CLUSTAL format seed alignment for MF_01348

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YC48L_SYNJA      ---------MAKMLKLWRLVLLAAFSLLLMAARM-----PDMKVVPWQQVEVPTQNILLD
YC48L_SYNJB      --------MRVKMFKPLRLVLLIAVSVLLMAARM-----PNMRVVPWQQVEVPTQNILLD
P2SAF_CYAPA      ---------MILNWRKVIVSFLVIILTNFYNISF-----THAESYKWEQIPLNTDEILLD
YC48L_SYNP6      ---MSSLLSRSR--VGWPLGFLLLPLLFWLPAPAWAATEVAPSTSPWQVIDLGTEKTILD
YC48L_SYNE7      ---MSSLLSRSR--VGWLLGFLLLPLLFWLPAPAWAATEVAPSTSPWQVIDLGTEKTILD
YC48L_SYNY3      ---MPVKFPSLKFEQLKQLVLVAAIAVFCVSCSH----VPDLAFNPWQEIALETDSTFAD
YC48L_SYNP2      ---MTSVLGLLK--PLKKAIAAIAVLVLCIGCVQ----APTISENPWQEIDLNTDSTFAN
YC48L_NOSS1      -------MVIVK--SWQKIFTLLVVLLLCIGCSK----VPSTSYNPWAVVSLPTEAKLLD
YC48L_TRIV2      -------MVIVK--SWQKIFALLVVLLLCIGCSK----VPSTSYNPWAVVSLPTEAKLLD
YC48L_THEEB      MFAKQIDIHWQKMKGIKFLHWLLGTVLLWVSLSTPALAIPALDYNPWEAIQLPTTATILD
YC48L_GLOVI      ----------MGKWSGLGLGLLLLVLAGCGAPPLE------RDEWKVIPTGLSDKADLLD
YC48L_PROMP      ---------MKKFVTSIPNLLLTFTLCFVLSSC-SSTGVKMSESSPWETIQFEDQSNALD
YC48L_PROM9      ---------MKKIITSFPNLLLSILLCFVLSSC-SSTGVKMSDSSPWKTIQFQDQANALD
YC48L_PROMT      ---------MKRLFSNVINLTLVLIVGVALSGC-TVSNASIGSSSPWSLVDLDTEANPLD
YC48L_PROMA      ---------MNRLIKFSFNLILIFVLGLGLSGCVTTTRIPVQSSSPWEEIELANDDNPLD
YC48L_SYNPX      ---------MTRFVSSAINLLLVLVLGVSLSGC-VTTRLPVASTSPWQALNLDTEANPLD
YC48L_SYNSC      ---------MKRLLNSATQLLLVLVLGISLSGC-VTTHVPTATTSPWQAMDLDTQANPLD
YC48L_SYNS9      ---------MNRLLSSAVNLLLVLVLGVGLSGC-VSTRVPTASSSPWKAIDLETQANPLD
YC48L_PROMM      ---------MSRLFSNLFNLLLIAAIGFGLSGC-VTSRLPVASTSPWQPLELNTESNPLD
                                                                    .       :

YC48L_SYNJA      IAFTGTNPSHGWLVGDKATLLESQDGGLHWQVRKLTAL-EPEAYLSSISFAGAEGWVVGQ
YC48L_SYNJB      IAFTGTTPSHGWLVGDKATLLESRDGGLHWQVRELPGL-EPEAYLASISFAGAEGWVAGQ
P2SAF_CYAPA      IGFVPDQPQRGWLLGTRSTLFETTDKGKTWELRSLNLE-DDKYRLNSISFSGKEGWVTGK
YC48L_SYNP6      IAFTS-NKQHGWLVGTDLALYETLDGEQSWSERALDL--DETYRLNSISFKGDEGWVVGQ
YC48L_SYNE7      IAFTS-NKQHGWLVGTDLALYETLDGGQSWSERALDL--DETYRLNSISFKGDEGWVVGQ
