CLUSTAL format seed alignment for MF_01349

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PANCY_SYNJB      ---MHWLRTVA---ALREQVADWRGST-----------------VGLVPTMGSLHEGHLS
PANCY_SYNJA      ---MQWLRTVA---ALREQVASWRGST-----------------IGLVPTMGSLHEGHLS
PANCY_GLOVI      ---MKVVETVARLEAFRRARAPVAGVE-----------------MGLVMTMGALHEGHRS
PANCY_SYNP6      ---MRQLISPE---ALRAFRQSVQGS------------------VGFVPTMGALHAGHRS
PANCY_SYNE7      ---MRQLISPE---ALRAFRQSVQGS------------------VGFVPTMGALHAGHRS
PANCY_ACAM1      MDNVPIIRTVSGLRHFLRCFPGNLNTGASPSSTVIG-------QIGLVPTMGALHAGHLS
PANCY_THEEB      MGTFHRLTTTAGLQTALGTF--------SPATTV-----------GFVPTMGALHGGHAA
PANCY_SYNY3      --MVQVFRTIAGLQTYLRQAGRGK-------------------TVGLVPTMGSLHAGHGS
PANCY_TRIEI      ---MRLFTTIAGLNCYLNLLRNEQKKSPD--------------TIGLVPTMGALHKGHLS
PANCY_NOSS1      ---MRLLTTVAALRCYLNKRRWESRLTASEEQILDSMTSWYQTAIGLVPTMGSLHQGHLS
PANCY_TRIV2      ---MRLLTTVAALRCYLNKRRWESQLTASEEQILDSMTSWYQTAIGLVPTMGSLHQGHLS
PANCY_PROM3      --------------------------------------------------MGALHRAHGQ
PANCY_PROMM      ------------MHQWRKHQQSS---------------------VHFVPTMGALHRGHGQ
PANCY_SYNS3      --------------------------------------------MHFVPTMGGLHHGHAS
PANCY_SYNPW      --------------------------------------------------MGGLHQGHAR
PANCY_SYNSC      -----------------------------------------------MPTMGGLHQGHGE
PANCY_SYNPX      -----MLSTQAELAAFHSGLGQP---------------------LQFVPTMGGLHQGHGE
PANCY_SYNS9      -----------------------------------------------MPTMGALHAGHGT
PANCY_SYNR3      ---MKLQTSADLQRWLQAGGPGP---------------------LHLVPTMGALHQGHAA
PANCY_PROM1      -MVRKIFQTNAELKDWLSEQ---------------------NSAIIFIPTMGGLHPGHQY
PANCY_PROMT      -MVRKIFQTNAELKDWLSGQ---------------------NSAIIFIPTMGGLHPGHQY
PANCY_PROMA      -MNLTILRTKTALEDWCRQKH--------------------NHEINFVPTMGGLHQGHQE
PANCY_PROM2      -MKKVIIRKTEEIENWKRNI---------------------NNEINFIPTMGNLHNGHIK
PANCY_PROM0      -MKKVIIRKTEEIENWRRNI---------------------NSEINFIPTMGNLHDGHIK
PANCY_PROMS      -MKKLIIRKTEEIENWRKDI---------------------DSEINFIPTMGNLHDGHIK
PANCY_PROM9      -MKKVIIRKTEEIKNWRRNI---------------------NSDINFIPTMGNLHNGHKT
PANCY_PROMP      -MNKIIIRKTEDLKEWRRNL---------------------KCDINFIPTMGNLHDGHQK
                                                                   ** ** .*  

PANCY_SYNJB      LIRRCRQ-ECD----HTVVSIFVNPLQFGPNEDWDRYPRDEEGDRALCEAAGVDVVFAPD
PANCY_SYNJA      LIRRCRQ-ECD----HTVVSIFVNPLQFGPNEDWDRYPRDEEGDRALCEAAGVDVVFAPD
PANCY_GLOVI      LIARARR-ENT----VLVVSIFVNPTQFGSSEDLSRYPRPLEADLELCRHEGVDLVFAP-
PANCY_SYNP6      LIERSRQ-QDD----VVIVSIFVNPRQFGPQEDLSRYPQTLDADLALCEAAGVDAVFCPT
PANCY_SYNE7      LIERSRQ-QDD----VVIVSIFVNPRQFGPQEDLSRYPQTLDADLALCEAAGVDAVFCPT
PANCY_ACAM1      LIQRARQ-ENQ----CVIVSIFVNPLQFAAHEDLTEYPQTLNQDQALCQEQGVNTIFAPS
