CLUSTAL format seed alignment for MF_01351

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUOI_POLNA       ---------------------MSAVAS------------VKDFVSSFMLTELLKGMALTG
NUOI_POLSJ       ---------------------MSTVAS------------VKDFVSSFMLTELFKGMALTG
NUOI_METPP       ---------------------MSAVAS------------IKEFFNTFFLLELLKGMKLTG
NUOI_ACISJ       ---------------------MAAVAASASFS-------IKDFFKSFMLWELAKGMALTG
NUOI_VEREI       ---------------------MTAVAA-APFS-------FKDFFKSFMLVELFKGMALTG
NUOI_PARXL       ---------------------MTAIQN---------------FFKTFFLTELLKGLALTG
NUOI_RHOFT       ---------------------MSTPTSNAIEIPNESAFSLKDFLSSFMLSELFKGLALTG
NUOI_CUPMC       --------------------MLLA---------------IKDFFNSLLLKELFKGMALTG
NUOI_RALSO       --------------------MLLA---------------IKEFFNSLLLKELFKGLALTG
NUOI_BORA1       ---------------------MEA---------------IKDFFGSLLLTELFKGMRLTG
NUOI_HERAR       ---------------------MEA---------------IKDFFGSLMLREMLKGMALTG
NUOI_AZOSB       ---------------------MGA----------------KDYIGSLFLKELVKGMALTG
NUOI_AROAE       ---------------------MGA----------------KDYIGSLFLTELIKGLALTG
NUOI_DECAR       ---------------------MGSM---------------KEIFNSLFLKELLKGMSVTG
NUOI_NITEC       ---------------------MER---------------IKRFLKSFLLFELLKGMKVTG
NUOI2_NITMU      ---------------------MNR---------------IKDFFRTFLLFELIKGMMLTG
NUOI_THIDA       ---------------------MRR---------------ITHFFGSLFLVELLRGMMLTG
NUOI_METFK       --------------------MISK---------------IKELFASFMLLELVKGMALTG
NUOI_NEIMF       ---------------------------------------MANLVKTFLLGELVKGMGVTL
NUOI_CHRVO       ------------------------------------MNSIRNFFKTFLLVELVKGLMVTG
NUOI_ALKEH       ---------------------MTA---------------LRDYVKSFLLVELLQGLRLTG
NUOI_HALHL       ---------------------MRP---------------LNDYLNSFLFTELLRGLRLTA
NUOI2_NITOC      ---------------------MNT---------------LRSYIKSFLLWELLLGLKLTG
NUOI_FRATN       ---------------------MRN---------------ITNFLKTFLLWELLKGLKVTG
NUOI_XYLFT       --------------------MMNR---------------VMHYFKSLLLLELLAGLWLTL
NUOI_RUTMC       ---------------------MIKK--------------LSKLVKDFTLSELRTGMKITA
NUOI_VESOH       ---------------------MIKK--------------LNKLIKNFTLNELRTGLKVTA
NUOI_HYDCU       ---------------------MIAF--------------IKHQVKTFGLIELFKGLAVTG
NUOI_LEGPA       ---------------------MKKVYH-----------YIIHYVRTYLLLELLAGLWLTV
NUOI_COXBU       ---------------------MRR---------------LKQIIKSFTLWELLKGLSLTL
NUOI_RHIL3       ------------------------------------MASLSGSISSLFLKEFVGAFFLSM
NUOI_AGRFC       ------------------------------------MASLSQAVNSLFLKEFVGAIFLTM
NUOI1_RHIME      -----------------------------------MMAGLSNAVSSLFLKEFVGAFLLSM
NUOI_CHESB       ------------------------------------MSALAQAAKSLLLKEFFGAVVLSM
NUOI_RHILO       -----------------------------------MMSALSQAAKSLLLQDFVSAFFLSM
NUOI_BRUSU       ------------------------------------MASITQAAKSLLLKEFASAFALSM