YC48L_SYNY3      IAFTE-DPNHGWLVGTKETIFETTDGGDTWEQKLIDLG-EEKASFSAVSFSGNEGWITGK
YC48L_SYNP2      IAFTD-DLQHGWLVGTKETLFETTDGGKTWAERVIDLG-DEKESFTGVSFSGQEGWITGR
YC48L_NOSS1      IAFTE-NPQHGFLVGSSATLLETNDGGNNWQPLNLALD-DDRYRFDSVSFAGKEGWIVGE
YC48L_TRIV2      IAFTE-NPQHGFLVGSNATLLETNDGGNNWQPLNLALD-DDRYRFDSVSFAGKEGWIAGE
YC48L_THEEB      MSFI--DRHHGWLVGVNATLMETRDGGQTWEPRTLVLD-HSDYRFNSVSFQGNEGWIVGE
YC48L_GLOVI      IAFVD--DKNGWAVGSRSTLLRTADGGESWTAVPVKLD-SDSR-FLSVSFDGKNGWIGGE
YC48L_PROMP      IDFID--NNHGFLVGSNRLIMESNDGGKSWEKRSLDIAAEENFRLLDIDFKGSEGWLIGQ
YC48L_PROM9      VDFID--NNNGFLVGSNRLIMESNDGGETWEKRNLDLPSEENFRLIDIDFKGQEGWLIGQ
YC48L_PROMT      VDFVD--DKNGFLVGTNRLILETNDGGITWKERNLDIPSEGNFRLISVDFKGQEGWIAGQ
YC48L_PROMA      IAFVD--DNHGFLVGANRLILETTDGGSTWEERDLDIPAEENFRLMSIDFKEDEGWIVGQ
YC48L_SYNPX      VAFTD--SRHGYLVGSNRMIRETNDGGATWNDRSLDLPEEENFRLISIDFNGDEGWIAGQ
YC48L_SYNSC      VAFTD--SSHGYLVGSNRMIRETNDGGAHWNERSLDLPDEENFRLISIDFSGDEGWIAGQ
YC48L_SYNS9      VSFTD--PSHGFLVGSNRMIRETDDGGAHWNDRSLDLPDEENFRLISIDFEGQEGWIAGQ
YC48L_PROMM      ISFSD--ANHGFVVGTNRLIMESNDGGVSWKKRSLDLEEDENFRLISIDFNGNEGWIAGQ
                 : *      .*: :*    : .: *    *    :         :  :.*   :**: *.

YC48L_SYNJA      PRILLHTLNEGSDWTSIRLSKQLPGEPILIQALGPGAAEMVTNVGAIYRTEDGGQTWHAQ
YC48L_SYNJB      PKILLHTLNEGSDWTSIRLNNQLPGEPLLIQALGPGAAEMVTNVGAIYRTEDGGQTWHAQ
P2SAF_CYAPA      PAILLHTTDGGSSWSRIPLSNQLPGDPALITALGTGKAELATDIGAIYRTENSGQTWKAQ
YC48L_SYNP6      PSLMLHTTDGGKNWLRIPLSEKLPGSPLLVTALGKGEAEMATDVAAIYRSRDGGKSWQAQ
YC48L_SYNE7      PSLMLHTTDGGKNWLRIPLSEKLPGSPLLVTALGKGEAEMATDVAAIYRSRDGGKSWQAQ
YC48L_SYNY3      PSILLHTTDGGQTWARIPLSEKLPGAPYSIIALGPQTAEMITDLGAIYKTTNGGKNWKAL
YC48L_SYNP2      PSILLHTDDGGEHWSRIALSSQLPGAPYNITALGPNTAEMVTDLGAIYKTTDGGKNWKAL
YC48L_NOSS1      PSLLLHTTDEGRSWSRIPLSEKLPGNPIAIQALGTDIAEMATDVGAIYKTTDGGKNWKAQ
YC48L_TRIV2      PSLLLHTTDEGRSWSRIPLSEKLPGNPIAIQALGTDIAEMATDVGAIYKTTDGGKNWKAQ
YC48L_THEEB      PPIMLHTTDGGQSWSQIPLDPKLPGSPRLIKALGNGSAEMITNVGAIYRTKDSGKNWQAL
YC48L_GLOVI      PKRLLRTVNGGASWTSITLDQRLPGSPLKVYALGADTAEVVLNSGLVIKTVNGGKNWQVV