PANCY_THEEB      LIRRARQ-ECD----VVVVSIFVNPLQFGPQEDLERYPRALEADTALCQQLGVDLLFVPS
PANCY_SYNY3      LLKRAVA-EMD----LVVLSIFVNPLQFGPGEDLEKYPRDFDGDRQWAESLGVAVIFAPT
PANCY_TRIEI      LIKRARE-ENT----ITVVSIFINPLQFAPREDFKEYPRQLEIDKEFCEKEGVDVIFAPT
PANCY_NOSS1      LIERARH-ENS----TVIVSIFINPLQFGPNEDYGRYPRTLEQDRQLCEQGGVDAIFAPS
PANCY_TRIV2      LIERARH-ENS----TVIVSIFINPLQFGPNEDYGRYPRTLEQDRQLCEQAGVDAIFAPS
PANCY_PROM3      LIKSVQG-FGSLQPAAVLVSVFVNPLQFGPAEDFDSYPRDLEADCELASRSGASALWAPS
PANCY_PROMM      LIKSVHG-FGRLQPAAVLVSVFVNPLQFGPAEDFDSYPRDLEADCELASRSGASALWAPS
PANCY_SYNS3      LISAASC-HKS-GDVETLVSVFVNPLQFGPNEDFARYPRTFEADCELAELSGASAIWCPD
PANCY_SYNPW      LIATAVT-SCG-GKGSVLVSTFVNPLQFGVDEDFDCYPRTFEDDCALAEQAGASALWCPD
PANCY_SYNSC      LIRRASE-QGP-----VLVSVFVNPLQFGPAEDFDRYPRTLEADRGLAECCGAHALWAPS
PANCY_SYNPX      LIRRAAE-QGP-----VLVSVFVNPLQFAPGEDFERYPRSLEADLALADRYGAAALWTPT
PANCY_SYNS9      VIRAASA-MGP-----VLVSVFVNPLQFGPDEDLARYPRSLESDLVVAERWGAAALWAPS
PANCY_SYNR3      LIRAARQ-QGG----RVLVSVFVNPLQFSPNEDFARYPRRLEEDHALALEAGADALWAPQ
PANCY_PROM1      LIQKAKE-RKTNTNQIILVSIFVNPLQFSKGEDFKKYPRNINRDAELAFSAGADAIWAPD
PANCY_PROMT      LIQKAKE-KKTNTNQIILVSIFVNPLQFSKGEDFKKYPRNIKRDAELAFSAGADAIWAPE
PANCY_PROMA      LIKTARSFCKRKHSSQVLVSIFINPLQFDLEEDFKKYPRTFENDCKIAYEAGANAIWAPS
PANCY_PROM2      LISTAKN----DNSNVNLVSIFINPLQFDNKLDLENYPKTIDNDIKISFSNGADAIFIPS
PANCY_PROM0      LISTAKN----DNSNVNLVSIFINPLQFDNKLDLENYPQTIDNDIKISFSNGADAIFIPS
PANCY_PROMS      LISTAKN----DNSNINLVSIFINPLQFDNKLDLENYPKTIDNDINISFSNGADAIFIPS
PANCY_PROM9      LISTAKN----ANSNVNLVSIFVNPLQFDNKSDLENYPKTIDNDIKISFENGADVIFIPS
PANCY_PROMP      LISTAQS----SNCNTNLLSIFVNPLQFDSKEDLKSYPKTVDKDIEIAFSNGADAIFIPN
                 ::               ::* *:** **    *   **:  . *   .   *.  :: * 

PANCY_SYNJB      PQEMGADPA----TGSDRTWVMPPESLLQTLCAPHRPGHFRGVATIVLQLLNLVQPQRAY
PANCY_SYNJA      PQEMGADPA----TAGDRTWVMPPESLLQTLCAPHRPGHFRGVATIVLQLLNLVQPQRAY
PANCY_GLOVI      PE---SELY----PLGSGTKVVPDPALTEVMCGLSRPGHFSGVATVVAKVMNLVQPVRAY
PANCY_SYNP6      AEALYPRPS----DRS--TGVQPPAELIQSLCGRQRPGHFQGVATVVLKLLQLVQPQRAY
PANCY_SYNE7      AEALYPRPS----DRS--TGVQPPAELIQSLCGRQRPGHFQGVATVVLKLLQLVQPQRAY
PANCY_ACAM1      TDTLLADA--------PLTQVIPPASLTEYLCGPHRPDHFTGVATIVLKLLNIVQPTRAY
PANCY_THEEB      VAELYPTGM------KHLTVVEPPRELTEHLCGRSRPGHFRGVATIVLKLLHLVQPDRAY
PANCY_SYNY3      VTDLGI------DAKGDQTTVLPPPAMTEVLCGAHRPGHFQGVATIVTKLFTIVCPDVAY
PANCY_TRIEI      PETMGMKNALSTDAQDSTTTVVSPSHMTSIMCGVSRPNFFQGVATIVTKLLNIVKPNNAY
PANCY_NOSS1      PEELGIPQ--KNIQESQVTQVIPPSVMISGLCGHSRLGHFQGVATIVTKLLNLVQPDRAY
PANCY_TRIV2      PEELGIPQ--KNIQESQVTQVIPPSVMISGLCGHSRLGHFQGVATIVTKLLNLVQPDRAY
PANCY_PROM3      VDQVFPGG------ASSQFRIQVPSHLQAHLCGAIRPGHFDGVVTVVARLLALVRPEVLV