NUOI_BARBK       ------------------------------------MSGLIQAAKSLLLLEFVDAFFLAM
NUOI_BRADU       -------------------------------MRAVMGININATARSLLLSEFVSAFFLAM
NUOI1_RHOPA      -------------------------------------MNVTATARSLLLTEFVSAFFLAM
NUOI2_RHOP5      -------------------------------------MGVTTAARSLLLTEFVSAFFLAM
NUOI_CAUVC       -----------------------------------MFQRITQAVKGAALLDFAGAFGLAM
NUOI_HYPNA       -------------------------------------MSLAQTLRGALLTDFMGAAWIAV
NUOI_MARMM       ------------------------------------MGRIQQAFRGALLMDFWSAFGLGM
NUOI_RUEST       ----------------------------------MTQIDYTRAAKYFLLQDVWQGFKLGL
NUOI_ROSDO       ----------------------------------MTQVDYTRAAKYFLLQDFWVGMKLGM
NUOI_JANSC       ----------------------------------MTQIDYTRAAKYFLLADFFKGFKLGM
NUOI1_RHOS1      -------------------------------MARTSAIDYGRAAKYFLLLDFIKGFGLGM
NUOI_PARDP       -----------------------------------MAFDFARATKYFLMWDFIKGFGLGM
NUOI_SPHAL       ------------------------------------MSYVGHLVKSFTLWEFVKAHALTL
NUOI_ERYLH       ------------------------------------MTTATQLLKSFTLWEFLKAHALTL
NUOI_GRABC       ------------------------------------MALLDRTARSFLLTEIVSGMALTL
NUOI_MAGSA       ------------------------------------MSFLDRTARAFLLTELVQGLALTL
NUOI_RHORT       ------------------------------------MTSIVRTLRSLTLWELVSGMALTF
NUOI_RICBR       ---------------------------------------MINYLKSFFLYEIIRGLALTL
NUOI_RICTY       ---------------------------------------MINYLKSFFLYEIVRGLTLTL
NUOI_ANAMM       --------------------------------------MRRVMVLFGVVIAGVKGFMLTL
NUOI_ANAPZ       ----------------------------------MLYCVQFGRRVIRLVSATVHGFFLTL
NUOI_EHRCJ       -----------------------------MICKKKF--LSPIINLFHSIIINCKGMYITL
NUOI_EHRCR       -----------------------------MIYKKNFSKLSPITNLIRSALLNCRGMYITL
NUOI_EHRRW       -----------------------------MINKRSL--LASFINLPYSLFITFKGMYITL
NUOI_WOLPM       -----------------------------MTDTSFKYFMLKKLAWYWSFVELIKGFVITL
NUOI_WOLTR       --------------------------------------MLKKLAWYWSFVELIKGFIITL
NUOI_NEOSM       ---------------------------------------MFKFLSQMQLTRFFVGFRTVL
NUOI_PELUB       -------------------------------------MKISRIFKTIFLLDFLGGLNIAI
NUOI_MAGMM       -----------------------------------MGNAMKQLMASLALRELWQGMAVTL
NUOI_SULDN       MHNEHIEEHFNNRNVTELSSEYYMVDIAP--YPTDGWGKFTRTLRRAIRGELFVGLWVVL
NUOI_WOLSU       ---------------MDLKQKYIFIEGTN--CPVTVRGRLLQVFRRSVSGELFKGLWLVL
NUOI_CAMJR       -----------------MKNYYLVDEKRK--TPVSTWEKISQALRRSVKLELFVGLFVMM
NUOI_HELAH       ----------------MAKQEYKQLPKRA--EIHSATEQFKDTIKTSLGLDLFKGLGLTI
NUOI_HELHP       ---------------MKLHNDYRLLTPRINRDKQSFLARVIITLKTSFSLDLFSGLKTAL
NUOI_ECOLI       ---------------------------------------MTLKELLVGFGTQVRSIWMIG
NUOI_PECAS       ---------------------------------------MTLKELVVGFGTQIRSICMVG
NUOI_SODGM       ---------------------------------------MTLKELAIGCGTTLRSIWMIG
NUOI_PHOLL       ---------------------------------------MTLKELVVGFATQVRSIWMIG