YC48L_PROMP      PSLVMHTIDEGKNWTRLSLG-KLPGQPFLVSTVDDGVAELATTSAAIYTTSNSGETWEAK
YC48L_PROM9      PSLVMHTLDAGKNWTRLSLGNKLPGQPYLITTVDDGVAELATTAGAIYQTSDSGESWNAK
YC48L_PROMT      PGLILHTTDGGKNWTRLDLGNKLPGDPYLITTIDTDIAELATTAGAIYKTTDAGTNWEAI
YC48L_PROMA      PNLVLHSEDAGKNWTRLSLGSQLPGNPYLITTLDTSSAELATTAGAVYRTTDGGKNWEGR
YC48L_SYNPX      PGLLMHTSDGGQNWTRLFLDTKLPGEPYLITALGSHSAEMATNVGAVYETHDDGGSWEAL
YC48L_SYNSC      PGLLMHSDDGGQNWTRLFLDTKLPGEPYLITALGSHSAELATNVGAVYETHNDGSSWEAK
YC48L_SYNS9      PGLLMHSTDGGQNWTRLFLDTKLPGEPYLITALGKSSAELATNVGAVYKTNDGGESWEAS
YC48L_PROMM      PGLVMHSTDAGKNWSRLKLENKLPGDPYLITNLGPNNAELATNAGAIYRTSDGGTTWKAT
                 *  :::: : *  *  : *  :*** *  :  :.   **:    . :  : : * .*.  

YC48L_SYNJA      VEEPI--GAIKNIARGPGGEYLAVSSRGSFYFLYTPESRSWKPYPRESSRRIQNMGFGPN
YC48L_SYNJB      VDEPI--GAIKNIARGPEGEYLAVSSRGSFYFLYTPESRTWKPYPRESSRRIQNMGFGPH
P2SAF_CYAPA      IQEPL--GVIRTVARSENGSYVAVSAKGNFYSTWKEGDDKWISHPRQSSRRIQSMGFTNN
YC48L_SYNP6      VPDAA--GVARSVSRSRDGRYLAVSARGNFYSTWKPGDTTWTPHQRTSSRRLQLMGFGPD
YC48L_SYNE7      VPDAA--GVARSVSRSRDGRYLAVSARGNFYSTWKPGDTTWTPHQRTSSRRLQLMGFGPD
YC48L_SYNY3      VEGAV--GVARTIQRSTDGRYVAVSARGNFYSTWAPGQTEWTPHNRNSSRRLQTMGYGKD
YC48L_SYNP2      VEGAV--GVARTIERSADGKYVAVSARGNFYSTWSPGDTEWTPHNRNSSRRLQSMGFNGE
YC48L_NOSS1      VEAAV--GVVRNLERSVDGKYVAVSAKGSFYSTWEAGQNAWVPHNRNSSRRVENMGFSQD
YC48L_TRIV2      VEAAV--GVVRNLERSEDGKYVAVSAKGSFYSTWEPGQNAWVPHNRNSSRRVENMGFSQD
YC48L_THEEB      VQEAI--GVMRNLNRSPSGEYVAVSSRGSFYSTWEPGQTAWEPHNRTTSRRLHNMGFTPD
YC48L_GLOVI      TPASA--GGIRSAERVADGSYWVVSTRGGSYLQWKPGDPQWTNYERTSSRRIQAMGFSSG
YC48L_PROMP      VSDPSEQGGIRDLRRTSNGDYVSVSSLGNFFSTLESGSDTWIAHQRASSKRVQGIGFNPD
YC48L_PROM9      VLDASGSGGVRDLRRTDKGDYVSVSSLGNFFSTLENDSNSWIAHQRASSKRVQSIGFNPE
YC48L_PROMT      VVDTSGSGGIRELRRTNNGGYISVSSLGNFFSVLRPGEEIWSPHQRASSKRVQSVGEQPN
YC48L_PROMA      VAEAS--GGVRDLRRKEDGTYVSVSSLGNFFVTLDKTDQAWQSHQRASSKRVQTLGFKPD
YC48L_SYNPX      VTDAA--GAVRDLRRGDDGSYVSVSSLGNFYATWQPGDSVWQVHQRVSSQRLQSIGYQPD