PANCY_PROMM      VDQVFPGG------ASSHFRIQVPSHLQAHLCGASRPGHFDGVVTVVARLLALVRPEVLV
PANCY_SYNS3      ESQIYPGG------SAESWRIQAPKSLQSRLCGSTRPGHFDGVVTVVCRLLALAKPHQLF
PANCY_SYNPW      ERQVYPYG------TSEGWRLQAPARLTAHLCGPWRSGHFDGVVTVVMRLLGLVRPHQLW
PANCY_SYNSC      VDAIYPSG------LPSAVSRSAPAGLQTHLCGASRPGHFDGVVTVVARLLQLVEPSCLW
PANCY_SYNPX      VQTIYPDG------ATADSARQAPAALQQHLCGADRPGHFDGVVTVVARLLELTRPAGLW
PANCY_SYNS9      VEQIYPQGG-----ERHPSTIQVPPGLQKHLCGAARPGHFDGVVTVVARLLDLVRPRQLW
PANCY_SYNR3      PEDVFPAG------AAGLTQLAPAPELVANLCGPSRPGHFEGVCTVVSRLLALVQPSHLH
PANCY_PROM1      YDEVFPGGAD------SHFKIEVPKTLHNQLCGAERKGHFDGVATVIIRLIKIIKPKKLV
PANCY_PROMT      YDEVFPGGAD------SHFKIEVPKTLHNQLCGAERKGHFDGVATVIIRLIKIIKPKKLI
PANCY_PROMA      FESVFPNGEE------AHFKIQVPFSLNKYLCGASREGHFDGVATVVVRLLALVRPNRIF
PANCY_PROM2      NEDIYPPNNK------NIKFLKAPIELSSALCGLNRIGHFDGVCTVVYRLLNLIKPKNLY
PANCY_PROM0      YEDIYPPNNK------NIKFLKAPKELSSALCGLNRIGHFDGVCTVVYRLLNLIKPKNLY
PANCY_PROMS      NEDIYPPNN-------NISFLKAPIELSSALCGLNRIGHFDGVCTVVYRLLNLIKPKNLY
PANCY_PROM9      TEEIYPSDNK------NITFLKAPLELSSSLCGLNRIGHFDGVCTVVYKLLNLIKPKNLY
PANCY_PROMP      VTDIYPKKNK------SISYLKASKELSSALCGLTRVGHFDGVCTVVYRLLKLIQPKNLF
                                           :   :*.  * ..* ** *:: ::: :  *    

PANCY_SYNJB      FGQKDAQQLAIIQRLVRDLQIPTTIVPCSTVREADGLACSSRNRYLSAAERQVAAGLYRA
PANCY_SYNJA      FGQKDAQQLAIIQRLVQDLQIPTTIVPCPTVREADGLAYSSRNRYLSAVERQVAASLYRA
PANCY_GLOVI      FGQKDAQQVAVIKSVCCDLNIGGRIVVCPTVHDPDGLALSSRNVYLSSAQRSTALALPRA
PANCY_SYNP6      FGEKDAQQLRVIQRLVEDFNLPIAIVPCPTVREPDGLALSSRNRYLTFEERSQASGLYRA
PANCY_SYNE7      FGEKDAQQLRVIQRLVEDFNLPIAIVPCPTVREPDGLALSSRNRYLTFEERSQASGLYRA
PANCY_ACAM1      FGQKDAQQLAIIQRLVQDFNLDVTIVPCKLIRDATGLALSSRNQYLNAQEAQQATILHHS
PANCY_THEEB      FGQKDAQQLAIIRRCVADLNLDVEIIGCPIVRDADGLALSSRNQYLSAEERATALALSQS
PANCY_SYNY3      FGAKDAQQLAIIRRLVQDLNLTVTIRSCATVREESGLAMSSRNQYLSPIEKEQATVLYRS
PANCY_TRIEI      FGQKDAQQLAIIKQLVKDLSLPVNIVYCPIIREASGLAISSRNQYLTPEQKEQASMLYAS
PANCY_NOSS1      FGQKDGQQLAVIKRLVADLDLPVEIVACPTVREASGLACSSRNQYLTAQEKQQAAVLYRG
PANCY_TRIV2      FGQKDGQQLAVIKRLVADLNLPVEIVACPTVREASGLACSSRNQYLTAPEKQQAAVLYRG
PANCY_PROM3      LGEKDWQQLVILRHLVAQLGLPVRVHGVATVRDDDGLACSSRNRYLMTQQRQQALALPQL
PANCY_PROMM      LGEKDWQQLVILRHLVAQLGLPVRVHGIATVRDDDGLACSSRNRYLMTQQRQQALALPQL
PANCY_SYNS3      LGEKDWQQLTILRRMVLDLGLAVRVRGVPTVRDGDGLASSSRNRYLNAQQRQQGVLFAQV
PANCY_SYNPW      LGEKDWQQLTILRHLVNDFGLRVRVRGCPTVREGDGLAASSRNRYLGDAQRTVASAFSSA
PANCY_SYNSC      LGEKDWQQLVILRRLVVDLDLGVVVKGVPTVRESDGLALSSRNQYLFPADRARAAALPAA
PANCY_SYNPX      LGEKDWQQLVILRQLVADLVLPVKIHGVATVREADGLALSSRNQYLSAAQRLQAAALPAA
PANCY_SYNS9      LGEKDWQQLVILRWLVAHLARPVIVQGVATVREADGLALSSRNQYLSPDQRRMAAALPEA
PANCY_SYNR3      LGEKDWQQLQVLRRLVRDLRWPVQIVPCPTLRERDGLPLSSRNAYLSVEQRQQAALLPQA
