR
ATPB_FERIS       EGNDLYLEMTEAGVLN----------------------------NTVLVFGQMNEPPGAR
ATPB_THEMA       EGNELWLEMQESGVLG----------------------------NTVLVFGQMNEPPGAR
ATPB_AQUPY       EGNDLWLEMKESGVLP----------------------------YTVMVYGQMNEPPGVR
ATPB_NITWN       EGNDLYHEFIESGVNKKGGGEG---------------------SKCALVYGQMNEPPGAR
ATPB_BRADU       EGNDLYHEFIESKVNADPHNPDPSVK-----------------SKCALVFGQMNEPPGAR
ATPB_RHILO       EGNDLYHEFIESGVNKKGGGEG---------------------SKAALVYGQMNEPPGAR
ATPB_AGRFC       EGNDLYHEMIESNVNKLGGGEG---------------------SKAALVYGQMNEPPGAR
ATPB_MAGSA       EGNDLYHEMIESGVIKLDGPG----------------------SKVALVYGQMNEPPGAR
ATPB_PELUB       EGNDLYHEMIDSGVIKPEGPG----------------------SKAALVYGQMNEPPGAR
ATPB_RHORT       EGNDLYHEMIDAGIIDLEGDK----------------------SKVALVYGQMNEPPGAR
ATPB_RUEPO       EGNDLYHEMIESNVIKLENLEE---------------------SQVALVYGQMNEPPGAR
ATPB_RUEST       EGNDLYHEMIESNVIKPDNLEE---------------------SQVALVYGQMNEPPGAR
ATPB_ROSDO       EGNDLYHEMIESSVIVPDNLTE---------------------SKVALVYGQMNEPPGAR
ATPB_JANSC       EGNDLYHEMIESGVIVPDNLPE---------------------SKIALVYGQMNEPPGAR
ATPB_RHOCA       EGNDLYHEMIESGVINLEKLEE---------------------SKVALVYGQMNEPPGAR
ATPB1_RHOS4      EGNDLYHEMIESGVIKIDNLSE---------------------SKVALVYGQMNEPPGAR
ATPB_RHOBL       EGNDLYHEFIESGVINIDDLEK---------------------SKVALVYGQMNEPPGAR
ATPB_NOVAD       EGNDLYHEFLDAGVIAKDADGNPTPDG----------------SKVALVFGQMNEPPGAR
ATPB_ZYMMO       EGNDLYHEFLEAGVIASDKDGNAISEG----------------SKVALVYGQMNEPPGAR
ATPB1_GLUOX      EGNDLYFEMQDAGVIKIAEDGS--TEG----------------SKVALVYGQMNEPPGAR
ATPB_RICTY       EGNDLYHEMIASGVINLEAPEK---------------------SKVALVYGQMNEPPGAR
ATPB_RICBR       EGNDLYHEMIDSGVINLEEPEK---------------------SKVALVYGQMNEPPGAR
ATPB_ANAMM       EGNDLYREMVESGVISRDEPSK---------------------SQAVLVYGQMNEPPGAR
ATPB_ANAPZ       EGNDLYREMVESGVINEDEREK---------------------SQAVLVYGQMNEPPGAR
ATPB_EHRCJ       EGNDLYHEMIESGVINLNEKDQ---------------------SQAVLVYGQMNEPPGAR
ATPB_EHRCR       EGNDLYHEMIESGVINLENKDQ---------------------SQAVLVYGQMNEPPGAR
ATPB_EHRRW       EGNDLYHEMIESGVINLEEKDK---------------------SQAVLVYGQMNEPPGAR
ATPB_WOLTR       EGNDLYHEMITSNVINVNEHEK---------------------SQAVLVYGQMNEPPGAR
ATPB_NEOSM       EGNDLYSEMVESGVIDKEHPEK---------------------SKVVLVYGQMNEPPGAR
ATPB_CAMJR       EGNDLYNEMKESNVLD----------------------------KVALCYGQMNEPPGAR
ATPB_SULDN       EGNDLYHEMKDSNVLD----------------------------KVALCYGQMSEPPGAR
ATPB_HELHP       EGNDLYHEMKEGGVLD----------------------------KVALCYGQMNEPPGAR
ATPB_WOLSU       EGNDLYHEMKESGVLD----------------------------KVALCYGQMNEPPGAR
ATPB_HELPJ       EGNDLYFEMKEGGVLD----------------------------KVALCYGQMNEPPGAR
ATPB_DESPS       EGNDLYNEMKESGVLP----------------------------KAALVYGQMTEPPGAR
ATPB_SYNAS       EGNDLYREMLESGVIK----------------------------QAALIYGQMTEPPGAR
ATPB_DESAG       EGNDLYHEMKDAGVLE----------------------------KAALVYGQMNEPPGAR
ATPB_DESVH       EGNDLYHEMKDAGVLE----------------------------KAALIYGQMNEPPGAR
ATPB_LAWIP       EGNDLYHEMKEAGVLE----------------------------KAILVYGQMNEPPGAR
ATPB_MYXXD       EGNDLYHEMQDTKVIQTDNLEA---------------------SQAVLVYGQMNEPPGAR
ATPB_STIAU       EGNDLYHEMQEGNVSTPRTWME---------------------SQCVLVYGQMNEPPGAR
ATPB_ANADE       EGNDLYHEMIEAGVINKDDLSK---------------------SQCVLVYGQMNEPPGAR
ATPB_GEOSL       EGNDLWMEMKESGVLD----------------------------KAALVYGQMNEPPGAR
ATPB_BDEBA       EGNDLWQEMKQSGVLA----------------------------KTSLVFGQMNEPPGAR
ATPB_CHLP8       EGNDLWHEMMESGVID----------------------------KTALVFGQMNEPPGAR
ATPB_KORVE       EGNDLWLEFTEAGVITPGDPSK---------------------SKAALVYGQMTEPPGAR
ATPB_OENEH       EGNDLYMEMKESGVINEQNIAE---------------------SKVALVYGQMNEPPGAR
ATPB_ORYSA       EGNDLYMEMKESGVINEKNLEE---------------------SKVALVYGQMNEPPGAR
ATPB_PEA         EGNDLYMEMKESRVINEKNIAE---------------------SKVALVYGQMNEPPGAR
ATPB_CUSRE       EGNDLYMEMKESGVINEKNITE---------------------SKVALVYGQMNEPPGAR
ATPB_CUSPE       EGNDLYMEMKESGVINQQKLAE---------------------SKVALVYGQMNEPPGAR
ATPB_PTEAQ       EGNDPYMEMKESKVINEENISE---------------------SKVALVYGQMNEPPGAR
ATPB_HUPLU       EGNDLYMEMKESKVINEQNISE---------------------SKVALVYGQMNEPPGAR
ATPB_PSINU       EGNDLYTEMKESKVINEQNLSE---------------------SKVALVYGQMNEPPGAR
ATPB_STAPU       EGNDLYMEMKESKVINEENLSE---------------------SKVALVYGQMNEPPGAR
ATPB_ZYGCR       EGNDLYMEMKESKVINEENISE---------------------SKVALVYGQMNEPPGAR
ATPB_CHAVU       EGNDLYMEMKESKVINEENISE---------------------SKVALVYGQMNEPPGAR
ATPB_PINKO       EGNDLYMEMKESGVIDEQKISE---------------------SKVALVYGQMNEPPGAR
ATPB_MESVI       EGNDLYMEMKESKVINEENLSS---------------------SKVALVYGQMNEPPGAR
ATPB_CHLRE       EGNDLYTEMKESGVIVEKNLSD---------------------SKVALVYGQMNEPPGAR
ATPB_TETOB       EGNDLYTEMKESGVIVEKNLID---------------------SKVALVYGQMNEPPGAR
ATPB_TUPAK       EGNDLYMEMKESGVIQEKNMSA---------------------SKVALVYGQMNEPPGAR
ATPB_CHLVU       EGNDLYMEMKESGVINESNISE---------------------SKVALVYGQMNEPPGAR
ATPB_OLTVI       EGNDLYAEMKESKVINEDNLSE---------------------SKVALVYGQMNEPPGAR
ATPB_NEPOL       EGNDLYMEMCESKVINKADVKS---------------------SKVALVYGQMNEPPGAR
ATPB_OSTTA       EGNDLYQEMCESKVIDTANLAN---------------------SKVALVYGQMNEPPGAR
ATPB_EUGGR       EGNDLYQEMKESGVINDRNFKE---------------------SKVALIYGQMNEPPGAR
ATPB_PROWI       EGNDLYMEMKESGIINEALISE---------------------SKVALVYGQMNEPPGAR
ATPB_CYAPA       EGNDLYQEMKESKVIDENNLPA---------------------SKVALVYGQMNEPPGAR
ATPB_GUITH       EGNDLYMEMKESKVINESNLGE---------------------SKVALVYGQMNEPPGAR
ATPB_TRICV       EGNDLYEEMKESGVINENNFKE---------------------SKVALVYGQMNEPPGAR
ATPB_PYRYE       EGNDLYMEMKESKVIDADNLKE---------------------SKVALVYGQMNEPPGAR
ATPB_GRATL       EGNDLYEEMKESKVINADNLKE---------------------SKVALVYGQMNEPPGAR
ATPB_CYAM1       EGNDLYEEMKASGVIQSQNLSE---------------------SKVALCYGQMNEPPGAR
ATPB_GALSU       EGNDLYVEMKESKVINEKNLEE---------------------SKVALVYGQMNEPPGAR
ATPB_EMIHU       EGNDLYAEMKESGVIDEKKLDN---------------------SKVALVYGQMNEPPGAR
ATPB_OCHNE       EGNDLYAEMKESKVIDEDKLEN---------------------SKVALVYGQMNEPPGAR
ATPB_PYLLI       EGNDLYMEMKESGVINETNLLE---------------------SKVALVYGQMNEPPGAR
ATPB_DICDH       EGNDLYMEMKESGVINESNLSE---------------------SKVALVYGQMNEPPGAR
ATPB_CYACA       EGNDLYQEMKESGVINEKDLNL---------------------SKVALCYGQMNEPPGAR
ATPB_TRIV2       EGNDLYNEMIESGVINKDNLNE---------------------SKIALVYGQMNEPPGAR
ATPB_SYNP1       EGNDLYNEMIESGVIDKDDPSK---------------------SKIALVYGQMNEPPGAR
ATPB_PRODI       EGNDLYNEMIESKVINADNLNE---------------------SKIALVYGQMNEPPGAR
ATPB_SYNY3       EGNDLYNEMIESNVINADKPEE---------------------SKIALVYGQMNEPPGAR
ATPB_PROMM       EGNDLYEEFKESGVINSDDLSK---------------------SKVALCFGQMNEPPGAR
ATPB_SYNS9       EGNDLYEEFKESGVINADDLSK---------------------SKVALCYGQMNEPPGAR
ATPB_PROMP       EGNDLYEEFKESGVINADDLSQ---------------------SKVALCFGQMNEPPGAR
ATPB_SYNE7       EGNDLYQEFKESGVIDEKNIAN---------------------SKVALVYGQMNEPPGAR
ATPB_SYNJA       EGNDLYNEMKESGVLD----------------------------KVALVYGQMNEPPGAR
ATPB_GLOVI       EGNDLYNEFKESNVLG----------------------------QVALVYGQMNEPPGAR
ATPB_LEPIC       EGNDLWREMKESGVID----------------------------KTVLCYGQMNEPPGAR
ATPB_FUSNN       EGRDLYGEMTESGVIT----------------------------KTALVYGQMNEPPGAR
ATPB_PROMO       EGRDLYDEMLESGVLD----------------------------KTSLVYGQMNEPPGAR
ATPB1_RHOFT      EGNDFYHEMADSGVVNLENLGE---------------------SKVAMVYGQMNEPPGNR
ATPB2_PARXL      EGNDFYHEMKDSNVLD----------------------------KVALVYGQMNEPPGNR
ATPB1_NITMU      EGNDFYHEMKDSNVLD----------------------------KVALVYGQMNEPPGNR
ATPB_NITEU       EGNDFYHEMKDSNVLD----------------------------KVALVYGQMNEPPGNR
ATPB_CUPPJ       EGNDFYHEMKDSNVLD----------------------------KVAMVFGQMNEPPGNR
ATPB_BORA1       EGNDFYHEMEESNVLD----------------------------KVAMVFGQMNEPPGNR
ATPB_AROAE       EGNDFYHEMKDSNVLD----------------------------KVAMVFGQMNEPPGNR
ATPB_DECAR       EGNDFYHEMKDSNVLD----------------------------KVAMVFGQMNEPPGNR
ATPB_METFK       EGNDFYHEMKDSNVLD----------------------------KVGMVFGQMNEPPGNR
ATPB_NEIMA       EGNDFYHEMKDSNVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_CHRVO       EGNDFYHEMKDSNVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_PSYCK       EGNDFYHEMQEAGVVNTEDFSK---------------------SKVAMVYGQMNEPPGNR
ATPB_ACIAD       EGNDFYHEMKDSNVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_XANC5       EGNDFYHEMKDSNVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_XYLFT       EGNDFYHEMKDSNVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_ALCBS       EGNDFYHEMKDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_HAHCH       EGNDFYYEMEESKVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_SACD2       EGNDFYFEMQEAGVVNVDKFDE---------------------SKVAMVYGQMNEPPGNR
ATPB_CHRSD       EGNDFYHEMQESNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_PSESM       EGNDFYHEMKDSNVLD----------------------------KVALVYGQMNEPPGNR
ATPB_PSEHT       EGNDFYHEMNDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_COLP3       EGNDFYHEMNDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_IDILO       EGNDFYHEMNDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_SHEON       EGNDFYYEMKDSGVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_PASMU       EGNDFYHEMKDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_MANSM       EGNDFYHEMTDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_ECOLI       EGNDFYHEMTDSNVID----------------------------KVSLVYGQMNEPPGNR
ATPB_METCA       EGNDFYHEMKESNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_NITOC       EGNDFYHEMKDSQVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_LEGPH       EGNDFYHEMKDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_COXBU       EGNDFYHEMKESNVLD----------------------------KVALVYGQMNEPPGNR
ATPB_FRATT       EGNDFYYEMKDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_THIDA       EGNDFYHEMKEGGVLD----------------------------KVALVYGQMNEPPGNR
ATPB_ACIFR       EGNDFYHEMTDSGVLD----------------------------KVALVYGQMNEPPGNR
ATPB_HYDCU       EGNDFYYEMEESGVLD----------------------------KVALVYGQMNEPPGNR
ATPB_VIBCH       EGNDFYHEMQEAGVVNVEQPEL---------------------SKVAMVYGQMNEPPGNR
ATPB_ALIF1       EGNDFYFEMQEAGVVNIEKPEE---------------------SKVAMVYGQMNEPPGNR
ATPB1_PHOPR      EGNDFYFEMQEAGVVNLENPSE---------------------SKVAMVYGQMNEPPGNR
ATPB2_PHOPR      EGNDFYYEMKEAGVLD----------------------------KVAMVYGQMNEPPGNR
ATPB_BUCAI       EGNDFYHEMNDSQVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_BUCAP       EGNDFYHEMKDSKVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_BUCBP       EGNDFYHEMSDSRVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_BAUCH       EGNDFYHEMKDSNVLD----------------------------KVSLVYGQMNEPPGNR
ATPB_BLOFL       EGNDFYHEMIHSGILD----------------------------KVALVYGQMNEPPGNR
ATPB_BLOPB       EGNDFYNEMINSDVIN----------------------------KVALVYGQMNEPPGNR
ATPB_WIGBR       EGNDFYNEMISSNVID----------------------------KVSLVYGQMNEPPGNR
ATPB_HERAU       EGNDLIHEMKDSKIPGTDQTVF---------------------DKTVMVFGQMNEPPGAR
ATPB_RHOBA       EGTDLWLEMQETEIGSTGRNVI---------------------EQTCMVFGQMNEPPGSR
ATPB_DEHMC       EGNDLWHEMEDS-------GVL---------------------PKTTMVFGQMNELPAVR
ATPB_ACEWD       EGNDLYYEMMESGVIN----------------------------KTALCFGQMNEPPGAR
ATPB_SYMTH       EGNDLYHEMIEAGVID----------------------------KVAMVFGQMNEPPGAR
ATPB_CALS4       EGNELWLEMHEAGVID----------------------------KTAFVFGQMNEPPGAR
ATPB_PARUW       EGNDLWLEMKESGILS----------------------------KTSLVFGQMNEPPGAR
ATPB_PECFR       EGNDLWSEMTESGVIN----------------------------KTALVYGQMNEPPGAR
ATPB_CARHZ       EGNDLYHEMKEAGVLD----------------------------KTIMVFGQMNEPPGVR