YC48L_SYNSC      VTDAA--GAVRDLRRSKDGSYVSVSGLGNFYATWEPGDSVWQVHQRVSSQRLQSIGFQPD
YC48L_SYNS9      VTDAA--GAVRDLRRSSNGSYVSVSGLGNFYATWEPGETVWKVHQRVSSQRLQSIGYQPD
YC48L_PROMM      VSEAA--GAVRDLRRSAAGNYVSVSSLGNFFSTLDLGQDVWQNHERVSSKRVQSLGYQPN
                    .   *  :   *   * *  **  *. :      .  *  : * :*:*:. :*    

YC48L_SYNJA      GSAWKLNQGAEIAFTSD----------FTSGEWSKPLRPGR--ALSFGYLNAAYQN-DHD
YC48L_SYNJB      GSAWKLNQGAEIAFTDD----------FTSGQWSSPLRPGR--ALSFGYLNAAYQN-DHD
P2SAF_CYAPA      NRLWMLTRGGQLWFSSNDS--------FDEPNWEGPKTPEGKVGFGLGLLNLAFKT-PTE
YC48L_SYNP6      DRTWLIARGGRLQFSKTSQIDNWEEMLEESDAWGTAIEPER--NAGWGFLDLAYRS-KQE
YC48L_SYNE7      DRTWLIARGGRLQFSKTSQIDNWEEMLEESDAWGTAIEPER--NAGWGFLDLAYRS-KQE
YC48L_SYNY3      GQLWLLARGGQLQFSTDPD----------AEEWSDVIAPQD--KGSWGLLDLSFRT-PEE
YC48L_SYNP2      DKLWLLARGGVVQFSDDTNPDN-------AEAWSEPVTPQY--RNSVGLLHIGYRT-PAE
YC48L_NOSS1      G-LWLLARGGQVQFSDPAN----------PDEWLDAETPEL--ATSWGLLDMAYRT-PNE
YC48L_TRIV2      G-LWLLARGGQVQFSDPTK----------PDEWLDAQTPEL--ATSWGLLDMAYRT-PNE
YC48L_THEEB      GRLWMIVNGGKIAFSDPDN----------SENWGELLSPLR--RNSVGFLDLAYRT-PNE
YC48L_GLOVI      KAGWMINQGGEMQFTANQG-----------ETWTPGRSVIL---NGLSLLDADYTAADKK
YC48L_PROMP      GNLWMLSRGAEIRFNDDSN---------DLESWTKPIVPIL---NGYNYLDMGWDP-EGN
YC48L_PROM9      GSLWMLSRGAEIRFNEDTN---------DLENWSKPIIPIL---NGYNYLDMGWDP-NGD
YC48L_PROMT      GDLWMLSRGAEIRFNADPD---------DIDSWSKPIIPIV---NGYNYQDLVWDP-SKS
YC48L_PROMA      GQLWMLSRGAEIRLNDASG---------DYESWSKPIIPLV---NGYNYMDMAWDP-EGN
YC48L_SYNPX      GNLWMVARGAQIRLNDESG---------NLESWTKAIIPIT---NGYGYMDMAWDE-DGA
YC48L_SYNSC      GNLWMVARGAQIRLNDEPG---------DFDSWSKAIIPIT---NGYGYMDLAWDD-DGA
YC48L_SYNS9      GNLWMVARGAQIRLNDGDG---------NVEDWSKAIIPIT---NGYGYMDMAWDD-DGG
YC48L_PROMM      GELWMVARGAEIRLNDQPG---------NVDSWGKAMIPIT---NGYNYLDLSWDP-NGG
                    * : .*. : :.                 *            . .  .  :      

YC48L_SYNJA      LWVVGGGGTLIHSPDGGKTWEEAKKLSNIPANFYSIEFFGP-----DRGFILGQRGTLLR
YC48L_SYNJB      LWVVGGGATLIHSPDGGKTWEQAKKLSNIPANFYSIEFFGP-----EQGFILGQRGTLLR