NUOI_BAUCH       ---------------------------------------MTLKQLVTGCYTILRSIWMIG
NUOI_SHEON       ---------------------------------------MKILRIIQGVGTQLRSLSMVF
NUOI_AERS4       ---------------------------------------MKIINIIKGVGTQLRSLGMVF
NUOI_PSEPF       -------------------------------------MFKYIGDIVKGTGTQLRSLVMVF
NUOI_PSEAB       -------------------------------------MIKEIINVVHGTFTQLRSLVMIF
NUOI_CHRSD       ----------------------------------------MIKSLLEGTWSQLRTLGMVF
NUOI_ACIAD       -----------------------------------------MYKVLAGVGSIVRTLWMVF
NUOI_PSYCK       -------------------------------------MFTTIKKTVIGLFTIVRSMWMVN
NUOI1_NITOC      ---------------------------------------MLSPLKNISLGSELKSLWTVF
NUOI1_NITMU      ------------------------------------------------MWNSLKTMWIVF
NUOI_METCA       ------------------------------------------------MISQLRTLWIVL
NUOI1_RHOP2      ----------------------------------------------MIG--WLEAMLRVG
NUOI2_RHOPA      ----------------------------------------------MIGFGWLEALLRVG
NUOI1_RHOP5      ----------------------------------------------MKGFGWLEGLLRVG
NUOI2_RHOPB      ------------------------------------------------MIGWLEALLRVG
NUOI2_RHOS1      ------------------------------------------------MKGILDSILRVG
NUOI_BLOFL       --------------------------------------MMKLKEFFINIISIFRSVYMVG
NUOI_BLOPB       --------------------------------------MMKLKKVFIDIGSILRSIWMIG
NUOI_BUCBP       ---------------------------------------MILFKFFLACFSQIKSVWLTF
NUOI_BUCAI       ---------------------------------------MTLKNIIIGFFTQIRSIFMIG
NUOI_BUCAP       ---------------------------------------MTVKEIIIGFLLQIRSILMVF
NUOI_BUCCC       ---------------------------------------MNMKNIFLGFLSQIRSILMIF
NUOI1_GEOMG      ------------------------------------------MPIITDFKAIATGLFVTW
NUOI2_GEOSL      ------------------------------------------MPILTDFKAIATGLFVTW
NUOI_PELCD       ------------------------------------------MSLWKDIKGTILPFWVTL
NUOI2_SYNFM      -----------------------------------------MSSAWEAVRALASGFATTF
NUOI2_RHIEC      --------------------------------MSRAQDRIGTWIGWTFFADLANALTLTF
NUOI2_RHIME      --------------------------------MSRALDKAGRWIGWAFFADLANGLALTF
NUOI_DEIGD       ----------------------------------------------MGVLDIAKGMGVTL
NUOI_DEIRA       ----------------------------------------------MGVLDIAKGMGVTL
NQO9_THET8       ----------------------------------------------MTLKALAQSLGITL
NUOI_PARUW       -----------------------------------------MRTTIHKVITMMKGLIIVL
NUOI1_SYMTH      ---------------------------------------------MNGVAAIAKGMATTL
NUOI_FRAAA       ----------------------------------------------MGFFDPYKGFGVTF
NUOI_FRACC       ----------------------------------------------MGILDPYKGFGVTF
NUOI_SACEN       ----------------------------------------------MGVFDPIKGFGVTF
NUOI_THEFY       ---------------------------------------------MLEWLNPVKGFGVTF