PANCY_PROM1      LGEKDWQQLIIIRKLFQELSIPVKIESYSTQRDQSGFAYSSRNSYLSDSERVNAQSLPNA
PANCY_PROMT      LGEKDWQQLIIIRKLFQELSIPVKIESYSTQRDQSGFAYSSRNSYLSDSERVNAQSLPNA
PANCY_PROMA      LGEKDWQQLVILRQLINDLGLPVLIHSIPTKRDQDGLPCSSRNVNLSKEERKKVVALPAV
PANCY_PROM2      LGEKDWQQLLILKNLVLKEKLNVAIKSIPTQRDFDGIPLSSRNVHLSKNERKLIRFFSSE
PANCY_PROM0      LGEKDWQQLLILKNLVLRKNLNVAIRSIPTQRDFDGIPLSSRNVHLSKNERKLISFFSSE
PANCY_PROMS      LGEKDWQQLLILKNLVLRKKLNIAIKSIPTQRDFDGIPLSSRNVHLSKNERKLISFFSRE
PANCY_PROM9      LGEKDWQQLLILKNLVLTKKLDVAIKSIPTQRDFDGIPLSSRNVHLSNNERKLIRFFSHE
PANCY_PROMP      LGEKDWQQLLIIKNLIEEKKFNIKIIPVPTQRDSDGVPFSSRNKHLSKSERKSLKLFSNE
                 :* ** **: :::           :      ::  *.. ****  *   :      :   

PANCY_SYNJB      LRRGYDHWQAGD---PSAEGILAAARAELEHTPELQLQYLELVDPQTLQPLPRV----ED
PANCY_SYNJA      LRRGYDHWQAGD---PSAEGILAAARAELERTPELRVQYLELVDPQTLQPLSEV----KD
PANCY_GLOVI      LDKAAHLWAGGE---RQASELERAVRSVLASEPGLEIEYVAAVDPERLAPRQDN----AG
PANCY_SYNP6      LRAAAECFQAGS---RDSQELVAAATAVLATTPAVQLEYCDCVDADSLQPLTQI----PD
PANCY_SYNE7      LRAAAECFQAGS---RDSQELVAAATAVLATTPAVQLEYCDCVDADSLQPLTQI----PD
PANCY_ACAM1      LQAARHTFQGGS---CDRNSVLATVAQTLAKGPQVEVEYIDLVDPVTLQPLEQI----TT
PANCY_THEEB      LEVAQAAFRQGC---WDASLLLAQVQDHLRQFPQLRLDYAELVHPQTLVPLERI----ET
PANCY_SYNY3      LQAAQQRYRQGD---RQVSALLTATQDVLDAEPSVQVQYLQLVEADTLQPITGTLP-DQN
PANCY_TRIEI      LCYGRKIFLENQDTPNILETVENAVKEKLASQPVLKLEYLEIVDPETLKPLENI----QN
PANCY_NOSS1      LLQAEAAFKAGV---RYSSRLREVVRQELAKVSSVLVEYIELVEPTTLMPLDKI----QE
PANCY_TRIV2      LLQAEAAFKAGV---RYSSRLREVVRQELAKVSSVLVEYIELVEPTTLMPLDKI----QE
PANCY_PROM3      LARAARESQDGR---AVDLAGL---RCAWEQL-GLEVEYVETVDAFNLQPLHAGRK----
PANCY_PROMM      LARAARESQDGR---AVDLAGL---RCAWEQL-GLEVEYVEKVDAFNLQPLHAGRK----
PANCY_SYNS3      LSDARSACLHGG---TALKPGE--VKRRLEEV-GLSVEYVDVVDPWFLQPSKSNQSS---
PANCY_SYNPW      LCATARDVCAGS---VDEASAQVALRQQLREA-GLEVEYVETVDPVTLQPARPGRS----
PANCY_SYNSC      LRHA--DPSDPE---SSV-------RQSLAKA-GLEVEYVERVDPRTLQPCGPETA----
PANCY_SYNPX      LRAA--DGTTPL---DVT-------RSRLSAA-GLEVEYVERVDPQSLQPCGSETA----
PANCY_SYNS9      LHAARGDGSDPI---PAL-------RGSLSDA-GFEVEYVQRVDPCTLQPCGDETA----
PANCY_SYNR3      LAQGQQLLDAGQ---RQAEPLLRAVRALMEDG-GLAVDYLQLVDLPRLQELEQVTG----
PANCY_PROM1      IKEAKTEFDKGK------VINLTKIASIFKEN-NLKIEYLKIVDPFSLKETEN----INR
PANCY_PROMT      IKEAKTEFDKGK------VINLTKIASIFKEN-NLKIEYLKIVDPFSLKETEN----INR
PANCY_PROMA      LQQAAQAFQENK------PINLNNMKTTLEEH-DLKVEYLETVDLKNLNPVNHD---ESK
PANCY_PROM2      LLEAKKNFQQEK------NINLNEIIKKLSAK-KISIEYLEHLHPHTLQKARL----EDN
PANCY_PROM0      LLEAKKIFQQDK------KINLNQIIKKLSAK-KISVEYLEHLHPHTLQKARP----EDN
PANCY_PROMS      LLEAKKNFQKEK------KINLKEIIKKLSEK-KISIEYLEHLHPYTLQKAKI----EDN
PANCY_PROM9      LLVAKENFQQEK------KINLKEIIQKLSAQ-KISIEYLEHLHPYTLQESKV----EDN