ATPB_MOOTA       EGNDLYLEMKESGVLE----------------------------KTALVFGQMNEPPGAR
ATPB_DESHY       EGNDLWNEMRESGVID----------------------------KMAMVFGQMNEPPGAR
ATPB_CLOAB       EGNDLYYEMKDSGVIN----------------------------KTALVFGQMNEPPGAR
ATPB_CLOPE       EGNDLYYEMMESGVIK----------------------------NTALVFGQMNEPPGAR
ATPB_BACTN       EGNDLLREMIESGVIRYGEAFKESMEKGDWDLSKVDYNELE-KSQVSLIFGQMNEPPGAR
ATPB_CELLY       EGNDLLREMLESGIIKYGDDFMHSMEEGGWDLSKVDKSVMK-DSKATFVFGQMNEPPGAR
ATPB_SALRD       EGNDLLREMIEAGVMTYGEEFRESMESGGWDLDKVDFDEMNSESNISLVFGQMNEPPGAR
ATPB_MYCMS       EGNDLYHEFIEAGVLN----------------------------KTCLVFGQMNEPPGAR
ATPB_MESFL       EGNDLYHEFIEAGVLD----------------------------KTSLVFGQMNEPPGAR
ATPB_UREPA       EGNDLYYEMAESDVLD----------------------------KTALVFGQMNEPPGAR
ATPB_MYCGE       EGNDLYYEMIQGGVID----------------------------KTVLVFGQMNEPPGAR
ATPB_MYCPN       EGNDLYYEMIQGGVID----------------------------KTALVFGQMNEPPGAR
ATPB_MYCGA       EGNDLYYEMIEGGVID----------------------------KTALVFGQMNEPPGAR
ATPB1_MYCPU      EGNDLYHEMIASGVLD----------------------------KTTLVFGQMNEPPGAR
ATPB_MYCS5       EGNDLYYEMKAAGVLD----------------------------KTALVFGQMNEPPGAR
ATPB_MYCMO       EGNDLYYEMKASGVLD----------------------------KTALVFGQMNEPPGAR
ATPB_MYCHJ       EGNDLYFEMKKAGVLD----------------------------KTALVFGQMNEPPGAR
ATPB_STAHJ       EGNDLYYEMRDSGVIK----------------------------KTAMVFGQMNEPPGAR
ATPB_STAS1       EGNDLYYEMSDSGVIK----------------------------KTAMVFGQMNEPPGAR
ATPB2_LISIN      EGNDLYFEMKDSGVIE----------------------------KTAMVFGQMNEPPGAR
ATPB_GEOSE       EGNDLYHEMKDSGVIS----------------------------KTGMVFGQMNEPPGPR
ATPB_BACSU       EGNDLFYEMSDSGVIN----------------------------KTAMVFGQMNEPPGAR
ATPB_BACMQ       EGNDLYHEMTDSGVIK----------------------------KTAMVFGQMNEPPGAR
ATPB_BACCR       EGNDLYHEMSDSGVIK----------------------------KTAMVFGQMNEPPGAR
ATPB_BACHD       EGNDLYHEMSDSGVIK----------------------------KTAMVFGQMNEPPGAR
ATPB_BACSK       EGNDLYHEMKDAGVIT----------------------------KTAMVFGQMNEPPGAR
ATPB_OCEIH       EGNDLYYEMSDSGVIA----------------------------KTAMVFGQMNEPPGAR
ATPB_STRMU       EGNDLYWEMKESGVIE----------------------------KTAMVFGQMNEPPGAR
ATPB_STRR6       EGNDLYWEMKESGVIE----------------------------KTAMVFGQMNEPPGAR
ATPB_ENTHA       EGNDLYYEMKDSGVIE----------------------------KTAMVFGQMNEPPGAR
ATPB_LACLA       EGNDLYWEMKESGVIE----------------------------KTAMVFGQMNEPPGAR
ATPB_LACAC       EGNDLYFEMKASGVLS----------------------------KTAMVFGQMNEPPGAR
ATPB_LACDA       EGNDLYFEMKASGVLD----------------------------KTAMVFGQMNEPPGAR
ATPB_LACJO       EGNDLYFEMKASGVLS----------------------------KTAMVFGQMNEPPGAR
ATPB_LACCA       EGNDLYFEMKESGVME----------------------------NTAMVFGQMNEPPGAR
ATPB_LACSS       EGNDLYFEMKESGVLE----------------------------KTAMVFGQMNESPGAR
ATPB_LACPL       EGNDLYFEMKASGVLK----------------------------NTAMVYGQMNEPPGAR
ATPB_LACS1       EGNDLYFEMKESGVLE----------------------------KTAMVFGQMNEPPGAR
ATPB_RUBXD       EGTALYGEMEEAGVLK----------------------------NTALIFGQMNEPPGAR
ATPB2_PELCD      EGEELFREMREAGVLD----------------------------NTVMVFGQMNEPPGAR
ATPB2_MYCPU      EAKELYDELVNSSLIK----------------------------STSLFISQMNEPSGSR
                 *.     *:                                      :  .** * .. *

ATPB_TROWT       LRVALSALTMAEYFRDVQ------KQDVLLFIDNIFRFTQAGSEVSTLLGRIPSAVGYQP
ATPB_LEIXX       LRVALSALTMAEYFRDVQ------KQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_BIFLO       LRVPLTALTMAEYFRDVQ------NQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_CUTAK       LRIALTGLTMAEYFRDVQ------NQDVLLFIDNIFRFSQAGSEVSTLLGRMPSAVGYQP
ATPB_THEFY       LRVALSALTMAEYFRDVQ------KQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_STRAW       LRVALAGLTMAEYFRDVQ------KQDVLFFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_FRACC       LRVALGALTMAEYFRDVQ------KQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_CORJK       MRVALSGLTMAEYFRDVQ------NQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_CORGL       MRVALSGLTMAEYFRDVQ------NQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_RHOJR       MRVALSALTMAEYFRDVQ------GQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_MYCLE       MRVALSALTMAEWFRDEA------SQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_FERIS       FRVALTALTIAEYFRDV------EGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_THEMA       FRVALTALTIAEYFRDV------EGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_AQUPY       FRVAHTGLTMAEYFRDV------EGQDVLIFIDNIFRFVQAGSEVSTLLGRLPSAVGYQP
ATPB_NITWN       ARVALSGLTVAEHFRD-------QGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_BRADU       ARVALTGLTIAEDFRD-------KGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RHILO       ARVGLTGLTVAEYFRD-------QGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_AGRFC       ARVALTGLTIAENFRD-------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_MAGSA       ARVALSGLTVAEYFRDV------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_PELUB       ARVALTGLTVAEYFRDQ------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RHORT       ARVALAGLTQAEYFRDE------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RUEPO       ARVALTGLTLAEQFRDQ------SGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RUEST       ARVALTGLTLAEQFRDQ------SGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_ROSDO       MRVALTGLTLAEQFRDQ------SGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_JANSC       MRIALSGLTLAEQFRDA------TGADVLFFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RHOCA       ARVALTGLTLAEQFRDQ------SGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB1_RHOS4      ARVALTGLTLAEQFRDQ------SGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RHOBL       ARVALTGLTLAEQFRDQ------SGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_NOVAD       ARVALSGLTMAEYFRDQ------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_ZYMMO       ARVALSGLTMAEYFRDQ------EGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQP
ATPB1_GLUOX      SRVALTGLSLAEYFRDE------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RICTY       ARVALSGLTIAESFRDMN-----AGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQP
ATPB_RICBR       ARVALTGLTVAESFRDMN-----EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_ANAMM       MRVALTALTMAEYFRDS------EGQDVLFFVDNVFRFTQSGSEVSALLGRIPSAVGYQP
ATPB_ANAPZ       MRVALSALTMAEYFRDA------EGQDVLFFVDNVFRFTQSGSEVSALLGRVPSAVGYQP
ATPB_EHRCJ       LRVALSALTMAEYFRDS------ENQDVLFFVDNIFRFTQSGSEISALLGRIPSAVGYQP
ATPB_EHRCR       LRVALSALTMAEYFRDA------ENQDVLFFVDNIFRFTQSGSEISALLGRIPSAVGYQP
ATPB_EHRRW       LRVALSALTMAEYFRDV------ENQDVLFFVDNIFRFTQSGSEISALLGRIPSAVGYQP
ATPB_WOLTR       ARVALTALTMAEYFRDH------ENQDVLFFVDNIFRFTQAGSEISALLGRMPSAVGYQP
ATPB_NEOSM       AKVAMSALTMAEYFRDK------EGQDVLFFVDNIFRFTQAGAELSTLLGRIPSAVGYQP
ATPB_CAMJR       NRIALTGLTMAEYFRDE------MGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQP
ATPB_SULDN       NRIALTGLTMAEYFRDE------KGLDVLMFVDNIFRFAQSGSEMSALLGRIPSAVGYQP
ATPB_HELHP       NRIAFTGLTMAEYFRDE------KGLDVLMFIDNIFRYAQSGSEMSALLGRIPSAVGYQP
ATPB_WOLSU       NRIAFTGLTMAEYFRDE------KGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQP
ATPB_HELPJ       NRIAFTGLTMAEYFRDE------KGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQP
ATPB_DESPS       ARVALTGLTAAEYFRDE------EGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_SYNAS       ARVSLTALAAAEYFRDV------EGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_DESAG       ARVALTALACAEYFRDE------ENQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_DESVH       ARVALTALACAEYFRDV------ENQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_LAWIP       SRVALTALTCAEYFRDE------EHQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQP
ATPB_MYXXD       ARVALSALTMAEYFRDV------EGRDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_STIAU       ARVALSALTIAEYFRDM------EGHDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_ANADE       ARVALSALTVAEYFRDV------ENRDMLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_GEOSL       ARVALSALSIAEYFRDE------EGQNVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_BDEBA       ARVALTGLTVAEYFRDV------ENQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQP
ATPB_CHLP8       ARVALTGLSIAEYFRDE------EGRDVLLFIDNIFRFTQAGAEVSALLGRMPSAVGYQP
ATPB_KORVE       LRVALTALTVAEYFRDE------EGTDTLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQP
ATPB_OENEH       MRVGLTALTMAEYFRDV------NKQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_ORYSA       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PEA         MRVGLTALTMAEYFRDV------NEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CUSRE       MRVGLTALTMAEYFRDV------NEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CUSPE       MRVGLTALTMAEYFRDV------NRQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PTEAQ       MRVGSTASTMAEYFRDV------NKQDVLPFIDNILRFVQAGSEVSALLGRMPSAVGYQP
ATPB_HUPLU       MRVGLTALTMAEYFRDV------NKQDVLLFIDNILRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PSINU       MRVGLTALTIAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_STAPU       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_ZYGCR       MRVGLTALTMAEYFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CHAVU       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PINKO       MRVGLTALTMAEYFRDV------NEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_MESVI       MRVGLTALTMAEYFRDV------NNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CHLRE       MRVALTALTMAEYFRDV------NKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQP
ATPB_TETOB       MRVALTALTMAEYFRDV------NKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQP
ATPB_TUPAK       MRVGLTALTMAEYFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CHLVU       MRVGLTALTMAEFFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_OLTVI       MRVGLTALTMAEYFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_NEPOL       MRVGLTALTMAEYFRDV------NNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_OSTTA       MRVGLTALTMAEYFRDV------NNQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_EUGGR       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PROWI       MRVGLTALTMAEYFRDV------SSQDVLLFIDNIFRFLQAGSEVSALLGRLPSAVGYQP
ATPB_CYAPA       MRVALTALTMAEYFRDV------NNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_GUITH       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_TRICV       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_PYRYE       MRVGLTALTMAEYFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_GRATL       MRVGLTALTMAEYFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CYAM1       MRVGLTALTMAEHFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_GALSU       MRVGLTALTMAEYFRDN------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_EMIHU       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_OCHNE       MRVGLTALTMAEYFRDV------NKQDVLLFIDHIFRFVQAGSEVSALLGSMPSAVGYQP
ATPB_PYLLI       MRVGLTALTMAEYFRDI------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_DICDH       MRVGLTALTMAEYFRDI------NRQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_CYACA       MRVGLTALTMAEYFRDV------NKQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_TRIV2       MRVGLSGLTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_SYNP1       MRVGLSGLTMAEYFRDV------NKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PRODI       MRVGLSALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_SYNY3       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PROMM       MRVGLSALTMAEHFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_SYNS9       MRVGLSALTMAEHFRDV------NKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PROMP       MRVGLSALTMAEHFRDV------NKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_SYNE7       MRVGLSALTMAEHFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_SYNJA       MRVGLTALTMAEYFRDV------NKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_GLOVI       MRVGLTALTMAEYFRDV------SKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_LEPIC       LRVALSALTMAEHFRDS------IGTDVLLFVDNIFRFSQAGSEVSALLGRMPSAVGYQP