P2SAF_CYAPA      IWVSGGSGILLSSQDTGNTWKKETSTDNIPSNFYKISFIDK-----EVGFVLGNQGTLLR
YC48L_SYNP6      IWLSGGSGTLLVSEDGGEHWQRDRVIAKLPSNLYTIKFFAP-----KQGFVLGQRGLLLR
YC48L_SYNE7      IWLSGGSGTLLVSEDGGEHWQRDRVIAKLPSNLYTIKFFAP-----KQGFVLGQRGLLLR
YC48L_SYNY3      VWVAGASGNLLMSQDGGQTWAKDTGVEDIPANLYRVVFLSP-----EKGFVLGQDGILLK
YC48L_SYNP2      LWAVGGSGSVVVSKDGGDTWFRDAALEEIPTNFYRVVFLNE-----NKGFILGQQGVILR
YC48L_NOSS1      VWIGGGSGNLLVSTDGGKTWEKDRDVEEVAANFYKVVFLKP-----DQGFVIGDRGVLLK
YC48L_TRIV2      VWIGGGSGNLLVSTDGGKTWEKDRDVEEVAANFYKVVFLKP-----DQGFVIGDRGVLLK
YC48L_THEEB      VWLAGGAGALLCSQDGGQTWQQDVDVKKVPSNFYKILFFSP-----DQGFILGQKGILLR
YC48L_GLOVI      IWAAGGGGTLIVSADDGQNW-KAEEVPGIKGSLLNVEFIG------NKGFVLGQNGVLLK
YC48L_PROMP      IWAGGGNGTLIVSKDDGKTWDSDPVASNLPTNFIKIQFLEKDELDAKKGFILGERGYILR
YC48L_PROM9      IWAGGGNGTLIVSKDQGKTWNKYPIAAELPTNYIKIVFLDKEALDNQKGFVLGERGYILK
YC48L_PROMT      IWAAGGNGTLLVSNDEGKTWEKDPVGESVPTNFIRILFLDDLNSESPKGFVFGERGNLLR
YC48L_PROMA      IWAGGGNGTLLVSKDDGNSWEKDPIGYATPTNFIRIFFLKNPNGNPPKGFVLGERGHVLR
YC48L_SYNPX      IWAGGGNGTLLVSRDGADSWEIDPVGDRQPSNFTRMVFDWD------HAFVLGERGNLLR
YC48L_SYNSC      IWAGGGNGTLLVSRDGGDSWENDPVGDRQPSNFTRMVFDGE------HAFVLGERGNLLR
YC48L_SYNS9      IWAGGGNGTLLVSHDGGDSWETDPVGDQQPSNFTRFVFDDD------HAFVLGERGNLLR
YC48L_PROMM      IWAAGGNGTLIKTLDDGKSWQIDPMGDTQPSNLIRILFDTSSESQA-KGFVLGERGHLLR
                 :*  *. . :: : * .. *           .   . *          .*::*: * :*:

YC48L_SYNJA      YVGYSNSPS------
YC48L_SYNJB      YVSSNNS--------
P2SAF_CYAPA      YVSL-----------
YC48L_SYNP6      YAPEAAA--------
YC48L_SYNE7      YAPEAAA--------
YC48L_SYNY3      YNPSTEVAMVP----
YC48L_SYNP2      YDTSTEAA-------
YC48L_NOSS1      YQPEAAKTATTEPAA
YC48L_TRIV2      YQPEAAKTATTEPAA
YC48L_THEEB      YVTDLTAAPA-----
YC48L_GLOVI      YRGAAD---------
YC48L_PROMP      WNG------------
YC48L_PROM9      WNS------------
YC48L_PROMT      WQG------------
YC48L_PROMA      WVGYS----------
YC48L_SYNPX      WVGNAV---------
YC48L_SYNSC      WVDNAV---------
YC48L_SYNS9      WVGNAV---------
YC48L_PROMM      WVG------------
                 :