PANCY_PROMP      LENAKIIFKKDK------RIDLKQLTNKLKSK-NISIEYLEHLHPYSLKKVQS----NDN
                 :                                 . ::*   :.   *            

PANCY_SYNJB      KGLLAIAAYVGQTRLIDNLLLSPEQGDPLPERVQHAAPPSSGTTSPPRRPLIAIDGPAGA
PANCY_SYNJA      KGLLAIAAYVGQTRLIDNLLLSPEGVDPLPQEQQSAVPPSP---KRGRRPLIAIDGPAGA
PANCY_GLOVI      PVLVAAAVRVGSTRLIDNVVLGQHHE---------------------RRPIIAIDGPAGA
PANCY_SYNP6      RALLAIAARVGTARLIDNLTLQ------------------------GRRPIIAIDGPAGA
PANCY_SYNE7      RALLAIAARVGTARLIDNLTLQ------------------------GRRPIIAIDGPAGA
PANCY_ACAM1      QGLVAIAARVGSARLIDNMLLDA------------------------RLPILAIDGPAGA
PANCY_THEEB      VGLLAIAGWVGQTRLIDNCLLDR------------------------RRPILAVDGPAGA
PANCY_SYNY3      PVLMAIAAYVGSTRLIDNLVLNH------------------------RLPIIAIDGPAGA
PANCY_TRIEI      IGLLAIAAYIGSCRLIDNILLRN------------------------RKPIIAIDGPAGA
PANCY_NOSS1      EGMLAIAARLGSTRLIDNTILRD------------------------RQPIIAIDGPAGA
PANCY_TRIV2      EGMLAIAARLGSTRLIDNTILRD------------------------RQPIIAIDGPAGA
PANCY_PROM3      LCLLAAAVRCGETRLIDHTFLMS------------------------RQPIVAIDGPAGA
PANCY_PROMM      LCLLAAAVRCGETRLIDHTFLMS------------------------RQPIVAIDGPAGA
PANCY_SYNS3      LTLLAAAVRCGSTRLIDHAFLMT------------------------RSPLVAIDGPAGA
PANCY_SYNPW      IRLLAAAVRCGETRLIDHVFIMT------------------------RSPIVAIDGPAGA
PANCY_SYNSC      ISLLAAAVRCGTTRLIDHVFLMT------------------------RQPLVAIDGPAGA
PANCY_SYNPX      LSLLAAAVRCGTTRLIDHSFLMT------------------------RQPLVAIDGPAGA
PANCY_SYNS9      ISLLAAAVRCGSTRLIDHAFLMT------------------------RQPLVAIDGPAGA
PANCY_SYNR3      PALLAAAVRCGEARLIDHRVLMS------------------------RLPILAIDGPAGA
PANCY_PROM1      LCLLAVAVKCGSTRLIDHTFLMH------------------------RKPIIAIDGPAGA
PANCY_PROMT      LCLLAIAVKCGSTRLIDHTFLMH------------------------RKPIIAIDGPAGA
PANCY_PROMA      LCLLAAAVHCGNTRLIDHGFLMK------------------------RNPIVAIDGPAGA
PANCY_PROM2      ISLLAGAIRCGETRLIDHVFLMK------------------------RRPIIAIDGPAGS
PANCY_PROM0      ISLLAGAIRCGETRLIDHVFLMK------------------------RRPIIAIDGPAGS
PANCY_PROMS      ISLLAGAIRCGETRLIDHVFLMK------------------------RRPIIAIDGPAGS
PANCY_PROM9      ISILAGAIRCGETRLIDHVFLMK------------------------RSPIIAIDGPAGS
PANCY_PROMP      ISILAGAIKCGKTRLIDHVFLMK------------------------RKPIIAIDGPAGS
                   ::* *   *  ****:  :                          * *::*:*****:

PANCY_SYNJB      GKSTVARAVAAQLQLLYLDTGAMYRAITWLALQRGIPLDDAEQLTQLAAQTQLTLQ--SG
PANCY_SYNJA      GKSSVARAVAAQLQLLYLDTGAMYRAITWLALQRGIPLDDAEQLTQLAAQTQLTLQ--SG
PANCY_GLOVI      GKSTLARRLAQRLGFLYIDTGAMYRAVTWRAMQERIDPLDGERLSALTRAVRIRLA--PG
PANCY_SYNP6      GKSTVTKRLAQQLGLLYLDTGAMYRAVTWLVQQQGIDPQDPIVLAELLAQADLQLRSQPA
PANCY_SYNE7      GKSTVTKRLAQQLGLLYLDTGAMYRAVTWLVQQQGIDPQDPIVLAELLAQADLQLRSQPA