ATPB_FUSNN       LRVALTGLTVAENFRDK------DGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_PROMO       LRVGLTGLTMAENFRDK------EGQDVLFFVDNIFRFTQAPSEVSALLGRMPSAVGYQP
ATPB1_RHOFT      LRVALTGLTIAESFRDE-------GKDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQP
ATPB2_PARXL      LRVALTGLTMAEHFRDE-------GLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQP
ATPB1_NITMU      LRVALTGLTMAEHFRDE-------GRDVLLFVDNIYRFTLAGTEVSALLGRMPSAVGYQP
ATPB_NITEU       LRVALTGLTMAEAFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_CUPPJ       LRVALSGLTMAEKFRDE-------GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_BORA1       LRVALTGLTMAEKFRDE-------GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_AROAE       LRVALTGLTMAERFRDE-------GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_DECAR       LRVALTGLTMAERFRDD-------GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_METFK       LRVALTGLTMAERFRDE-------GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_NEIMA       LRVALTGLTMAEYFRDEKD-ENGKGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_CHRVO       LRVALTGLTMAEHFRDEKD-ENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_PSYCK       LRVALSGLTMAEYFRDTKDPATGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_ACIAD       LRVALTGLTMAEYFRDQKD-ENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_XANC5       LRVALTGLTMAEYFRDEKD-ASGKGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_XYLFT       LRVALTGLTMAEYFRDEKD-SSGKGKDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_ALCBS       LRVALTGLTMAEKFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_HAHCH       LRVALTGLTMAEKFRDE-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_SACD2       LRVALTGLTMAEKFRDE-------GKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_CHRSD       LRVALTGLTIAEKFRDD-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_PSESM       LRVALTGLTMAEKFRDE-------GNDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_PSEHT       LRVALTGLTMAEKFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_COLP3       LRVAFTGLTMAEKFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_IDILO       LRVALTGLTIAEKFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_SHEON       LRVALTGLTMAEKFRDE-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_PASMU       LRVALTGLTMAEKFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_MANSM       LRVALTGLTMAEKFRDE-------GRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_ECOLI       LRVALTGLTMAEKFRDE-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_METCA       LRVALTGLTIAEKFRDE-------GRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_NITOC       LRVALTGLTMAEFFREE-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_LEGPH       LRVALTGLTMAEKFRDE-------GRDVLLFIDNIYRYTLAGVEVSALLGRMPSAVGYQP
ATPB_COXBU       LRVGLTGLTLAEAFRDE-------GRDVLLFIDNIFRYTLAGVEVSALLGRMPSAVGYQP
ATPB_FRATT       LRVALSGLTIAEGFRDE-------KRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_THIDA       LRVALTGLTMAEYFRDE-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_ACIFR       LRAGLTGLTMAEHFRDE-------GRDILMFIDNIFRYPLAGTEVSALLGRMPSAVGYQP
ATPB_HYDCU       LRVALTGLTMAEYFRDE-------GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_VIBCH       LRVALTGLTMAEKFRDE-------GRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_ALIF1       LRVALTGLTMAERFRDE-------GRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB1_PHOPR      LRVALTGLTMAERFRDE-------GRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB2_PHOPR      LRVALTGLTIAERFRDE-------GRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_BUCAI       LRVAFTGLTIAEKFRDE-------GKDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_BUCAP       LRVAFTGLTIAEKFRDE-------GRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQP
ATPB_BUCBP       LRVAFTGLTIAEKFRNE-------GHDVLLFIDNIYRYTLAGTEVSALLGRIPSAVGYQP
ATPB_BAUCH       FRVALTGLTIAEKFRDE-------GHDVLLFIDNIYRYTLAGAEVSALLGRMPSAVGYQP
ATPB_BLOFL       LRVALTGLTIAEKFRDE-------GHDVLLFIDNIYRYTLAGTEVSALLGRVPSAVGYQS
ATPB_BLOPB       LRVALTGLTMAEKFRDE-------GHDVLLFIDNIYRYTLAGTEVSALLGRIPSAVGYQS
ATPB_WIGBR       LRVALTGLTLAEKFRDE-------GNDVLFFVDNIYRYTLAGTEVSALLGRIPSAVGYQP
ATPB_HERAU       LRVALSALTMAEYFREE-------GRDVLLFVDNIFRFTQAGSEVSALLGRMPSQVGYQP
ATPB_RHOBA       LRVALSALTMAEYFRDTT------GADTLLFVDNIFRFSQAGSEVSALLGRMPSAVGYQP
ATPB_DEHMC       LRIALTGLTMAEYFRDEE------RQDVLLFIDNIYRYTLAGMEVSALLGRMPSAVGYQP
ATPB_ACEWD       MRIALAGLTMAEYFRDD------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_SYMTH       MRVALTGLTMAEYFRDE------QGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_CALS4       MRVGLAGLTIAEYFRDE------EHQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PARUW       MRVGLTGLTMAEHFRDQ------EHQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_PECFR       MRVALTGLTMAEYFRDV------QHQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQP
ATPB_CARHZ       LRVGLTGLTMAEYFRDE------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MOOTA       LRVGLTGLTMAEYFRDA------EGQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
ATPB_DESHY       LRVGLTGLTMAEYFRDV------QNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_CLOAB       MRVALTGLTMAEYFRDKGQ-------DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_CLOPE       MRVALTGLTMAEYFRDQGQ-------DVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQP
ATPB_BACTN       ASVALSGLTVAESFRDAGKEGE--KRDILFFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_CELLY       ARVALSGLTIAEYFRDGAGEGQ--GKDVLFFVDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_SALRD       ARVGLTGLTIAEYFRDLGG------RDVLFFLDNIFRFVQAGQEMSALMGRMPSAVGYQP
ATPB_MYCMS       MRVALTGLTIAEYFRDQKN------MDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MESFL       MRVALTGLTIAEHFRDEKN------MDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_UREPA       MRVALSGLTMAEEFRDAFG------QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MYCGE       MRVALTALTMAEYFRDHDN------QNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MYCPN       MRVALTALTMAEYFRDHDN------QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MYCGA       MRVALTGLTMAEYFRDVNN------QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB1_MYCPU      MRVALTGLTMAEYFRDKFK------QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MYCS5       MRVALTGLTMAEYFRDKQN------QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_MYCMO       MRVALSGLTMAEYFRDELN------QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_MYCHJ       MRVALSALTMAEYFRDYEN------QDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQP
ATPB_STAHJ       MRVALSALTMAEYFRDE------QGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_STAS1       MRVALSGLTMAEHFRDV------QGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB2_LISIN      MRVALTGLTIAEYFRDE------EHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_GEOSE       MRVALTGLTMAEYFRDE------QGQDVLLFIDNNFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_BACSU       MRVALTGLTMAEHFRDV------QGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_BACMQ       QRVALTGLTMAEYFRDE------QGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_BACCR       QRVALTGLTMAEHFRDE------QGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_BACHD       MRVALSGLTMAEYFRDK------QGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_BACSK       MRVALTGLTMAEYFRDE------QGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_OCEIH       MRVALTGLTMAEYFRDE------QGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_STRMU       MRVALTGLTIAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_STRR6       MRVALTGLTIAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_ENTHA       MRVALTGLTIAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_LACLA       MRVALTGLTIAEYFRDV------QGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_LACAC       MRVALTGLTLAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_LACDA       MRVALTGLTIAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_LACJO       MRVALTGLTIAEYFRDV------EGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_LACCA       MRVALTGLTIAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_LACSS       MRVALTGLTIAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
ATPB_LACPL       MRVALTGLTIAEYFRDV------QGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_LACS1       MRVALTGLTLAEYFRDV------EGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP
ATPB_RUBXD       FRVGLTGVTIAEYFRDV------LGQDVLFFLDNIFRFAQAGNEVSALMGRMPSEVGYQP
ATPB2_PELCD      FRVGLTALTMAEYFRDD------QGRDVLLLIDNIFRFIQAGMEISGLLGLMPSRLGYQP
ATPB2_MYCPU      MKILPVGITAAEYARDS------EQKDVLFFVDNIYRYLQAGRELSFSLGKKPSEAGYQA
                       . : **  *:          : * ::*:  *:  :  *:*  :*  **  ***.

ATPB_TROWT       NLADEMGVLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSREIASKG
ATPB_LEIXX       NLADEMGLLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSREIASKG
ATPB_BIFLO       NLADEMGSLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSRDIASKG
ATPB_CUTAK       NLADEMGQLQERITSTRGHSITSMQAVYVPADDYTDPAPATTFAHLDATTELSREIASRG
ATPB_THEFY       NLADEMGLLQERITSTRGHSITSMQAIYVPADDYTDPAPATTFAHLDATTELSRPISQKG
ATPB_STRAW       NLADEMGLLQERITSTRGHSITSMQAIYVPADDLTDPAPATTFAHLDATTVLSRPISEKG
ATPB_FRACC       TLADEMGVLQERITSTRGHSITSLQAIYVPADDLTDPAPATTFTHLDATTVLDRAISDLG
ATPB_CORJK       TLADEMGVLQERITSTKGRSITSLQAVYVPADDYTDPAPATTFAHLDATTELDRSIASKG
ATPB_CORGL       TLADEMGVLQERITSTKGRSITSLQAVYVPADDYTDPAPATTFAHLDATTELDRSIASKG
ATPB_RHOJR       TLADEMGELQERITSTRGRSITSLQAIYVPADDYTDPAPATTFAHLDATTELSRPISQMG
ATPB_MYCLE       TLADEMGELQERITSTRGRSITSMQAVYVPADDYTDPAPATTFAHLDATTELSRSVFAKG
ATPB_FERIS       TLSTDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATIVLSRQLAALG
ATPB_THEMA       TLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELG
ATPB_AQUPY       TLNTDVGEVQERITSTKKGSITAIQAVYVPADDITDPAPWSIFAHLDATTVLTRRLAELG
ATPB_NITWN       TLATDMGALQERITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEKG
ATPB_BRADU       TLATDMGALQERITTTQKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLSRSIAEKG
ATPB_RHILO       TLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLNRAIAEKG
ATPB_AGRFC       TLATDMGQMQERITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRSIAEKG
ATPB_MAGSA       TLATDMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRQIAELG
ATPB_PELUB       TLATDMGNLQERITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEIG
ATPB_RHORT       TLATDMGALQERITSTKKGSITSVQAIYVPADDLTDPAPAASFAHLDATTTLNRSIAELG
ATPB_RUEPO       TLATDMGAMQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRAISELG
ATPB_RUEST       TLATDMGAMQERITSTKNGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLNRAISELG
ATPB_ROSDO       TLATDMGAMQERITSTKAGSITSVQAVYVPADDLTDPAPATSFAHLDATTVLSRAISELG
ATPB_JANSC       TLATDMGTMQERITSTKRGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRAISELG
ATPB_RHOCA       TLATDMGALQERITSTKAGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRAISELG
ATPB1_RHOS4      TLATDMGALQERITSTKAGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRAISELG
ATPB_RHOBL       TLATDMGQLQERITSTKAGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLSRAISELG
ATPB_NOVAD       TLATDMGQLQERITSTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLNRAISELG
ATPB_ZYMMO       TLATDMGQLQERITSTKKGSITSVQAIYVPADDLTDPAPAASFAHLDATTVLSRAISEMG
ATPB1_GLUOX      TLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPAATFAHLDATTVLNRSIAEMG
ATPB_RICTY       TLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPSTSFAHLDATTVLSRQIAELG
ATPB_RICBR       TLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELG
ATPB_ANAMM       TLAAEMGAMQERITSTNTGSITSVQAIYVPADDLTDPAPAASFAHLDSTTVLSRQISELG
ATPB_ANAPZ       TLASEMGAMQERITSTHKGSITSVQAIYVPADDLTDPAPSTSFLHLDSTTVLSRQISELG
ATPB_EHRCJ       TLAAEMGAMQERITSTNNGSITSVQAIYVPADDLTDPAPATSFAHLDSTTVLSRQISELG
ATPB_EHRCR       TLAAEMGAMQERITSTNSGSITSVQAIYVPADDLTDPAPATSFAHLDSTTVLSRQISELG
ATPB_EHRRW       TLAAEMGAMQERITSTNRGSITSVQAIYVPADDLTDPAPATSFAHLDSTTVLSRQIAELG
ATPB_WOLTR       TLATDMGAMQERIASTTSGSITSVQAIYVPADDLTDPAPAATFSHLDSTTVLSRQIAEMG
ATPB_NEOSM       TLATDMGRLQERITSTKNGSITSVQAIYVPADDITDPAPATSFAHLDSTTVLSRQVAEAG
ATPB_CAMJR       TLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKG
ATPB_SULDN       TLAREMGALQDRITSTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKG
ATPB_HELHP       TLAGEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLDRKISEKG
ATPB_WOLSU       TLASEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKG
ATPB_HELPJ       TLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKG
ATPB_DESPS       TLATDLGALQERITSTNKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQISELG
ATPB_SYNAS       TLATDLGELQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRPIAELG
ATPB_DESAG       TLGTDLGGLQERITSTTKGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELG
ATPB_DESVH       TLGTDLGALQERITSTTKGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELG
ATPB_LAWIP       TLGTDLGSLEERITSTHNGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELG
ATPB_MYXXD       TLATEMGGLQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRSIAELA
ATPB_STIAU       TLSTEMGALQERITSTTKGSVTSVQAIYVPADDLTDPAPATTFAHLDATTVLNRAISELG
ATPB_ANADE       TLSTEMGELQERITSTQKGAITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRKLTEIG
ATPB_GEOSL       TLATEMGELQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELG
ATPB_BDEBA       TLATEMGTLQERITSTKKGSITSVQAVYVPADDYTDPAPATTFTHLDATTNLDRDIAAMA
ATPB_CHLP8       TLGTEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELG
ATPB_KORVE       NLATEMGELQERITSTKRGSVTSVQAIYVPADDLTDPAPATTFAHLDATTVLSRALTEIG
ATPB_OENEH       TLSTEMGSLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_ORYSA       TLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_PEA         TLGTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_CUSRE       TLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_CUSPE       TLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRSLAAKG
ATPB_PTEAQ       TLGTEMGSSQERITSTKDGSITSIQAVYVPADDLTDPAPATTSAHLDATTVLSRGLAAKG
ATPB_HUPLU       TLGTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_PSINU       TLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_STAPU       TLGTEMGGLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_ZYGCR       TLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_CHAVU       TLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_PINKO       TLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_MESVI       TLSREMGTLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_CHLRE       TLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_TETOB       TLATEMGALQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_TUPAK       TLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_CHLVU       TLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLASKG
ATPB_OLTVI       TLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_NEPOL       TLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_OSTTA       TLSTEMGSLQERITSTKTGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_EUGGR       TLATEMGGLQERITSTKVGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLASKG
ATPB_PROWI       TLASEMGALQERITSTKDGSITSIQAVYIPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_CYAPA       TLGTEMGSLQERITSTTKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_GUITH       TLATEMGSLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFSHLDATTVLSRNLAAKG
ATPB_TRICV       TLATEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKG
ATPB_PYRYE       TLATEMGALQERITSTTEGSITSIQAVYVPADDLTDPVPATTFAHLDATTVLSRNLAAKG
ATPB_GRATL       TLATEMGTLQERITSTTDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRSLAAKG
ATPB_CYAM1       TLATEMGALQERITSTVDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_GALSU       TLATEMGALQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_EMIHU       TLATEMGVLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_OCHNE       TLATEMGVLQERITSTNEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_PYLLI       TLGTEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_DICDH       TLGTEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKG
ATPB_CYACA       TLGTEMGALQERITSTLDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRALAAKG
ATPB_TRIV2       TLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKG
ATPB_SYNP1       TLGTDVGALQERITSTMEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKG
ATPB_PRODI       TLGTDVGDLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKG
ATPB_SYNY3       TLGTDVGDLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKG
ATPB_PROMM       TLGTDVGALQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKG
ATPB_SYNS9       TLGTDVGTLQERVASTVEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLNRALASKG
ATPB_PROMP       TLGTDVGALQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARGLAAKG
ATPB_SYNE7       TLGTDVGQLQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
ATPB_SYNJA       TLATEMGNLQERITSTKQGSITSVQAVYVPADDLTDPAPATTFAHLDSTVVLSRSLAAKG
ATPB_GLOVI       TLGTEMGDLQERITSTNEGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQLASLG
ATPB_LEPIC       TLSTEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPANAFAHLDATTVLSRAISDKG
ATPB_FUSNN       NLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLG
ATPB_PROMO       NLATDMGALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLG
ATPB1_RHOFT      TLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLG
ATPB2_PARXL      TLAEEMGKLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLG
ATPB1_NITMU      TLAEEMGRLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLG
ATPB_NITEU       TLAEEMGRLQERITSSKTGSITSIQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLG
ATPB_CUPPJ       TLAEEMGKLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFLHLDSTLVLSRDIAALG
ATPB_BORA1       TLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFQHLDSTVVLSRDIAALG
ATPB_AROAE       TLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALG
ATPB_DECAR       TLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIASLG
ATPB_METFK       TLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALG
ATPB_NEIMA       TLAEEMGCLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLG
ATPB_CHRVO       TLAEEMGRLQERITSTKDGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLG
ATPB_PSYCK       TLAEEMGMLQERITSTQSGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASQG
ATPB_ACIAD       TLAEEMGVLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSG
ATPB_XANC5       TLAEEMGVLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDSTVTLSRNIASLG
ATPB_XYLFT       TLAEEMGVLQERITSTANGSITSIQAVYVPADDLTDPSPATTFGHLDSTVTLSRSIAALG
ATPB_ALCBS       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVSLSRDIASKG
ATPB_HAHCH       TLAEEMGVLQERITSTKVGSITSVQAVYVPADDLTDPSPATTFSHLDATVVLSRDIAAKG
ATPB_SACD2       TLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIAAKG
ATPB_CHRSD       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATVVLARSIAELG
ATPB_PSESM       TLAEEMGTLQERITSTKNGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLG
ATPB_PSEHT       TLAEEMGVLQERIASTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLG
ATPB_COLP3       TLAEEMGVLQERITSTNKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASQG
ATPB_IDILO       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLNRDIASLG
ATPB_SHEON       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLG
ATPB_PASMU       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLG
ATPB_MANSM       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLG
ATPB_ECOLI       TLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLG
ATPB_METCA       NLAEEMGILQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELG
ATPB_NITOC       TLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELG
ATPB_LEGPH       TLAEEMGMLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELG
ATPB_COXBU       TLAEEMGALQERITSTKKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAERG
ATPB_FRATT       TLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELG
ATPB_THIDA       TLADEMGRLQERITSTKTGSITSFQAVYVPADDLTDPSPATTFAHLDATLVLSRQVAELG
ATPB_ACIFR       TLAEEMGQLQERITSTKVGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELG
ATPB_HYDCU       TLSQEMGQIQERITSTKTGSITSIQAVYVPADDLTDPAPATTFAHLDATVVLNRSIAETG
ATPB_VIBCH       TLAEEMGVLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLNRNIAAMG
ATPB_ALIF1       TLAEEMGVLQERITSTKQGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLNRNIAAMG
ATPB1_PHOPR      TLAEEMGVLQERITSTKSGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLG
ATPB2_PHOPR      TLAEEMGVLQERITSTHKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRNIAALG
ATPB_BUCAI       TLAEEMGLLQERITSTKNGSITSVQAVYVPADDLTDPSPATTFAHLDSTVTLSRQIASLG
ATPB_BUCAP       TLAEEMGLLQERITSTKEGSITSVQAVYVPADDLTDPSPATTFAHLDSTVTLSRQIAALG
ATPB_BUCBP       TLSEEMGVLQERITSTNKGSITSIQAVYVPADDLTDPSPATTFSHLDSTITLSRQIVSLG
ATPB_BAUCH       TLSEEMGLLQERITSTKYGSITSIQAVYVPADDLTDPAPATTFSHLDATIVLSRQIASLG
ATPB_BLOFL       TLSEEMGMLQERIASTKSGSITSVQAIYVPADDLTDPSPTTTFAHLDATIVLSRQIAALG
ATPB_BLOPB       TLSEEMGILQERITSTSLGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAALG
ATPB_WIGBR       TLSEEMGILQERITSTKSGSITSVQAIYVPADDLTDPSPATTFVHLDATVVLSRQIASLG
ATPB_HERAU       TLGTEMGELQERITSTKTGSITSLQAVYVPADDYTDPAPATTFAHLDATISLERSISEKG
ATPB_RHOBA       TLATEMGALQERITSTKQGAITSVQAVYVPADDPTDPAPATAFGQLDAFIYLERSISEKG
ATPB_DEHMC       TLATEMGALQERIASTKQGSITSFQAVYVPADDYTDPGVVATFGHLDAMIALERSLAEQA
ATPB_ACEWD       TLATEMGALQERITSTSKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAITEKG
ATPB_SYMTH       TLATEMGYLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAVFEKA
ATPB_CALS4       TLATEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRSIAEMG
ATPB_PARUW       TLASEIGSLQERITSTKHGSITSVQAIYVPADDYTDPAPASIFPHLDAATTLSRQIAELG
ATPB_PECFR       TLTTDVGALQERITSTKKGSITSVQAVYVPADDLTDPGPAATFTHLDATTVLSRQIAELG
ATPB_CARHZ       TLATEMGQLQERITSTRKGSITSVQAVYVPADDLTDPAPATTFAHLDATVVLSRQIAELG
ATPB_MOOTA       TLATEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELG
ATPB_DESHY       TLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKG
ATPB_CLOAB       TLANEMGALQERITSTKQGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSREISNLG
ATPB_CLOPE       TLATEMGALQERITSTTHGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLSRSIAEIG
ATPB_BACTN       TLATEMGAMQERITSTRKGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLDRKITELG
ATPB_CELLY       TLATEMGAMQERITSTKRGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIAELG
ATPB_SALRD       TLASEMGDLQERITSTQEGSITSFQAVYVPADDLTDPAPATTFAHLDCTTVLSRQLSTQG
ATPB_MYCMS       TLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLG
ATPB_MESFL       TLSTEMGSLQERITSTNKGSITSVQAVYVPADDLTDPAPATTFTHLDAKIVLDRSIASLG
ATPB_UREPA       TLAFEMGQLQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKVVLDRAIASLG
ATPB_MYCGE       TLAIEMGKLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALG
ATPB_MYCPN       TLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALG
ATPB_MYCGA       TLAEEMGSLQERITSTKSGSITSVQAIYVPADDLTDPAPSTTFTHLDAKTVLDRNIASLG
ATPB1_MYCPU      TLATEMGQLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLERNIAALG
ATPB_MYCS5       TLATEMGALQERITSTRSGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLDRNVAALG
ATPB_MYCMO       TLATEMGQLQERITSTRKGSITSIQAVYVPADDLTDPAPATTFIHLDAQTVLDRNIASLG
ATPB_MYCHJ       TLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALG
ATPB_STAHJ       TLATEMGQLQERITSTNKGSVTSIQAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMG
ATPB_STAS1       TLATEMGQLQERITSTTKGSVTSIQAVFVPADDYTDPAPAAVFAHLDATTNLERKLTEMG
ATPB2_LISIN      TLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQG
ATPB_GEOSE       TLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMG
ATPB_BACSU       TLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMG
ATPB_BACMQ       TLATEMGQLQERITSTSVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMG
ATPB_BACCR       TLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMG
ATPB_BACHD       TLATEMGQLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMG
ATPB_BACSK       TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQG
ATPB_OCEIH       TLATEMGQLQERITSTDKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLDRKLSEQG
ATPB_STRMU       TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERRLTQMG
ATPB_STRR6       TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLG
ATPB_ENTHA       TLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQG
ATPB_LACLA       TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMG
ATPB_LACAC       TLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPSTTFAYLDATTNLERSLVEQG
ATPB_LACDA       TLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAYLDATTNLERSLVEQG
ATPB_LACJO       TLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQG
ATPB_LACCA       TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPRTTFAHLDATTNLERRLTEQG
ATPB_LACSS       TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLDRKLTQQG
ATPB_LACPL       TLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTEQG
ATPB_LACS1       TLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQG
ATPB_RUBXD       TLGTEMGALQERITSTKKGSITSFQAVYVPADDPTDPAPFTVFAHLDSTVELSRSLFEQA
ATPB2_PELCD      TMGTELAELQERISSTRHAAITSIQAVYVPADDFTDPAAVHTFSHLSASIVLSRRRASEG
ATPB2_MYCPU      TLVSDISSVQERLANSKHGSITSFQTVFLPMDDLNDPASVAILNHLDSSLVLSREIFAEG
                 .:  ::.  ::*: .:   ::*:.* :: * ** .**        *.    * *     .

ATPB_TROWT       LYPAVDPLASTSRILDPKYIGKDHYRVAVTVKQILQRDKELREIIAILGIDELSEEDRVT
ATPB_LEIXX       LYPAVDPLTSTSRILDPRYLGADHYRVATTVKQILQKNKELQEIIAILGVDELSEEDKIT
ATPB_BIFLO       IYPAVDPLSSTSRILDPRYVGQAHYDCANRVKAILQRNKELQDIIALIGIDELGEEDKTT
ATPB_CUTAK       LYPAVDPLTSTSRILDPLYVGQEHYDTATQVKQILQRNKELQDIIAILGVDELSEEDKVT
ATPB_THEFY       IYPAVDPLTSTSRILDPQYVGQEHYEVAQRVKEILQRNHDLQDQIAILGIDELSEEDKII
ATPB_STRAW       IYPAVDPLDSTSRILDPRYIAQDHYDAAMRVKTVLQKYKDLQDIIAILGIDELGEEDKLV
ATPB_FRACC       IYPAVSPLDSNSRILDARYLGQEHYDTAREVQRILQRYKDLQDIIAILGIDELSEEDKIL
ATPB_CORJK       IYPAVNPLTSTSRILEPGIVGERHYEVAQRVIHILQKNKELQDIIAILGMDELSEEDKIT
ATPB_CORGL       IYPAVNPLTSTSRILEPAIVGERHYEVSQRVIGILQKNKELQDIIAILGMDELSEEDKIT
ATPB_RHOJR       IYPAVDPLTSTSRILEPGIVGAEHFRVANEVKRILQKYKELQDIIAILGMDELQEEDKVL
ATPB_MYCLE       IFPAVDPLASSSTILDPGIVGEEHYRVAQEVIRILQRYKDLQDIIAILGIDELSEEDKQL
ATPB_FERIS       LYPAVDPLDSTSKILDPNIVGKEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLI
ATPB_THEMA       LYPAVDPLDSSSKILDPAIVGREHYEVARGVQEVLQRYKDLQDIIAILGVEELSPEDKLV
ATPB_AQUPY       IYPAIDPLESTSKYLAPEYVGEEHYEVAMEVKRILQRYKELQEIIAILGMEELSEEDKAI
ATPB_NITWN       IYPAVDPLDSTSRMLSPLIVGEEHYQTARLVQQVLQRYKSLQDIIAILGMDELSEEDKLT
ATPB_BRADU       IYPAVDPLDSTSRMLSPLVVGEEHYAVARQVQQVLQRYKALQDIIAILGMDELSEEDKLT
ATPB_RHILO       IYPAVDPLDSTSRMLDPMVVGEEHYAVARQVQSILQRYKSLQDIIAILGMDELSEEDKQT
ATPB_AGRFC       IYPAVDPLDSTSRMLDPMIVGEEHYEVARKVQSTLQRYKSLQDIIAILGMDELSEEDKLT
ATPB_MAGSA       IYPAVDPLDSTSRVLDPRVVGNDHYQTARDVQRILQTYKSLQDIIAILGMDELSEEDKLV
ATPB_PELUB       IYPAVDPLDSTSRILDPRIVGDEHYRVAREVQKILQTYKSLQDIIAILGMDELSEEDKLT
ATPB_RHORT       IYPAVDPLDSTSRALDPLVVGEEHYKVAREVQRVLQTYKSLQDIIAILGMDELSEEDRLV
ATPB_RUEPO       IYPAVDPLDSSSRILDPQVVGEEHYQVARDVQGILQRYKSLQDIIAILGMDELSEEDKLT
ATPB_RUEST       IYPAVDPLDSSSRLMDPQIVGEEHYKVASDVQQILQRYKSLQDIIAILGMDELSEEDKLT
ATPB_ROSDO       IYPAVDPLDSTSRLMDPQVLGEEHYNVARDVQGILQRYKSLQDIIAILGMDELSEEDKLT
ATPB_JANSC       IYPAVDPLDSSSRLMDPTIVGDEHYQVARDVQGILQRYKSLQDIIAILGMDELSEEDKLT
ATPB_RHOCA       IYPAVDPLDSTSRILDPQVVGEEHYQVARDVQGMLQRYKSLQDIIAILGMDELSEEDKLT
ATPB1_RHOS4      IYPAVDPLDSTSRILDPQIVGEEHYNVARAVQGILQRYKSLQDIIAILGMDELSEEDKLS
ATPB_RHOBL       IYPAVDPLDSTSRLMDPQILGEEHYNTARAVQGILQRYKSLQDIIAILGMDELSEEDKLT
ATPB_NOVAD       IYPAVDPLDSTSRVLTPAVVGQEHYETARRVQETLQKYKSLQDIIAILGMDELSEEDKLT
ATPB_ZYMMO       IYPAVDPLDSSSRNLEPRIVGDEHYQTARDVQEILQRYKNLQDIIAILGMDELSEDDRKV
ATPB1_GLUOX      IYPAVDPLDSTSRSLDPKIVGEEHYQVARQVQQTLQTYKGLQDIIAILGMDELSEDDKKI
ATPB_RICTY       IYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLT
ATPB_RICBR       IYPAVDPLDSTSQVLDPMIVGEEHYNVARKVQQILQTYKSLQDIIAILGMDELSEEDKLT
ATPB_ANAMM       IYPAVDPLESTSQALSPEVVGSEHYEVAQEVKRILQTYKSLQDIIAILGMDELSQEDKLL
ATPB_ANAPZ       IYPAVDPLDSTSQALSVDVVGAEHYEVAREVQRILQTYKSLQDIIAILGMDELSQEDKIL
ATPB_EHRCJ       IYPAVDPLDSTSQALSADIVGEEHYEVAKEVQRILQTYKSLQDIIAILGMDELSEDDKLI
ATPB_EHRCR       IYPAVDPLDSTSQALSADVVGKEHYDVAKEVQRILQTYKSLQDIIAILGMDELSEEDKLI
ATPB_EHRRW       IYPAVDPLDSASQALSIDIVGEKHYEVSKEVQRILQTYKSLQDIIAILGMEELSEEDKLI
ATPB_WOLTR       IYPAVDPLDSTSQSLSAEIVGEEHYKVTSEVKRILQTYKSLQDIIAILGMDELSDEDKIT
ATPB_NEOSM       IYPAVDALASSAQILSPEVLGQEHYEVAQKVKGILQSYKSLQDIIAILGMEELSEEDKLT
ATPB_CAMJR       IYPAVDPLDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLV
ATPB_SULDN       IYPAVDPLDSSSRLLDPQILGEEHYNVARGVQQTLQKYKDLQDIIAILGMDELSEDDKNI
ATPB_HELHP       IYPAVDPLGSTSRILDPQIVGEEHHKVATGVQQVLQKYKDLQDIIAILGMDELSEEDKQV
ATPB_WOLSU       IYPAVDPLDSTSRILDPQVVGEDHYKTATGVQQVLQKYKDLQDIIAILGMDELSEEDKRV
ATPB_HELPJ       IYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKT
ATPB_DESPS       IYPAVDPLDSTSRILDPNVIGEEHYDVARGVQVSLQKYKDLQDIIAILGMDELSEEDQQL
ATPB_SYNAS       IYPAVDPLDSTSRILDPIVLGEEHYKVARAVQVTLQKYKDLQDIIAILGMDELSEEDKLT
ATPB_DESAG       IYPAVDPLDSTSRILDPNVVGAEHYSVAREVQMVLQKYKDLQDIIAILGMDELSDEDKQT
ATPB_DESVH       IYPAVDPLDSTSRILDPNVVGVEHYGVARQVQQVLQKYKDLQDIIAILGMDELSDEDKLT
ATPB_LAWIP       IYPAVDPLDSTSRILEPNFVGEEHYTVARGVQKILQKYKELQDIIAILGMDELSDEDKLV
ATPB_MYXXD       IFPAVDPLDSTSRILDPAVIGAEHYGVARKVQGILQRYKELQDIIAILGMDELSEDDKLV
ATPB_STIAU       IYPAVDPLDSTSRILDPNVVGPEHYAVARKVQGILQKYKELQDIIAILGMDELSETDKLT
ATPB_ANADE       IYPAVDPLDSTSRILDPNVVGKEHYAVARAVQETLQRYKDLQDIIAILGMDELSEDDKLT
ATPB_GEOSL       IYPAVDPLDSTSRILDPQVIGEEHYSIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLV
ATPB_BDEBA       IFPAVHPLTSTSRLLDPTVIGEEHYKCARDVQALLQRNRELQDIIAILGMDELSESDKLV
ATPB_CHLP8       IYPAVDPLDSTSRILDPNIIGNDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLV
ATPB_KORVE       IYPAVDPLGSTSRILDPRIVGQEHYDVAQGVKGILQQYKDLQDIIAILGIDELSEDQKLT
ATPB_OENEH       IYPAVDPLDSTSTMLQPRIVGDEHYETAQRVKETLQRYKELQDIISILGLDELSEEDRLT
ATPB_ORYSA       IYPAVDPLDSTSTMLQPRIVGNEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLT
ATPB_PEA         IYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDMIAILGLDEVSEEDRLT
ATPB_CUSRE       IYPAVDPLDSTSMMLQPRLVGEEHYETAQKVKQTLQRYKELQDIIAILGLDELSEEDRLT
ATPB_CUSPE       IYPAVDPLDSTSMMLQPQIVGKQHYKTAQRVKQTLQRYKELQDIIAILGLDELSDDDRLT
ATPB_PTEAQ       IYPAVDPLDSTSTMSQPWIVGEEHYETAQGVKQTSQRYKELQDIIAILGLDELSEEDRQT
ATPB_HUPLU       IYPAVDPSDSTPTMLQPWIVGEQHYETAQEVKQTLQRYKELQDIIAILGLDESSEEDRLT
ATPB_PSINU       IYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKQTLQRYKELQDIIAILGLDELSEEDRLT
ATPB_STAPU       IYPAVDPLDSTSTMLQPWIVGAEHYETAQGVKKTLQRYKELQDIIAILGLDELSEDDRLT
ATPB_ZYGCR       IYPAVDPLDSTSTMLQPWIVGTEHYDTAQGVKQTLQRYKELQDIIAILGLDELSEEDRLV
ATPB_CHAVU       IYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKETLQRYKELQDIIAILGLDELSEEDRLI
ATPB_PINKO       IYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKQTLQRYKELQDIIAIPGLDELSEEDRLI
ATPB_MESVI       IYPAVDPLDSTSTMLQPWIVGEEHYGTAQRVKQTLQRYKELQDIIAILGLDELSEEDRLV
ATPB_CHLRE       IYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLI
ATPB_TETOB       IYPAVDPLDSTSTMLQPWILGEKHYGCAQSVKRTLQRYKELQDIIAILGLDELSEEDRLV
ATPB_TUPAK       IYPAVDPLDSTSTMLQPWIVGEEHYSCAQNVKETLQRYKELQDIIAILGLDELSEEDRKV
ATPB_CHLVU       IYPAVDPLDSTSTMLQPWIVGDQHYQCAQNVKQTLQRYKELQDIIAILGLDELSEEDRLI
ATPB_OLTVI       IYPAVDPLDSTSTMLQPQTLGEEHYGCAQAVKTTLQRYKELQDIIAILGLDELSDEDRLV
ATPB_NEPOL       IYPAVDPLDSTSTMLQPWILGDDHYGTAQRVKQTLQRYKELQDIIAILGLDELSEEDRMI
ATPB_OSTTA       IYPAVDPLDSTSTMLQPWILGDDHYDTAQGVKQTLQRYKELQDIIAILGLDELSEEDRLT
ATPB_EUGGR       IYPAVDPLDSTSTMLQPWIVGEEHYNTAQSVKKTLQRYKELQDIIAILGLDELSEEDRLV
ATPB_PROWI       IYPAVDPLESTSTMLQPWIVGEEHYKCSQNVKQTLQRYKELQDIIAILGLDELSPDDRLI
ATPB_CYAPA       IYPAVDPLDSTSTMLQPGIVGEKHYACAQRVKGILQRYKELQDIISILGLDELSEDDRLA
ATPB_GUITH       IYPAVDPLDSTSTMLQINIVGQEHYSCAQNVKETLQRYKELQDIIAILGLDELSEEDRQI
ATPB_TRICV       IYPAVDPLDSTSTMLQPGIVSGEHYEIAETVKETLQRYKELQDIIAILGIDELSEEDRLT
ATPB_PYRYE       IYPAVDPLDSTSTMLQPGIVGTEHYSTAQEVKSTLQRYKELQDIIAILGLDELSEEDRQT
ATPB_GRATL       IYPAVDPLGSTSTMLQPSIVGSQHYSTAQQIKSTLQRYKELQDIIAILGLDELSEDDRLT
ATPB_CYAM1       IYPAVDPLDSTSTMLQPNIVGEAHYQTASRVKQTLQRYKELQDIIAILGLDELSEEDRLL
ATPB_GALSU       IYPAVDPLDSTSTMLQPQIVGDEHYVTAQRVKENLQRYKELQDIIAILGLDELSEEDRLT
ATPB_EMIHU       IYPAVDPLDSTSTMLQPEIVGAEHYATAQNIKETLQRYKELQDIIAILGLDELSEEDRLT
ATPB_OCHNE       IYPAVDPLDSTSTMLQPEIVGTEHYATAQRIKETLQRYKELQDIIAILGLDELSEDDRLT
ATPB_PYLLI       IYPAVDPLDSTSTMLQPLIVGDEHYKTAQLVKETLQRYKELQDIIAILGIDELSEEDRLV
ATPB_DICDH       IYPAVDPLDSTSTMLQPVIVGSEHYDTAQLVKKTLQRYKELQDIIAILGIDELSEEDRLV
ATPB_CYACA       IYPAVDPLDSTSTMLQPGIVSDEHYTTARKVKETLQRYKELQDIIAILGLDELSEEDRLI
ATPB_TRIV2       IYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLI
ATPB_SYNP1       IYPAVDPLGSTSNMLQPDIVGSEHYQTARAVQATLQRYKELQDIIAILGLDELSEEDRLT
ATPB_PRODI       IYPAVDPLDSTSTMLQAGIVGEDHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLI
ATPB_SYNY3       IYPAVDPLDSTSTMLQPSIVGSEHYDTAREVQSTLQRYKELQDIIAILGLDELSEEDRLT
ATPB_PROMM       IYPAVDPLDSTSTMLQPSVVGDEHYRTARSVQATLQRYKELQDIIAILGLDELSEDDRRT
ATPB_SYNS9       IYPAVDPLDSSSTMLQPAVVGDEHYRTARAVQSTLQRYKELQDIIAILGLDELSEDDRQT
ATPB_PROMP       IYPAVDPLDSTSTMLQPSVVGDEHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLT
ATPB_SYNE7       IYPAVDPLDSTSTMLQPSIVGEEHYRTARAVQSTLQRYKELQDIIAILGLDELSEEDRQT
ATPB_SYNJA       IYPAVDPLDSSSTILQADIVGEEHYNTAQAVKQTLQRYKELQDIIAILGLDELSEEDKLV
ATPB_GLOVI       IYPAVDPLSSTSTMLQPAVVGEEHYNIARGVQSTLQRYKDLQDIIAILGLDELSPEDKLV
ATPB_LEPIC       IYPAVDPLDSTSRVMNAQVLGEEHYLVAREVQRILQRYKDLQDIIAILGMDELSEDDKVL
ATPB_FUSNN       IYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLT
ATPB_PROMO       IYPAVDPLDSTSTALEPQIIGHEHYNTAREVQQILQRYKELQDIIAILGMDELSDEDKVT
ATPB1_RHOFT      IYPAVDPLDSTSRQLDPNVVGQDHYETARAVQGTLQRYKELRDIIAILGMDELAPEDKLT
ATPB2_PARXL      IYPAVDPLDSTSRQIDPNVIGEEHYSITRGVQQTLQRYKELRDIIAILGMDELAPEDKLA
ATPB1_NITMU      IYPAVDPLDSTSRQLDPLVVGEEHYSTARAVQQTLQRYKELRDIIAILGMDELSPEDKLA
ATPB_NITEU       IYPAVDPLDSTSRQLDPLIIGEDHYNTAREVQQTLQRYKELRDIIAILGMDELSPEDKLS
ATPB_CUPPJ       IYPAVDPLDSTSRQMDPQVVGQEHYNVARAVQQTLQRYKELRDIIAILGMDELSPEDKMA
ATPB_BORA1       IYPAVDPLDSSSRQLDPQVVGEEHYQVARGVQQTLQRYKELRDIIAILGMDELSPEDKQA
ATPB_AROAE       IYPAVDPLDSTSRQLDPLVVGEEHYNVARQVQVTLQRYKELRDIIAILGMDELSPEDKLA
ATPB_DECAR       IYPAVDPLDSTSRQLDPQVVGEEHYSVARAVQMNLQRYKELRDIIAILGMDELSPEDKLA
ATPB_METFK       IYPAVDPLDSTSRQLDPQIVGEEHYSVARAVQSTLQRYKELRDIIAILGMDELSPEDKLA