PANCY_ACAM1      GKSTVTRRCAQAIGLQYLDTGAMYRAVAWLALDQQVEVSDPFAIADLVEDCQIELKP--H
PANCY_THEEB      GKSTVTRLAAQALGLRYLDTGAMYRAVTWWCLENNLDLHDEPAIVEAIAHCRLHLES---
PANCY_SYNY3      GKSTVTRQVADGLGLTYLDTGAMYRALAWLILDQGIAPEDEPAVAELTSGAEIELMP--R
PANCY_TRIEI      GKSTVTKLVGQSLGLLYLDTGAMYRAVTWMVLQSGVPVTDQAQVAELVSQCQISFN----
PANCY_NOSS1      GKSTVARQVATKLGLVYLDTGAMYRAVTWLVLQQGIAIDDDCAIAELASKCKIELTP--S
PANCY_TRIV2      GKSTVARQVATKLGLVYLDTGAMYRAVTWLVLQQGIAIDDDCAIAELANNCKIELTP--S
PANCY_PROM3      GKSTVTRAFAERLGLLYLDTGAMYRAVTWLTQQHDVDPHDPVAVKTILENLELELEP---
PANCY_PROMM      GKSTVTRAFAERLGLLYLDTGAMYRAVTWLTQQHDVDPHDPVAVKTILENLELELEP---
PANCY_SYNS3      GKSTVTRAFAERLGLVYLDTGAMYRAVTWLVLEQGGDPGDSEAVDLVLNDLKVELEP---
PANCY_SYNPW      GKSTVTRAFAERMGLLYLDTGAMYRAVTWWVQSNGADPSSAPAVEALLEGLEVDLSP---
PANCY_SYNSC      GKSTVTRAFAERMGLVYLDTGAMYRSVTWLVQQNGVDHQDAVSIAPLLNDLDLQLKS---
PANCY_SYNPX      GKSTVTRAFAERLGLIYLDTGAMYRAVTWLVQQQGVEPGDAAAVDALLRALDLQLQS---
PANCY_SYNS9      GKSTVTRAFAERLGLVYLDTGAMYRSVTWLVLERGVNPSDGVAIEPLLKDLDVQLQS---
PANCY_SYNR3      GKSTVTRQVAHELGLTYLDTGAMYRGVTWLLQQRGFEPQEGEPLQALLADLELRFGP---
PANCY_PROM1      GKSTVTKAFAKKLGFIYLDTGAMYRAVTWLIISNSIDPNDQVEIKNILKDSKLEFKS---
PANCY_PROMT      GKSTVTKAFAKKLGFIYLDTGAMYRAVTWLIISNSIDPNDQAEIKNILKDSKLEFKN---
PANCY_PROMA      GKSTVTKKFAQKLGLIYLDTGAMYRAVTWLIQENNIDPQNSSELELILNDINLDICL---
PANCY_PROM2      GKSTVTKLIAKKLKLLYLDTGAMYRALSWLLLKENIDYKKEKKLLNIFKDISIVFKS---
PANCY_PROM0      GKSTVTKLIAKKLNLLYLDTGAMYRALSWLIIKESVDYKIEKKLQNILKDISIFFKS---
PANCY_PROMS      GKSTVTKLIAKKLKLLYLDTGAMYRALSWLIIKENIDFKKENKLQNILKDISIVFKS---
PANCY_PROM9      GKSTVTQLIAKKLKLLYLDTGAMYRALSWLLIKENIDYKEEKKLQNILKDISIVFKS---
PANCY_PROMP      GKSTITKLIAKELNLLYLDTGAMYRAISWLFKKEKIDYAKESELKKILNNISIIFKS---
                 ***::::  .  : : *:*******.::*   .          :        : :     

PANCY_SYNJB      TSSTEPTRIWADGEEITQAIRSPEVTRWVSHVAAVPGVRQELVKRQRSIGRDGGAVLEGR
PANCY_SYNJA      PSADEPTRIWADGEEVTQAIRSPEVTRWVSQVAAVPGVRQELVKRQRLIGRDGGAVLEGR
PANCY_GLOVI      YQSAFPTRVWVDGEEVTRAVRDEAVSLHVSAVSSHPGVRSELVAQQRRIGEAGGVILDGR
PANCY_SYNP6      ADGSEQLQVLIQGNDVTAAIRTPTVTAQVSAIAALPLVRQFLVEQQRQLGQRGGLVAEGR
PANCY_SYNE7      ADGSEQLQVLIQGNDVTAAIRTPTVTAQVSAIAALPLVRQFLVEQQRQLGQRGGLVAEGR
PANCY_ACAM1      ADPQQQPQVWVNHQEVTQAIRTPDVTALVSAVAAQPPVREALVKQQQRLGRQGGLIAEGR
PANCY_THEEB      PDPHQPTRVWINDREVSQAIRSLEVTQRVSQIAALRGVRRLMVQQQRAIGAHGGIAAEGR
PANCY_SYNY3      PAPQLT-GVKVNGQDVSDAIRTPAVTQLVSTIAAQGAVRAKLLKLQRKYGDQGGIVAEGR
PANCY_TRIEI      -SPENN-HVVINGQDVTVAIRSREVTNNVSIVAAQPTVRYFMVKQQQQFGAKGGIVAEGR
PANCY_NOSS1      QDLQSPVRVWINDTDVTQNIRTIEVTSQVSAIAAQAAVRQALVKQQQRWGKRGGLVAEGR
PANCY_TRIV2      QDLQSPVRVWINDTDVTQDIRTIEVTSQVSAIAAQAAVREALVKQQQRWGKRGGLVAEGR
PANCY_PROM3      -SQSGPQKVRINGHDVTEAIRSPEVTSSVSVVAAHGCVRKALTAQQQRMGVRGGLVAEGR