ATPB_NEIMA       IYPAVDPLDSTSRQLDPMVLGQEHYDVARGVQSTLQKYKELRDIIAILGMDELSDEDKLT
ATPB_CHRVO       IYPAVDPLDSTSRQLDPLVVGDEHYTVARGVQSTLQRYKELRDIIAILGMDELSEEDKLV
ATPB_PSYCK       IYPAVDPLDSTSRQLDPLVIGEEHYNVARGVQEVLQRYKELKDIIAILGMDELSEEDKLV
ATPB_ACIAD       IYPAIDPLDSTSRQLDPLVVGQEHYEIARSVQNVLQRYKELKDIIAILGMDELAEEDKLV
ATPB_XANC5       IYPAVDPLDSTSRQMDPLVIGHEHYDTAQRVQQTLQKYKELKDIIAILGMDELSEEDKQS
ATPB_XYLFT       IYPAVDPLDSSSRQMDPLIIGEEHYNTTQRVQQTLQKYKDLKDIIAILGMDELSEDDKLS
ATPB_ALCBS       IYPAIDPLDSTSRQLDPLVIGQEHYDIARGVQTVLQRFKELKDIIAILGMDELSEDDKLI
ATPB_HAHCH       IYPAIDPLDSTSRQLDPLVIGQEHYDVARGVQTVLQRYKELKDIIAILGMDELSEEDKQI
ATPB_SACD2       IYPAIDPLDSSSRQLDPLIIGQEHYDTARGVQSVLQRYKELKDIIAILGMDELSEEDKLT
ATPB_CHRSD       IYPAIDPLDSTSRQLDPLTVGEEHYNTARGVQGVLQRYKELKDIIAILGMDELSDEDKLT
ATPB_PSESM       IYPAVDPLDSTSRQLDPNVIGQEHYDTARGVQYVLQRYKELKDIIAILGMDELSETDKQL
ATPB_PSEHT       IYPAVDPLDSSSRQLDPQVIGQEHYDTARGVQTVLQRYKELKDIIAILGMDELSDEDKQL
ATPB_COLP3       IYPAIDPLDSSSRQLDPLVVGTEHYETARGVQTVLQRYKELKDIIAILGMDELSEEDKQT
ATPB_IDILO       IYPAVDPLDSTSRQLDPQVIGDEHYDTAMGVQEVLQRYKELKDIIAILGMDELSEEDKLS
ATPB_SHEON       IYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDDDKMT
ATPB_PASMU       IYPAVDPLESTSRQLDPLVVGEEHYNVARGVQTTLQRYKELKDIIAILGMDELSEEDKLV
ATPB_MANSM       IYPAVDPLDSTSRQLDPQVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEDDKLV
ATPB_ECOLI       IYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLV
ATPB_METCA       IYPAVDPLDSTSRQLDPLVIGHEHYETTRRVQSTLQRYKELRDIIAILGMDELSENDKLI
ATPB_NITOC       IYPAVDPLDSTSRQLDPLIVGQEHYQVARAVQGNLQRYKELKDIIAILGMDELSEEDKLT
ATPB_LEGPH       IYPAVDPLDSTSRQLDPLIVGQEHYDTARRVQQTLQRYKELKDIIAILGMDELSEEDKRV
ATPB_COXBU       IYPAIDPLDSTSRQLDPLIIGEEHYRVARGVQETLQRYEELKDIIAILGMDELSEDDKRA
ATPB_FRATT       IYPAVDPLDSTSRQLDPLVVGQDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKI
ATPB_THIDA       IYPAVDPLDSTSRILDPQVVGEEHYTVARKVQGTLQKYKELRDIIAILGMDELSPEDKLA
ATPB_ACIFR       IYPALDPLDSFSRQLDPQIVGQEHYDVARSCQKTLQRYKELQDIIAILGMDELSEDDKLL
ATPB_HYDCU       IYPAIDPLDSTSRQLDPLVVGSEHYDTARGVQETLQRYKELKDIIAILGMDELSEEDRSL
ATPB_VIBCH       LYPAIDPLDSTSRQLDPLVVGQEHYDVARGVQATLQRYKELKDIIAILGMDELSEADKQV
ATPB_ALIF1       LYPAIDPLDSTSRQLDPLVVGQEHYDIARGVQSTLQRYKELKDIIAILGMDELSEEDKQV
ATPB1_PHOPR      LYPAIDPLDSTSRMLDPLVVGQEHYDIARGVQSLLQRYKELKDIIAILGMDELSENDKQA
ATPB2_PHOPR      LYPAIDPLDSTSRQLDPLVVGVEHYDVARGVQTVLQRYKELKDIIAILGMDELSEDDKLT
ATPB_BUCAI       IYPAIDPLNSTSRQLDPYIVGDEHYETALGVQSILQRYQELKDIIAILGMDELAEKDKLL
ATPB_BUCAP       IYPAIDPLNSTSRQLDPYIVGDEHYDTARGVQSILQRYQELKDIIAILGMDELSQEDKIL
ATPB_BUCBP       IYPAIDPLNSTSRQLDPRIVGQLHYDVALGVRSILQRYQELKDIIAILGMDELSEDDKIL
ATPB_BAUCH       IYPAIDPLESTSRQLDPLVVGQKHYDVALGVQGILQRYQELKDIIAILGIDELSEDDKMV
ATPB_BLOFL       IYPAVDPLDSYSKQLDPCIVGQEHYDIANNVKSILQRYQELKDIIAILGMDELSEEDKLI
ATPB_BLOPB       IYPSVDPLDSNSQQLNPLIVGQEHYNVARDVKSILQRYQELKDIIAILGMDELSEEDKLI
ATPB_WIGBR       IYPAIDPLDSTSRQLDPLIVGEDHYLVARKIQSILQRYKDLKDIIAILGIDELSEEDKIL
ATPB_HERAU       IYPAVDPLASTSRILDPNIVGEEHYRVATEVQRMLQRYKDLQDIIAILGVEELSDDDKLT
ATPB_RHOBA       IYPAIDPLASNSRILDPQYVGDRHYTIARRVQTILQRYRELQDIIAILGVDELSEEDKTI
ATPB_DEHMC       LYPAVDPLASNSRILDPQVVGEEHYKVARDVQKVLQRYKDLQDVIAILGMEELSEEDKLT
ATPB_ACEWD       IYPAVDPLDSTSRILDPKIVGQEHYETAREVQEILQRYKELQDIIAILGMDELSDADKIT
ATPB_SYMTH       IFPAVDPLDSTSRILDPNIVGREHYEVARGVQKVLQRYKELQDIIAILGMDELSDEDKLI
ATPB_CALS4       IYPAVDPLDSTSRILEPHIVGEEHYYVARKVQEILQRYKELQDIIAILGMEELTEEDRLI
ATPB_PARUW       IYPAVDPLNSSSRILDPHVLGEEHYQVARQVQKVLQRYKDLQDIIAILGIDELSEEDQLT
ATPB_PECFR       IYPAVDPLDSTSRILDPHVIGEDHYEVARGVQAVLQKYKELQDIIAILGMEELSDADKLT
ATPB_CARHZ       IYPAVDPLDSTSRILDPHIVGEEHYQVARGVQRVLQRYKELQDIIAILGMDELSDEDKLI
ATPB_MOOTA       IYPAVDPLDSTSRILDPRVLGEEHYQVARGVQQVLQRYKELQDIIAILGMDELSEEDKLI
ATPB_DESHY       IYPAVDPLDSNSRILSPQIIGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLV
ATPB_CLOAB       IYPAVSPLESTSRILDPRIVGEEHYEVANKVKHILERYQELQDIIAILGVDELSDEDRLL
ATPB_CLOPE       IYPAVDPLDSSSRILDPRVVGEEHYEVASKVKHILERYKELQDIIAILGVDELADEDKLI
ATPB_BACTN       IYPAVDPLASTSRILDPHIVGQEHYDVAQRVKQILQRNKELQDIISILGMEELSEEDKLV
ATPB_CELLY       IYPAVDPLDSTSRILAPEILGKDHYSCAQRVKELLQRYKELQDIIAILGMEELSEEDKMA
ATPB_SALRD       IYPAIDPLDSTSQMLNERALGTEHYETAQDVKEILQRYEELQDIIAILGMDELSDEDKQA
ATPB_MYCMS       IYPAVDPLASSSRVLDPEIVGQEHYDIALRVQIALQKYQDLQSIIAILGMDELSEEDKLI
ATPB_MESFL       IYPAVDPLSSSSRMLDPEIIGEEHYNVALGVQGTLQKYQDLQSIIAILGMDELSAEDKLI
ATPB_UREPA       LYPAISPLQSTSRLLDPLVVGVKHYSVARRVIEILQRFMELQDIIAILGMDELSEEDRQL
ATPB_MYCGE       IFPAINPLESTSRLLDPSVVGINHYKVALGVQNILQRFAELQDIIAILGIDELSDEDKII
ATPB_MYCPN       IFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKII
ATPB_MYCGA       IFPAVNPLDSTSRLLDPSVVGIQHYQTARKVQMILQKFLELQDIIAILGIDELSEEDKLT
ATPB1_MYCPU      IYPAIDPLASSSRMLDPLIIGNEHYLVALEVQNILQRFKELQDIIAILGIGELSEEDKKL
ATPB_MYCS5       IYPAIDPLESSSRLLDPLVVGQEHYKVAQDVINILQRFKELQDIIAILGMGELSEEDKKI
ATPB_MYCMO       IYPAIDPLASASRMLSADIVGEEHYKIAREVQRILQKFKELQDIIAILGMDELSDEDKNI
ATPB_MYCHJ       IYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQV
ATPB_STAHJ       IYPAVDPLASTSRALEPAIVGQEHYEVARDVQSTLQKYRELQDIIAILGMDELSEEDKLT
ATPB_STAS1       IYPAVDPLASTSRALDPTIVGQDHYEIARDVQSTLQKYRELQDIIAILGMDELSEEDKQT
ATPB2_LISIN      IYPAVDPLASTSRALSPDIVGEEHYEVATEVQRLLQRYKELQDIIAILGMDELSDEDKQS
ATPB_GEOSE       IYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLV
ATPB_BACSU       IYPAVDPLASTSRALAPEIVGEEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLV
ATPB_BACMQ       IYPAVDPLASTSRALSPEIVGEEHYAIARQVQQTLQRYKELQDIIAILGMDELSDEDKLV
ATPB_BACCR       IYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLV
ATPB_BACHD       IYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQKYKELQDIIAILGMDELSEEDKLI
ATPB_BACSK       IYPAVDPLASTSRALSPEIVGEEHYNVARGVQQTLQKYRELQDIIAILGMEELSEEDKLI
ATPB_OCEIH       IYPAVDPLESTSRALDPEVVGKEHYEVATEVQQTLQKYRELQDIIAILGMDELSDEDKLV
ATPB_STRMU       IYPAVDPLASSSRALSPEIVGQEHYDVATEVQHVLQRYRELQDIIAILGMDELSDEEKTL
ATPB_STRR6       IYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTL
ATPB_ENTHA       IYPAVDPLASSSSALAPEIVGEEHYKVATEVQHVLQRYRELQDIIAILGMDELSDQEKVL
ATPB_LACLA       IYPAVDPLASSSRALTPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKIL
ATPB_LACAC       IYPAVDPLESSSSALDPEVVGQEHYEVATRVQHVLQRYHELQDIISVLGMDELSDEEKLI
ATPB_LACDA       IYPAVDPLESTSSALDPEIVGQEHYDVATRVQHILQRYRELQNIISVLGMDELSDEEKLI
ATPB_LACJO       IYPAVDPLESTSSALDPEIVGEEHYEVAVKVQHILQRYQELQDIISVLGMDELSDDEKLI
ATPB_LACCA       IYPAVDPLESSSSALTPEIVGEEHYKVATEVQQVLQRYRELQDIISILGMDELSDEEKVI
ATPB_LACSS       IYPAVNPLESSSSALDPEIVGQEHYEVASEVQHVLQRYRELQDIISILGMDELSDDEKII
ATPB_LACPL       IYPAVDPLASSSIALDPSIVGEEHYQVATEVQRVLQRYRELQDIISILGMDELSDEEKTT
ATPB_LACS1       IYPAVDPLASTSSALTPEIVGEEHYEVATEVQHVLQRYRELQDIISILGMDELSDEEKII
ATPB_RUBXD       IFPAVDPLASSSTILDPDVVGQEHYEVAQEVKGILQRYKELQDIIAILGIDELSEEDKVI
ATPB2_PELCD      LYPAIDPLASTSNILNPRIVGERHYRLAQEIRRTLATYEELKDIIAMLGLEELSREDRRI
ATPB2_MYCPU      LFPAIDPLLSNSSLLQEKIVGKRHILLVKRVKKILHKYKQLEEMIMILGVQELEPNNRLI
                 ::*:: .  * .       :.  *                *.. * : *: *    ::  

ATPB_TROWT       VARARRIEQFLSQNTYMAKKFTGVDGSTVPLQETIDGFDAICRGDCDHIPEQAFFNVGGL
ATPB_LEIXX       VSRARRIQQFLSQNTYMAKKFTGVEGSTVPLKETIESFDAIAKGEFDHVAEQAFFNVGAL
ATPB_BIFLO       VNRARKIEQFLGQNFYVAEKFTGRPGSYVPADETIEAFTRICDGVYDDVPEQAFSGIGGI
ATPB_CUTAK       VARARRIQQFLSQNTYTAEKFTGVAGSTVPIADTVEGFQMICRGDVDHIPEQAFFNVGSM
ATPB_THEFY       VHRARRLERFLSQNMFVAEKFTGTPGVFVPLEETIASFKAICDGEYDHLPEQAFLNVGNI
ATPB_STRAW       VHRARRVERFLSQNTHVAKQFTGVDGSDVPLDESITAFNAIIDGEYDHFPEQAFFMCGGI
ATPB_FRACC       VNRARRIQRFLSQPFFVAEQFTGIPGKFVPLDETIDSFKRLTQGDFDHLPEQAFFMCGGI
ATPB_CORJK       VQRARRLERFLGQNFFVAEKFTGIPGSYVPLADTIDAFERICDGEFDAYPEQAFNGLGGL
ATPB_CORGL       VARARRIERFLGQNFFVAEKFTGLPGSYVPLTDTVDAFERICNGDFDHYPDQAFNGLGGL
ATPB_RHOJR       VGRARRLQKFLGQNFIVAEKFTGEPGSVVPLRDTIEAFDRICKGEFDHLPEQAFNSCGGL
ATPB_MYCLE       VNRARRIERFLSQNMMAAEQFTGQPGSTVPVKETIDAFDRLCKGEFDHVPEQAFFLIGGL
ATPB_FERIS       VQRARKIQRFLTQPTHVAERFSGIPGVYVPIKETIRGFKEILEGRYDDLPEAAFYMVGTI
ATPB_THEMA       VHRARRIQRFLSQPFHVAERFTGRPGRYVPIEETIRGFKEILDGKLDDVPEQAFLMAGNI
ATPB_AQUPY       VNRARRIQKFLSQPFHVAEQFTGMPGKYVKLEDTIRSFKEVLTGKYDHLPENAFYMVGTI
ATPB_NITWN       VARARKVERFLSQPFHVAEVFTGSPGKFVDLADTIKGFRDLCQGKYDHLPEAAFYMVGTI
ATPB_BRADU       VARARKVERFMSQPFHVAEIFTGSPGKFVDLADTIKGFKGLVEGKYDHLPEAAFYMVGTI
ATPB_RHILO       VARARKIERFLSQPFFVAEVFTGAPGKLVDLADTIKGFKGLCNGDYDHLPEAAFYMVGGI
ATPB_AGRFC       VARARKIERFLSQPFFVAEVFTGSPGKLVALEDTIKGFKGLVNGEYDSLPEAAFYMVGSM
ATPB_MAGSA       VSRARKIQRFLSQPFHVAEIFTGSPGKLVAIDDTIKGFKAIVAGEYDHLPEAAFYMVGGI
ATPB_PELUB       VARARKIQRFLSQPFFVAEVFTGSPGKLVDLESTIKGFAAICNGEYDHLPEAAFYMVGTI
ATPB_RHORT       VARARKIQRFLSQPFHVAEVFTGSPGKLVSLEDTIKGFKGLVEGEYDHLPEQAFYMVGNM
ATPB_RUEPO       VARARKIQRFLSQPFDVAKVFTGSDGVQVPLEDTISSFKAVVAGEYDHLPEGAFYMVGGI
ATPB_RUEST       VARARKIQRFLSQPFDVAKVFTGSDGVQVSLEDTIASFKAVVAGEYDHLPEGAFYMVGGI
ATPB_ROSDO       VARARKIQRFLSQPFDVAKVFTGSDGKQVPLAETIESFKAVVAGEYDHLPEGAFYMVGGI
ATPB_JANSC       VARARKIQRFLSQPFDVAKVFTGSDGIQVQLEDTISSFKAVVAGEYDHLPEGAFYMVGGI
ATPB_RHOCA       VARARKIQRFLSQPFDVAKVFTGSDGVQVPLEDTIKSFKAVVAGEYDHLPEAAFYMVGGI
ATPB1_RHOS4      VARARKIQRFLSQPFDVAKVFTGSDGVQVPLEKTIASFKAVVNGEYDHLPEAAFYMVGDI
ATPB_RHOBL       VARARKIQRFLSQPFDVAQVFTGSPGVQVPLDKTIASFKAVVAGEYDHLPEAAFYMVGDI
ATPB_NOVAD       VARARKIQRFLSQPFHVAEVFTGIPGKFVQVEDTVRSFKAVVDGEYDHLPEAAFYMVGGI
ATPB_ZYMMO       VGRARRIQRFLSQPFHVAEVFTGMPGKFVQVEDTVRSFREIIDGKYDDLPENAFYMVGSI
ATPB1_GLUOX      VGRARRIQRFLSQPFHVAEVFTGAPGKLVSLEDTIRSFKAVVAGEYDHLPEGAFYMVGDI
ATPB_RICTY       VSRARKIQRFLSQPFHVAEVFTGVEGKFVNLDDTIAGFKGLVEGKYDDLPEAAFYMVGTI
ATPB_RICBR       VSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLTEGKYDDLPEAAFYMVGTI
ATPB_ANAMM       VARARKIQRFLSQPFHVAEVFTGHPGSFVSLEDTVRSFKGLVEGQYDDLPEAAFYMVGGI
ATPB_ANAPZ       VARARKIQRFLSQPFHVAEVFTGNPGVFVSLEDTVRSFKGLVEGQYDDLPEAAFYMVGGI
ATPB_EHRCJ       VARARKIQRFLSQPFHVAEVFTGSPGKFVSLEDTVSSFKGLVEGKYDHLPEAAFYMVGSI
ATPB_EHRCR       VARARKIQRFLSQPFHVAEVFTGAPGKFVSLEDTVLSFKGLVEGKYDHLPEAAFYMVGSI
ATPB_EHRRW       VARARKIQRFLSQPFHVAEVFTGTPGVFVSLEDTVSSFKDIVEGKYDHLPEAAFYMVSNI
ATPB_WOLTR       VDRARKIQKFFSQPFHVAEVFTGMPGKFVSLSDTVSSFKGIVEGEYDHLPEAAFYMVGNI
ATPB_NEOSM       VYRARKIEKFLSQPFHVAEVFTGQPGKFVSLKDTIAGFKELVEGKCDDMPEAAFYMVGNM
ATPB_CAMJR       VERARKIEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDHLPENAFYMVGNI
ATPB_SULDN       VERARKIEKFLSQPFFVAEVFTGSPGKYVSLADTIKGFKMILSGECDHMPEGSFYMVGGI
ATPB_HELHP       VARARKIERFLSQPFFVAEIFTGSPGKYVTLEETLEGFKGILEGKYDDIPENAFYLVGNI
ATPB_WOLSU       VERARRIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFKGILEGKYDQIPENAFYMVGGI
ATPB_HELPJ       VERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSI
ATPB_DESPS       VSRARKIQRYLSQPFTVAEVFTGMPGKFVKVADTVQGFKEILEGKHDALNENSFYMVGSI
ATPB_SYNAS       VNRARKIQRFLSQPFFVAAQFTGVDGKFVSVPDTVRGFKEILEGKYDDLPEQAFYMVGGI
ATPB_DESAG       VARARRIQRFLSQPFHVAEVFTGTPGVYVKLEETIKAFRGILNGEYDHLAENDFYMVGGI
ATPB_DESVH       VARARRIQRFLSQPFHVAETFTGTPGVYVKLEDTIKGFMGILNGDYDHLAEGDFYMVGGI
ATPB_LAWIP       VSRARRIQRFLSQPFHVAETFTGTAGEYVKLEDTIKGFKGILAGEYDHLSESDFYMVGNI
ATPB_MYXXD       VARARKIQRFLSQPFFVAKVFTGKDGRYVKLQDTIQGFKEIAEGKHDDIPEGAFYMTGSI
ATPB_STIAU       VARARKIQKFLSQPFHVAEVFTGAPGRYVELKDTIQGFKELAEGKHDDLPEAAFYMVGNI
ATPB_ANADE       VARARKIQRFLSQPFTVAQQFTGNPGKYVELPDTIRGFKEIVDGKHDDLPEQAFYMVGGI
ATPB_GEOSL       VARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDDVPEQAFYMVGTI
ATPB_BDEBA       VSRSRKIQRFLSQPFFVAEQFTGLPGKYVDIKDTVKGFREILDGKHDALPEQAFYLVGTI
ATPB_CHLP8       VARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGKHDSLPENAFYLVGTI
ATPB_KORVE       VSRARKIQRFLSQPFHVAEQFTGFPGRYVKIADTVRSFREILQGKHDEIPEQAFYMKGTI
ATPB_OENEH       VARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGTI
ATPB_ORYSA       VARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNI
ATPB_PEA         VARARKIERFFSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNI
ATPB_CUSRE       VARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIIGFTLILSGELDSLPEQAFYLVGNI
ATPB_CUSPE       VARARKIERFLSQPFFVAEIFTGSPGKYVSLAETIRGCTLILSGEFDDLPEQAFYLVGTI
ATPB_PTEAQ       VARARKIERFSSQPSFVAEVFTGSPGKYVSLSETIKGFQMILPGELDNLPEQAFYLVGNI
ATPB_HUPLU       VARARKIERFLSQPFFVAEVFTGSPGKYVTLVETIKGFQMILSGELDNLPEQAFYLVGDI
ATPB_PSINU       VARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIKGFQMILSGELDSLPEQAFYLVGNI
ATPB_STAPU       VARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIKGFQMILSGELDHLPEQAFYLVGNI
ATPB_ZYGCR       VARARKVERFLSQPFFVAEVFTGSPGKYVSLAETIKGFQMILAGELDHLPEQAFYLVGNI
ATPB_CHAVU       VARARKIERFLSQPFFVAEVFTGSPGKYVSLIDTIKGFQMILSGELDHLPEQAFYLVGDI
ATPB_PINKO       VARARKIERFLSQPFFVAEVFTGSPGKYVGLMETIRGFQMILSGELDGLTEQSFYLVGNI
ATPB_MESVI       VARARKIERFLSQPFFVAEVFTGSPGKYVSLADSIKGFTMILNGELDSLPEQAFYLVGNI
ATPB_CHLRE       VARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFGKIFAGELDDLPEQAFYLVGNI
ATPB_TETOB       VARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFNKILAGELDDLPEQAFYLVGNI
ATPB_TUPAK       VARARKIERFLSQPFFVAEVFTGSPGKYVSLKETIQGFNKILTGELDDLPEQAFYLVGTL
ATPB_CHLVU       VARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIQGFNLILSGELDDLPEQAFYLVGNL
ATPB_OLTVI       VARARKIERFLSQPFFVAEVFTGSPGKYVSLSETIQGFSQILTGELDDLPEQSFYLVGNL
ATPB_NEPOL       VARARKIERFLSQPFFVAEVFTGAPGKYVPLAESIQGFKLILSGELDSLPESAFYLVGNI
ATPB_OSTTA       VARARKVERFLSQPFFVAEVFTGSPGKYVSLAESIQGFKMILGGELDDLPEQAFYLVGNI
ATPB_EUGGR       VSRARKVERFLSQPFFVAEVFTGSPGKYVTLAETIEGFKAILSGDLDEVPEQAFYLVGNI
ATPB_PROWI       VARARKIERFLSQPFFVAELFTGLPGKYVSLAKTIQGFNLILSGDLDALSEQAFYLVGDI
ATPB_CYAPA       VARARRVERFLSQPFFVAEVFTGSPGKYVSLEDTIKGFTMILDGELDELPEQSFYLVGDI
ATPB_GUITH       VARARKIERFLSQPFFVAEVFTGSPGKYVSLADTMKGFNMILNGELDELPEQSFYLVGNI
ATPB_TRICV       VARARKVERFLSQPFFVAEIFTGSPGKYVSLEETIKGFTMVLKGELDELPEQAFYLVGNI
ATPB_PYRYE       VSRARKIERFLSQPFFVAEVFTGSPGKYVSLEDAIKGFQMILKGNLDDLPEQAFYLVGDI
ATPB_GRATL       VARARKIERFLSQPFFVAEVFTGSPGKYVSLEDSIKGFNMILGGELDDLPEQAFYLVGNI
ATPB_CYAM1       VARARKIERFLSQPFFVAEVFTGSPGKYVSLEESIKGFKMILDGELDDLPEQAFYLVGNI
ATPB_GALSU       VARARKIERFLSQPFFVAEVFTGSPGKYVSLKESIDGFKMILNGELDDLPEQAFYLVGNI
ATPB_EMIHU       VARARKVERFLSQPFFVAEVFTGSPGKYVSLADSIDGFNRLLDGEFDDLPEQSFYLVGDI
ATPB_OCHNE       VSRARKVERFLSQPFFVAEVFTGSPGKYVSLNDSIDGFNRLLNGEFDDLPEQSFYLVGDI
ATPB_PYLLI       VDRARKIERFLSQPFFVAEVFTGSPGKYVDLENTIKGFNMILGGELDDLPEQAFYLVGDI
ATPB_DICDH       VDRARKIERFLSQPFFVAEVFTGSPGKYVDLENTIKGFNMILNGELDVYQSIAFYLVGDI
ATPB_CYACA       VSRARKIEKFLSQPFFVAEVFTGISGKYVSLSDSIKGFNMILSGEVDNIPEQAFYLVGRI
ATPB_TRIV2       VARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDI
ATPB_SYNP1       VARARKVERFLSQPFFVAEVFTGAPGKYVTLEETIKGFQMILSGELDDLPEQAFYMVGNI
ATPB_PRODI       VDRARKVERFLSQPFFVAEVFTGAPGKYVSLEDTIKGFKMILSGELDDLPEQAFYLVGDI
ATPB_SYNY3       VDRARKIERFLSQPFFVAEVFTGAPGKYVSLADTIKGFKAILAGELDDLPEQAFYLVGDI
ATPB_PROMM       VDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEETIAGFNMIMSGELDHLPEQAFYLVGNI
ATPB_SYNS9       VDRARKVEKFLSQPFFVAEIFTGMPGKYVKLDETIAGFNQILAGELDDLPEQAFYLVGSI
ATPB_PROMP       VSRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILAGELDDLPEQAFYLVGNI
ATPB_SYNE7       VARARKIEKFLSQPFFVAEVFTGSPGKYVKLEDTISGFNRILNGELDDLPEQAFYLVGDI
ATPB_SYNJA       VARARRIERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQRILSGELDHLPEQAFYLVGTI
ATPB_GLOVI       VNRARKLQRFLSQPFHVAEIFTGSPGKYVSLDKTIAGFKRVLQGEFDDLPEQAFYLVGDL
ATPB_LEPIC       VARARKIEKFLSQPFHVAEVFTGAPGKYVKLADTVRSFKEVISGNYDHLPEQAFYMVGSI
ATPB_FUSNN       VSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTI
ATPB_PROMO       VNRARKIERFFSQPFHVAEQFTGMDGKYVTVKETIRGFKEIIEGKHDDLPEQAFLYVGTI
ATPB1_RHOFT      VARARKIQRFLSQPFHVAEVFTGSPGKYVSLAETIRGFKMIVAGECDHLPEQAFYMVGTI
ATPB2_PARXL      VARARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVEGECDHLPEQAFYMVGTI
ATPB1_NITMU      VARARKIQRFLSQPFNVAEVFTGAPGKYVPLKETIKGFKGIVSGEYDHLPEQAFYMVGGI
ATPB_NITEU       VSRARKIQRFLSQPFFVAEVFTGSPGKYVPLKETIKGFKGIVSGEYDDIPEQAFYMVGGI
ATPB_CUPPJ       VNRARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMLVDGECDHLPEQAFYMVGSI
ATPB_BORA1       VARARKIQRFLSQPFHVAEVFTGSPGKYVPLAETIRGFKMIVEGECDALPEQAFYMVGTI
ATPB_AROAE       VSRARKIQRFLSQPFHVAEVFTGSPGKYVPLKDTINGFKMIVNGECDHLPEQAFYMVGGI
ATPB_DECAR       VSRARKIQRFLSQPFHVAEVFTGSPGKFVSLKETIKGFKGICAGEYDHLPEQAFYMVGGI
ATPB_METFK       VARARKIQRFLSQPFHVAEVFTGAPGKYVPLKDTIKGFKAIVNGEYDHLPEQAFYMVGSI
ATPB_NEIMA       VMRARKIQRFLSQPFHVAEVFTGSPGKYVALRDTIAGFKAILNGEYDYLPEQAFYMVGSI
ATPB_CHRVO       VARARKIQRFLSQPFHVAEVFTGSPGKYVPLRETIKGFKAILAGEYDHLPEQAFYMVGAI
ATPB_PSYCK       VYRARKIQRFLSQPFHVAEVFTGAPGKYVPLRDTIASFKAIIAGEYDSLPEQAFYMAGGI
ATPB_ACIAD       VYRARKIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYMVGGI
ATPB_XANC5       VSRARKIERFFSQPFHVAEVFTGSPGKYVSLKDTIRGFKAICDGEYDHLPEQAFYMVGSI
ATPB_XYLFT       VSRARKIERFFSQPFHVAEVFTGAPGKYVPLKDTIRGFKAIVDGEYDHLPEQAFYMVGNI
ATPB_ALCBS       VSRARKIERYLSQPFFVAEVFTGSPGKYVSLKDTLAGFKGILGGDYDHIPEQDFYMKGSI
ATPB_HAHCH       VSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILDGEFDHLPEQAFYMVGGI
ATPB_SACD2       VSRARKIERFLSQPFNVAKVFTGQDGKIVSLKDTISGFQGLLSGQYDDLPEQAFYMVGSI
ATPB_CHRSD       VSRARKIQRFLSQPFFVAEVFTGAPGKYVSLKETIRGFQGILDGEYDDLPEQAFYMVGTI
ATPB_PSESM       VNRARKIQRFLSQPFFVAEVFTGASGKYVSLKDTIAGFKGILNGDYDHLPEQAFYMVGGI
ATPB_PSEHT       VSRARKIQRFLSQPFFVAEVFTGASGKYVSLKDTISGFKGILNGEFDDMPEQAFYMVGSI
ATPB_COLP3       VSRARKIQRYLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGILAGEYDDMPEQAFYMVGGI
ATPB_IDILO       VSRARKIQRFLSQPFFVAEVFTGAPGKYVSLKDTIAGFKGILDGDYDDMPEQAFYMVGTI
ATPB_SHEON       VSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILSGEFDHIPEQAFYMVGSI
ATPB_PASMU       VARARKIERFLSQPFFVAEVFNGTPGKYVPLKETIRGFKGILDGEYDHIPEQAFYMAGTI
ATPB_MANSM       VARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEYDHIPEQAFYMVGSI
ATPB_ECOLI       VARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSI
ATPB_METCA       VSRARKIQRFLSQPFFVAEVFTGSPGKYVPLKDTIAGFKGIVDGDYDDVPEQAFYMVGSI
ATPB_NITOC       VSRARKIQRFLSQPFFVAEVFTGSPGKYVPLKETIQSFKGIVEGEYDHLPEQAFYMVGTI
ATPB_LEGPH       VTRARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIKGFQGILAGEYDDLPEQAFYMVGSI
ATPB_COXBU       VRRARKIQRFLSQPFFVAEVFTGAPGKYVSLQDTIRGFKGIINGEYDELPEQAFYMVGSI
ATPB_FRATT       VDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSI
ATPB_THIDA       VSRARKLQRFLSQPFFVAEVFTGAPGKYVTLKDTIAGFKAIVEGEYDHLPEQAFYMVGGI
ATPB_ACIFR       VSRARKIQRYLSQPFFVAEVFTGSPGTYVSLKETIRAFKAIVAGEYDHLPEQAFYMVGTI
ATPB_HYDCU       VARARKMQRFFSQPYFVAKVFTGEDGRYVPLKETLRGFKMIISGELDDIPEQAFMYAGDI
ATPB_VIBCH       VARARKIERFLTQPYHVAEVFTGDPGVYVPLKETLRGFKGLLAGDYDDIPEQAFMYCGTI
ATPB_ALIF1       VSRARKIEKFLTQPYHVAEVFTGDPGIYVPLKDTLAGFKGLLAGDYDDVPEQAFMYCGKI
ATPB1_PHOPR      VSRARKIERFLTQPYHVAEVFTGDPGIYVALKDTLRSFKGLLAGEYDDIPEQAFMYCGAI
ATPB2_PHOPR      VARARKVERFLTQPYHVAEVFTGQPGIFVSLKDTLNGFKGLLSGEYDDVPEQAFLYCGAI
ATPB_BUCAI       VSRARKIQRFLSQPFFVAEVFTGFPGKYVSLKDNIRAFKGIIKGEFDDLPEQAFYMVGSI
ATPB_BUCAP       VSRARKIQRFLSQPFFVAEVFTGFPGKYVSLKDNIRAFKGIIGGEFDNLPEQAFYMVGTI
ATPB_BUCBP       VSRARKIQKFLSQPFFVAEIFTGFSGKYVKLQDTINGFKDIIEGKVDHVPEQAFYMVGSI
ATPB_BAUCH       VSRARKIQRFLSQPFFVAEVFTGSQGKYVSLQETISGFEDIINGKYDHLPEQKFYMIGSI
ATPB_BLOFL       VLRSRKIQRFLSQPFFVAEVFTGFSGSYVSLEDTIAGFKEIIDGKYDHLPEQSFYMVGSV
ATPB_BLOPB       VLRSRKIQRFLSQPFFVAEVFTGFSGVYVSLRDTIQGFKEIIEGKYDHIPEQAFYMVGTI
ATPB_WIGBR       VSRARKIQRFLSQPFFVAEIFTGFSGKYVTLKDTIDGFNSIINGEYDYIPEQAFYMTGNI
ATPB_HERAU       VSRARKLERFFSQPFGVAEVFTNIPGKYVAVGDTVKSFARVLAGEFDHIPESFFFMKGRI
ATPB_RHOBA       VHRARRIERFLSQPFLVAEVFIGKPGEITSLEDTIRSFEGICDGKYDHLPEQAFMYVGAI
ATPB_DEHMC       VARARRIQRFLTQPMFVSEVFTGRPGQYVSLTETIRGFKEILEGKHDSLPEQAFYMVGTI
ATPB_ACEWD       VSRARKVERFLSQPFNVAEQFTGTAGVYVTIGDTIKGFKEILEGQHDDLPESAFLLVGTI
ATPB_SYMTH       VARARKIERFLSQPMFVAEKFTNLPGVFVDPKDTVKGFKEILEGKHDDLPEQAFYMVGTI
ATPB_CALS4       VYRARKIQRFLSQPFFVAEAFTGTPGKYVPLKETIRGFKKIVEGEMDDIPEPAFYMVGTI
ATPB_PARUW       VSRARRIQKFLSQPFFVAETFTGKKGRFVKLPDTIKGFKMIVEGEMDNIPEQAFYMVGTI
ATPB_PECFR       VARARKIQRFLSQPFFVAEQFTGSPGKYVPLKETIRGFKEILEGKYDDLPESAFYMVGSI
ATPB_CARHZ       VARARKLQRFLSQPFTVAEAFTGRPGKYVPVKETIRGFKEILEGKHDDIPETCFYMAGTI
ATPB_MOOTA       VARARKIQRFLSQPFHVAEAFTGQPGVYVPLKETIRGFKEILEGRHDNLPEQAFYMVGTI
ATPB_DESHY       VSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTI
ATPB_CLOAB       VGRARRVQRFLSQAFSVAEQFTGMKGQFVPVKDTIRSFKEILDGKCDDLPEAAFLFAGTI
ATPB_CLOPE       VARARRIQKFLSQPFTVAEQFTGMQGRYVPIKETIRGFKEILEGKHDNVPESAFLFAGTI
ATPB_BACTN       VNRARRVQRFLSQPFAVAEQFTGVPGVMVGIEDTIKGFRMILDGEVDNLPEQAFLNVGTI
ATPB_CELLY       VGRARRVQRFLSQPFHVAEQFTGLKGVLVDIKDTIKGFNMIMDGELDHLPESAFNLKGTI
ATPB_SALRD       VNRARRVQRFLSQPFFVAEQFTGQPGKYVPIEETIRGFRMILDGELDHLPERAFLLKGTI
ATPB_MYCMS       VQRARKIRNFLSQSFFVGEKFTGRPGVFVKVNDTVRSFKSILDGEVDYIPETYFLYSSII
ATPB_MESFL       VQRARKIRNFLSQSFYVGEKFTGRPGQYVKVSDTVRSFKMILDGEMDDIPEILFLYKGTA
ATPB_UREPA       VMRARKVRNYLSQPSHVAEKFSGQPGLSVKLEDTIEGFRKILDGECDDIHEQHFLYVGKI
ATPB_MYCGE       VERARRIRNFLSQPFFVAEKFSGIAGKYVSLNDTVQSFKEILEGKHDHLPEQAFFYVGTI
ATPB_MYCPN       VERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTI
ATPB_MYCGA       VSRARKIRNFLSQPFFVAEKFSGNKGKYVPISETIKGFSEIVEGKHDDLPEQAFFYVGSI
ATPB1_MYCPU      VFRARKIRNFLSQPFTVAEKFSGKKGKFVPLKETIRSFKEILEGKHDNLPEDAFLYVGSI
ATPB_MYCS5       VARARKIRNFLSQPFTVAEKFSGIKGSYVKLSDTIRSFKEILNGNLDDYPEDIFRYAGSI
ATPB_MYCMO       VYRARKIRNFLSQPFHVAEKFSGIKGTFVKLSDTLRSFRDILDGKYDDLDESAFLYVGTI
ATPB_MYCHJ       VARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTI
ATPB_STAHJ       VERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVADFKDILDGKYDHIPEDAFRLVGSM
ATPB_STAS1       VERARRIQFFLSQNFHVAEQFTGQKGSYVPVQKTVEGFKAILDGEYDHIPEDAFRLVGSM
ATPB2_LISIN      VSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRI
ATPB_GEOSE       VHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRI
ATPB_BACSU       VHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVQGFKEILAGKYDHLPEDAFRLVGRI
ATPB_BACMQ       VQRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKEILEGKYDHLPEDAFRLVGRI
ATPB_BACCR       VHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGGI
ATPB_BACHD       VARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETIKGFKEILEGKYDDLPEDAFRLVGRI
ATPB_BACSK       VARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETIQGFKDILAGKYDDLPEDAFRLVGRI
ATPB_OCEIH       VARARRIQFFLSQNFHVAEQFTGQPGSYVPVQETVKGFKEILEGKYDDLPEDAFRLVGRI
ATPB_STRMU       VGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDELPEDAFRSVGAI
ATPB_STRR6       VARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSI
ATPB_ENTHA       VSRARRVQFFLSQNFNVAEQFTGLPGSYVPVEETVKGFREILEGKYDDLPEEAFRSVGRI
ATPB_LACLA       VGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPI
ATPB_LACAC       VARARKVQFFLSQNFFVAEQFTGVPGSYVPIKETIKGFKLILDGHLDDLPEDAFRGVGPI
ATPB_LACDA       VARARRIQFFLSQNFFVAEVFTSVPGSYVPIKETIKGFKMILDGHLDDLPEDAFRGVGPI
ATPB_LACJO       VERARKIQFFLSQNFFVAEQFTGIPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPI
ATPB_LACCA       VARARRVQFFLSQNFNVAERFTGQPGSYVPVEETVKGFKQILEGKYDDYPEDAFRSVGRI
ATPB_LACSS       VARARRIQFFLSQNFHVAEAFTGQAGSYVPVKDTVSGFKAILAGDYDDVPEEAFRLVGNI
ATPB_LACPL       VARARRIQFFLSQNFFVAENFTGQPGSYVPINDTIKGFKEILEGKYDDLPEDAFRQVGKI
ATPB_LACS1       VARARRIQFFLSQNFHVAEQFTGNPGSYVPVEETVKGFKEILEGKYDNLPEEAFRLVGGI
ATPB_RUBXD       VARARRLQRFLSQPFFVAEQFTSLPGKFVELEETVQSFREVVEGKHDDLPEQAFYLVGGI
ATPB2_PELCD      VFRARRLERFLTQPFHTTQQFTGMQGRTVALDAALNGCEAILNDEFSEAPEKILYMIGGL
ATPB2_MYCPU      VKKAQQLKNYFSQNLFMASSYTKKPGFFADKEEMLDEIEKIVDGHYIDIPEYKFLYLGSS
                 * :::::.    :            *        :     :  .      .  :   .  

ATPB_TROWT       EDVERKWSKLQKELG-------------------
ATPB_LEIXX       SDVEEKWAQIQKENG-------------------
ATPB_BIFLO       DDLEEKWHNMQKELGA------------------
ATPB_CUTAK       DMVMENWDKMKKEG--------------------
ATPB_THEFY       EMAVEKAKKLQS----------------------
ATPB_STRAW       EDLKANAKELGVS---------------------
ATPB_FRACC       EDAEKNAENL------------------------
ATPB_CORJK       DDVEAAYKKMTEK---------------------
ATPB_CORGL       DDVEAAYKKLTGK---------------------
ATPB_RHOJR       DDVEAAAKKIAGK---------------------
ATPB_MYCLE       DDLTKKAESLGAKL--------------------
ATPB_FERIS       DEAVEKAKKLMKSAVI------------------
ATPB_THEMA       DEVKERAKEMRS----------------------
ATPB_AQUPY       EDAIEKAKQMGAKV--------------------
ATPB_NITWN       EEAVEKGKKLAAEAA-------------------
ATPB_BRADU       EEAVEKGKKLAAEAA-------------------
ATPB_RHILO       EEAVEKAQRLAAEAA-------------------
ATPB_AGRFC       EEAIEKAKKLTAEAA-------------------
ATPB_MAGSA       DEVIEKAKKMAAEAA-------------------
ATPB_PELUB       EEAVEKAEKMAKDAAA------------------
ATPB_RHORT       AEAIEKAKKMAAEAA-------------------
ATPB_RUEPO       DEVIAKAERMAAEAA-------------------
ATPB_RUEST       DEVIAKAEKMAADAA-------------------
ATPB_ROSDO       EEVKAKAEQMAADAA-------------------
ATPB_JANSC       DEVIAKAEKMAADAA-------------------
ATPB_RHOCA       DDVIAKAQRLAAAA--------------------
ATPB1_RHOS4      EDVIAKAQRLAAQAA-------------------
ATPB_RHOBL       EEAKAKAAKLAAAAA-------------------
ATPB_NOVAD       DEAVEKAKKLAAEA--------------------
ATPB_ZYMMO       DEAVAKAEKMAAEAA-------------------
ATPB1_GLUOX      DEAIAKAEKMKQEA--------------------
ATPB_RICTY       DEAVEKAKILKI----------------------
ATPB_RICBR       EEALEKAKTLK-----------------------
ATPB_ANAMM       DDAVKKAASLK-----------------------
ATPB_ANAPZ       DAAVEKAKALK-----------------------
ATPB_EHRCJ       DDVIKKAELLQKEGKV------------------
ATPB_EHRCR       DDVIKKAELLQKEGKV------------------
ATPB_EHRRW       NEAVKKAELLQKEGK-------------------
ATPB_WOLTR       DEAIKKAELIKDETKVGAKS--------------
ATPB_NEOSM       NEAREKAISLREK---------------------
ATPB_CAMJR       DEAIAKADKLKG----------------------
ATPB_SULDN       DEAIEKAQKMK-----------------------
ATPB_HELHP       QEALEKAQKLKNA---------------------
ATPB_WOLSU       DEVLEKAERLKANA--------------------
ATPB_HELPJ       QEVLEKAKNMKNS---------------------
ATPB_DESPS       DEAVAKDAASKA----------------------
ATPB_SYNAS       EEAVEKAKKYQEQ---------------------
ATPB_DESAG       EMAVERYNQRQQAA--------------------
ATPB_DESVH       EMALEKYKKRQEQ---------------------
ATPB_LAWIP       DSAVAKYEKRKESK--------------------
ATPB_MYXXD       DEVVENARKLAAS---------------------
ATPB_STIAU       NEAIEKARKLAAA---------------------
ATPB_ANADE       EEAVEKAKKLTAG---------------------
ATPB_GEOSL       EEALEKAKKLAA----------------------
ATPB_BDEBA       EDAIEKAKKLQA----------------------
ATPB_CHLP8       EEAVEKAKKL------------------------
ATPB_KORVE       DEVHEAAEKMKANA--------------------
ATPB_OENEH       DEATAKAANLEMESDLKK----------------
ATPB_ORYSA       DEASTKAINLEEENKLKK----------------
ATPB_PEA         DEATAKATNLT-----------------------
ATPB_CUSRE       NEATEKAMNLKT----------------------
ATPB_CUSPE       DEVNAKAMLE------------------------
ATPB_PTEAQ       DEATAKAAALQVEGQ-------------------
ATPB_HUPLU       NEATAKAATSQVEN--------------------
ATPB_PSINU       EEATAKAGISQMED--------------------
ATPB_STAPU       DEATAKAATIQVESA-------------------
ATPB_ZYGCR       NEATAKAATLS-----------------------
ATPB_CHAVU       EEATAKAATIQVQSE-------------------
ATPB_PINKO       DEATVRLNSTGK----------------------
ATPB_MESVI       EEAIAKAATLKE----------------------
ATPB_CHLRE       TEAISKAASLK-----------------------
ATPB_TETOB       NEALTKAASMK-----------------------
ATPB_TUPAK       DEAVAKAATL------------------------
ATPB_CHLVU       DEAVSKAATLS-----------------------
ATPB_OLTVI       DEAIAKAATLG-----------------------
ATPB_NEPOL       EEAIAKAASIQAAAAAAAAA--------------
ATPB_OSTTA       DEAVEKAAKL------------------------
ATPB_EUGGR       EEVISKAIELQ-----------------------
ATPB_PROWI       EEAISKGFLKK-----------------------
ATPB_CYAPA       QEAISKGQKLLAEAK-------------------
ATPB_GUITH       DEAIEKAKSLKG----------------------
ATPB_TRICV       DEAIAKAETLK-----------------------
ATPB_PYRYE       DEAIQKADSMKD----------------------
ATPB_GRATL       DEAISKAEKLK-----------------------
ATPB_CYAM1       EEAIQKAQKL------------------------
ATPB_GALSU       QEAIKKADELKDK---------------------
ATPB_EMIHU       NEAIEKAAKINAK---------------------
ATPB_OCHNE       NEAIAKAAKLKG----------------------
ATPB_PYLLI       NEAISKAKTFKN----------------------
ATPB_DICDH       NEAIAKAKTITN----------------------
ATPB_CYACA       EEAIDKAKQVEKS---------------------
ATPB_TRIV2       NEAIAKAEKLKG----------------------
ATPB_SYNP1       EEAKAKAEKLKA----------------------
ATPB_PRODI       QEAKAKAEKLKQD---------------------
ATPB_SYNY3       EEAKAKGAKLKEG---------------------
ATPB_PROMM       DEVKAKAEKMASEAKG------------------
ATPB_SYNS9       EEVKAKAQKMAAESK-------------------
ATPB_PROMP       DEVKAKAEKIKEEK--------------------
ATPB_SYNE7       QEAIEKGAKLKAES--------------------
ATPB_SYNJA       EEAIEKAEKLKSK---------------------
ATPB_GLOVI       DEALEKAKKLKDEGKS------------------
ATPB_LEPIC       DDAIEKAKGYKG----------------------
ATPB_FUSNN       EEAVAKSKDLAK----------------------
ATPB_PROMO       DEAIAKARELMKGAE-------------------
ATPB1_RHOFT      DEAFEKAKKI------------------------
ATPB2_PARXL      DEAFEKAKKIQ-----------------------
ATPB1_NITMU      DEAVEKAKTLQ-----------------------
ATPB_NITEU       EEVLEKAKSIQ-----------------------
ATPB_CUPPJ       DEAFEKAKKLQ-----------------------
ATPB_BORA1       DEAFEKAKKLQ-----------------------
ATPB_AROAE       EEAMEKAKKLQ-----------------------
ATPB_DECAR       EEVIEKAKTL------------------------
ATPB_METFK       EEAVEKAKTLN-----------------------
ATPB_NEIMA       EEAVEKAKTLN-----------------------
ATPB_CHRVO       EEAAEKAKTLN-----------------------
ATPB_PSYCK       DEVVAKAEKMKSSAA-------------------
ATPB_ACIAD       DEVIAKAEKL------------------------
ATPB_XANC5       EEAVEKANKMSAKA--------------------
ATPB_XYLFT       EEVIEKANKMTA----------------------
ATPB_ALCBS       DEVIEAYNKRSK----------------------
ATPB_HAHCH       DEAVEKAKKTK-----------------------
ATPB_SACD2       DEAIEKAKKMKEKAA-------------------
ATPB_CHRSD       DEAVEKANNMK-----------------------
ATPB_PSESM       EEAIEKAKKL------------------------
ATPB_PSEHT       EEAQEKAKSM------------------------
ATPB_COLP3       EEAIEKANKM------------------------
ATPB_IDILO       EEAVEKAKNL------------------------
ATPB_SHEON       DEAVEKANKKK-----------------------
ATPB_PASMU       DEVLEKAKKL------------------------
ATPB_MANSM       EEVVEKAKNM------------------------
ATPB_ECOLI       EEAVEKAKKL------------------------
ATPB_METCA       DEALEKAKRLAA----------------------
ATPB_NITOC       DEAVEKAKKL------------------------
ATPB_LEGPH       EEAVAKAKTL------------------------
ATPB_COXBU       EEAVEKAKSL------------------------
ATPB_FRATT       QEAIEKAKTL------------------------
ATPB_THIDA       EEAVEKAKTIQ-----------------------
ATPB_ACIFR       DEALAKAQKLQQG---------------------
ATPB_HYDCU       DEVLEKAKKYKD----------------------
ATPB_VIBCH       DDAIENAKKL------------------------
ATPB_ALIF1       EDALEKAKKL------------------------
ATPB1_PHOPR      EDVLEKAKKL------------------------
ATPB2_PHOPR      EDVIEKAKTM------------------------
ATPB_BUCAI       EEVIEKAKKL------------------------
ATPB_BUCAP       EEVIKKAKLL------------------------
ATPB_BUCBP       NEVIEKSKKL------------------------
ATPB_BAUCH       NEAMTKE---------------------------
ATPB_BLOFL       KEAIEKSKIL------------------------
ATPB_BLOPB       EEVIKKNKTL------------------------
ATPB_WIGBR       SDVLDKYKKFYS----------------------
ATPB_HERAU       DDVVAAFDASKQ----------------------
ATPB_RHOBA       EQAEEQAKKMESK---------------------
ATPB_DEHMC       DDAVAEAKKLSAV---------------------
ATPB_ACEWD       EDAVVKAKKIKG----------------------
ATPB_SYMTH       EQAVEKGKKLLAEVS-------------------
ATPB_CALS4       DEVYEKAEKMK-----------------------
ATPB_PARUW       EEVFEKAEQMK-----------------------
ATPB_PECFR       DEAVEAAKKIKQEA--------------------
ATPB_CARHZ       DEVVERARELEGSA--------------------
ATPB_MOOTA       DEAVKKGQELM-----------------------
ATPB_DESHY       EEAIEKAKALGA----------------------
ATPB_CLOAB       EDVKEKAKKMMES---------------------
ATPB_CLOPE       EEVLEKARAMAQ----------------------
ATPB_BACTN       EEAIEKGKKLLEQAKK------------------
ATPB_CELLY       EEAIEAGEKMLAEA--------------------
ATPB_SALRD       DEVIEAGEEMAEEA--------------------
ATPB_MYCMS       DDVIEKYNKDKDK---------------------
ATPB_MESFL       EDVIQAYNETKVKNKK------------------
ATPB_UREPA       DDVFEKAAKNK-----------------------
ATPB_MYCGE       QEAVEKAKRLNQEFDKTK----------------
ATPB_MYCPN       QEAVEKAKRLKKATVEEK----------------
ATPB_MYCGA       DEAIERAKTLTRNG--------------------
ATPB1_MYCPU      DEAIEKAKGQSNATTANNNNA-------------
ATPB_MYCS5       DDVIARYKK-------------------------
ATPB_MYCMO       EEAKQKHLKNYKGDHVEK----------------
ATPB_MYCHJ       DQALEKAKKMGWSEKN------------------
ATPB_STAHJ       EDVIAKAKDMGVEV--------------------
ATPB_STAS1       EEVIAKAKDMGVEV--------------------
ATPB2_LISIN      EDVLEKAKDMGVEV--------------------
ATPB_GEOSE       EEVVEKAKAMGVEV--------------------
ATPB_BACSU       EEVVEKAKEMGVEV--------------------
ATPB_BACMQ       EEVIENAKRMGVEV--------------------
ATPB_BACCR       EEVIENAKKMMA----------------------
ATPB_BACHD       EEVVERAKQMV-----------------------
ATPB_BACSK       EEVVEKAKQMA-----------------------
ATPB_OCEIH       EEVVEKAKGME-----------------------
ATPB_STRMU       EDVVEKAKNMGV----------------------
ATPB_STRR6       EDVIAKAEKMGF----------------------
ATPB_ENTHA       EDVVEKAKKLGY----------------------
ATPB_LACLA       EDVLEKAKSMGY----------------------
ATPB_LACAC       EDVLKKAQEMGVTPSDPEAKALLEK---------
ATPB_LACDA       EDVLKKALKMGVTPSDPEAKALLEK---------
ATPB_LACJO       EDVIKQAEKMGVTPKNPEAKAILEAK--------
ATPB_LACCA       EEVVEKAKKMGFAP--------------------
ATPB_LACSS       DAALAKAKEMGYTQSEKAVDQD------------
ATPB_LACPL       DDVVEKAKSMVTD---------------------
ATPB_LACS1       EDVVEKAKKLAGNN--------------------
ATPB_RUBXD       DDVLEKARQLSGEEEEGEEAAKEEAGVGAGGEGS
ATPB2_PELCD      EEARQRLREEETAGHGEEPP--------------
ATPB2_MYCPU      KKLDQIKANLEKDQKEQEN---------------