PANCY_PROMM      -SQSGAQTVRINGHDVTEAIRSPEVTSSVSVVAAHGCVRKALTAQQQRMGVRGGLVAEGR
PANCY_SYNS3      -LQQGVQVVRVNGHEVTDAIRDPRVTASVSAVASHACVRAAMTAQQQRMGKAGGLVAEGR
PANCY_SYNPW      -LKDGVQTVRVNGRDITDAIRDPEVTGSVSLVAAHPCVRALLTKQQQRLGERGGLVAEGR
PANCY_SYNSC      -LPGGGQQVLVNGQDVSDAIRSPEVTASVSAVAAHRCVRQALTAQQKAMGAKGGLVAEGR
PANCY_SYNPX      -LPGGGQQVMVNGEDVSQAIRSPEVTGSVSVVAAHRCVRQALTTQQKAMGAKGGLVAEGR
PANCY_SYNS9      -LPGGVQQVLVNGEDVSSAIRSPDVTASVSAVAAHRCVRQALTVQQKSMGSKGGLVAEGR
PANCY_SYNR3      -ASGTEQTLLVNGVDATSAIRTAEVTASVSAVAALPSVRAALTQQQQQLGQQGGLVAEGR
PANCY_PROM1      -SSFVEQKIFINNIDVTEKIRSPKVTSMVSEIAKQQFVRELLTRKQQVIGNNGGLVAEGR
PANCY_PROMT      -SSFVEQKIFINNIDVTEKIRSPQVTSMVSEIAKQQFVREVLTRKQQVIGNNGGLVAEGR
PANCY_PROMA      -SNTGNQQVLINGKDITTLIRSPTVTSQVSLVAAIGSVREKLTSQQKELGSKGGLVAEGR
PANCY_PROM2      -NTNSHQDVYVNNCCVTEEIRSQKISSIVSKISSIKEVRKFLVEEQRKIGESGGLVAEGR
PANCY_PROM0      -NTNSHQDVYVNNYCVTKEIRSQKISSIVSKISSIKEVRKFLVAEQRKIGESGGLVAEGR
PANCY_PROMS      -NTSSHQDVYVNNYCVTEEIRSQKISSIVSKISSIKEVREFLVEEQRKIGESGGLVAEGR
PANCY_PROM9      -NTNSQQDVFINNYCVTEEIRSQEISSIVSKISSIKEVREFLVEEQRKIGESGGLVAEGR
PANCY_PROMP      -NSISQQDVFINNFCVTEEIRSQEISSIVSKISSIKKVREFLVYEQRKIGQSGGLVAEGR
                         :  :    :  :*   ::  ** ::    **  :   *:  *  **   :**

PANCY_SYNJB      DIGTHVFPDAELKVFLTASVGERAQRRQHQLQAQGQMVP-LEELKAQIEQRDRRDSERLI
PANCY_SYNJA      DIGTHVFPDAELKVFLTASVGERAQRRQHQLQAQGQVVS-LEELKAQIEQRDRRDSERLI
PANCY_GLOVI      DIGTHVFSRAELKIYLTASVEERALRRADDLKAKGLPVPDIEVLKEQIRSRDNQDMSRAY
PANCY_SYNP6      DIGTHVFPDAELKIFLTATNAERARRRALDLEAQGLTVD-LAQLEAEIRDRDRQDSERAI
PANCY_SYNE7      DIGTHVFPDAELKIFLTATNAERARRRALDLEAQGLTVD-LAQLEAEIRDRDRQDSERAI
PANCY_ACAM1      DIGTNVFPDAGLKIFLTASIEERARRRQQDLKNQNLPPQTQSELEDLIASRDQQDSQREF
PANCY_THEEB      DIGTHVFPEAGLKIFLTASPEERAQRRWQELQQQGHCDLSYEELLAQITARDTADQQRPY
PANCY_SYNY3      DIGTQVFPNAELKIFLTASVQERARRRLKDFEAQGNQAVDLAQLEADIAHRDHLDSTRAI
PANCY_TRIEI      DIGSHVFPNAELKIFLTASLKERSRRRLVELKQKGQTNISLEEVEKEIICRDQKDTNRKI
PANCY_NOSS1      DIGTHVFPDAEVKIFLTASVGERARRRQQDFQKQGQPEVSLEQLEKDIAERDWKDSTRKV
PANCY_TRIV2      DIGTHVFPDAEVKIFLTASVGERARRRQQDFQKQGQPEVSLEQLEKDIAERDWKDSTRKV
PANCY_PROM3      DIGTAVFPDAELKVFLTASPAERARRRALDLDNRGFPVPDLAELETQIEERDRMDSTREV
PANCY_PROMM      DIGTAVFPDAELKVFLTASPAERARRRALDLDNRGFPVPDLAELETQIEERDRMDSTREV
PANCY_SYNS3      DIGTAVFPDAELKVFLTATPKERARRRALDLEARGHEVPALPELEAQIVERDRLDSTREV
PANCY_SYNPW      DIGTAVFPDADVKVFLTATPEERARRRAKDLEARGHAVPDLAALEAQIVERDRLDSTREV
PANCY_SYNSC      DIGTAVFPDADLKVFLTATVGERARRRALDLEQRGFPVPERSELEAQIAERDHLDSTREE
PANCY_SYNPX      DIGSAVFPDADLKVFLTATVAERARRRALDLEQRGFPVQERSELEAQIAERDHLDSTREE
PANCY_SYNS9      DIGTAVFPHADLKVFLTATVTERARRRALDLEQRGFAVPERAELEAQIAERDRLDSTREE
PANCY_SYNR3      DIGTAVFPDAELKIYLTATVAERARRRAADLAARSLPVPVLSQLEQEIADRDHKDSSREV
PANCY_PROM1      DIGTAVFPDADLKIFLTASPTERAKRRALDLHKRGYEFSSIEDLEKEIKERDKKDSERKI
PANCY_PROMT      DIGTAVFPDADLKIFLTASPTERAKRRALDLHKRGYEFSSIEDLEKEIKERDKKDSERKI
PANCY_PROMA      DIGTAVFPDAELKIFLTATAQERAKRRAIDLKKQGFSTPSLSELEKQIKERDRLDSSREI
PANCY_PROM2      DIGTTVFPNAELKIFLTASIDERAKRRKSDKQSKDSQEIDLDTLKELIEKRDFEDSNREI
PANCY_PROM0      DIGTTVFPHAELKIFLTASIDERAKRRKYDKNSKDSQEIDLYTLKELIKKRDFEDSNREI
PANCY_PROMS      DIGTTVFPHAELKIFLTASIDERAKRRKSDKNSKDLQEIDLHKLKELIKQRDSEDSNRKI
PANCY_PROM9      DIGTTVFPDAELKIFLTASIDERAKRRKSDKKSKDSQEIDLHKLKELIKKRDFEDSNREI
PANCY_PROMP      DIGTTVFPNAELKIFLTASIDERAKRRKSELDLRGTEEIDFNQLRELIRKRDFEDSTRKI
                 ***: **. * :*::***:  **: **  :   :.        :   *  **  *  *  

PANCY_SYNJB      SPLRPAPDAILIDTDHLSQSEVQDKIVMLYRQL-LERSGPARLDQ---------
PANCY_SYNJA      SPLRPAPDAILIDTDHLSQAEVEDKIVRLYRQL-LERSGAAHFDII--------
PANCY_GLOVI      APLRKADDAIEVNTDTFTVQDTLDRLLALYRDK-VGGSV---------------
PANCY_SYNP6      APLCKAEDAVEVLTDGLSIEAVTDQIIRLYRDRGLGDSSPQATPGQTPSPLSLG
PANCY_SYNE7      APLCKAEDAVEVLTDGLSIEAVTDQIIRLYRDRGLGDSSPQATPGQTPSPLSLG
PANCY_ACAM1      APLRKAYDAVEINTDGMTIEQVITRITTLYQERFPDRA----------------
PANCY_THEEB      APFRKAADAIEVCTDNLGIDEVVSKIVHLYRSRFPQP-----------------
PANCY_SYNY3      APLQKAVDAVEIITDNLTIAEVVETIIELYKKYNKG------------------
PANCY_TRIEI      SPLRKSSDAVEISTDGLSIGEVTQKIVDIFKTTCYGKSSVNNII----------
PANCY_NOSS1      SPLQKAADAVELQTDGLSISDVASQIVDYYQQRLSQW-----------------
PANCY_TRIV2      SPLQKAADAVELQTDGLSISDVASQIVDYYQQRLSQW-----------------
PANCY_PROM3      APLRQAEDATELISDGMSIEEVIETLIDLFRVQVPEEVWPTPGS----------
PANCY_PROMM      APLRQAEDATELISDGMTIEEVIETLIDLFRVQVPEEVWPTAGR----------
PANCY_SYNS3      APLLQADDAIELISDGMSIDQVIDALEDLFRRRVGEEVWPTPV-----------
PANCY_SYNPW      APLVQADDATELITDGMSIEAVIDALEDLFRFRVAKEIWPTPQG----------
PANCY_SYNSC      APLVQADDALELVTDGMSIEAVIDALVGQFRSRVGEEAWPTPAG----------
PANCY_SYNPX      APLVQAIDAVELVTDGMSIDAVIDALVEQFRARVPEEAWPTPAG----------
PANCY_SYNS9      APLMQADDAIELVTDGMDIDAVIEALVRLFRERVAEEAWPTPQR----------
PANCY_SYNR3      APLRQASDAVELLSDGLSIDEVVAQIVALFREWVPVEALNADA-----------
PANCY_PROM1      APLKKAQDAIELVTDGMNIEDVLKELIDIFRSKIPEEVWPTPNS----------
PANCY_PROMT      APLKKAQDAIELVTDGMNIEDVLKELIDIFRSKIPEEVWPTPNS----------
PANCY_PROMA      APLSKAKDAQELITDGMNIEEVVELLINIFREKIPQEVWPTNAT----------
PANCY_PROM2      SPLIKANDAIEIISDGYTINEVVDKIIDLYNDKIPKETEIK-------------
PANCY_PROM0      SPLIKANDAIEIITDGYTIDEVVDKIIDLYNDRIPKETEIK-------------
PANCY_PROMS      SPLIKANDAIEIITDGYSINEVVDKIIDLYNDKIPKESEIK-------------
PANCY_PROM9      SPLIKANDAIEIITDGCSINEVVDKIIDLYNDKIPKETQIR-------------
PANCY_PROMP      SPLKKANDAIELLTDGYSINEVVEKIVNIYNLNIPKEIQLE-------------
                 :*:  : **  : :*      .   :   :.