NUOI_ACIC1       --------------------------------------------MPNILPGPLRGFGVTF
NUOI2_MYCPA      ---------------------------------------------MAKFLDAVAGFGVTF
NUOI_MYCUA       ---------------------------------------------MAKFLDSIAGFGVTF
NUOI_MYCTU       ------------------MANTDRPALPHKRAVPPSRADSGPRRRRTKLLDAVAGFGVTL
NUOI_MYCSJ       ---------------------------------------------MPKLWDAVAGFAVTF
NUOI_MYCS2       ---------------------------------------------MPKFLDALAGFAVTL
NUOI_MYCVP       ---------------------------------------------MPKFLDAVAGFGVTF
NUOI1_MYCPA      ---------------------------------------------MFTFLKLIAGFRVTF
NUOI_RHOJR       ---------------------------------------------MTKFLGPIAGFGVTF
NUOI_NOCSJ       -----------------------------------MAGSPEPKSMREQFWDPIAGFGVTF
NUOI1_STRAW      -------------------------------------MAEEPKETGPGFQNPVAGFGVTF
NUOI1_STRCO      ---------------------------------------MDHKGTDPGFMNPVAGFGVTF
NUOI_CUTAK       -------------------------------------------------MGAWSGFGITF
NUOI2_KORVE      ------------------------------------------MGYLRNIGAIAKGMGITF
NUOI1_SOLUE      -------------------------------------MANPIEEILGTAAAIAKGMGITF
NUOI1_ANADE      ------------------------------MPYQLENRP-PDLRESMYFPEIIRGIGTIT
NUOI_MYXXD       ------------------------------MAYKVSKDPRTDIRERTYVPNLLRGLGITA
NUOI_CAMFF       ----------------------------MAIKTKTIRRKKIPFLQRIYLPFIFAGMARTF
NUOI_PELPD       ------------------------------MKKEYWNKPTMDLWDRLYIFEVIRGLCITG
NUOI_BDEBA       ----------------------------------MSVMQNNSEKSKWFLPGILGGLATTM
NUOI_LEPIC       --------------------------MGTVNVVRVASRHKLSWYEKFYFYSIGKGLWITL
NUOI_CYTH3       --------------------------MQLTNRSKVVVDKKMTFMERIYIPSIVSGMMITL
NUOI1_GEOSL      -----------------------------------------------MIMPLINGLKITL
NUOI2_AQUAE      ------------------------------MIKKVAAK-PLSWLERIFFIDFIKGLRITL
NUOI1_AQUAE      -----------------------------MGVKKLSRKDYLNILESILFIDFLKGLSVTL
NUOI1_KORVE      -----------------------------------MSIAPLLRKVFLI--DLIKGLSITF
NUOI2_SOLUE      -------------------------------------MIELLKKIFLV--DLFQGLFVTF
NUOI2_SYMTH      -----------------------------------MGVTNFFGEAWRTGKSIVTGLGITF
NDHI_HORVU       ------------------------------MFPMVTGFMSYGQQTIRATRYIGQSFITTL
NDHI_WHEAT       ------------------------------MFPMVTGFMSYGQQTIRATRYIGQSFITTL
NDHI_AGRST       ------------------------------MFPMVTGFMSYGQQTIRATRYIGQSFITTL
NDHI_MAIZE       ------------------------------MFPMLTGFISYGQQTIRAARYIGQSFIITL
NDHI_CALFG       ------------------------------MFPMVTGFMNYGQQTVRAARYIGQSFMITL
NDHI_ACOCL       ------------------------------MFPMVTGFMNYGQQTVRAARYIGQSFMITL
NDHI_ILLOL       ------------------------------MFPMLNGFMNYGQQTVRAARYIGQSFMITL
NDHI_AMBTC       ------------------------------MFPMVTGFMNYGQQAVRAARYIGQSFMITL
NDHI_PLAOC       ------------------------------MLPMVTGFMNYGQQTVRAARYIGQSFMITL
NDHI_DIOEL       ------------------------------MFPMVTGFINYGQQTIRAARYIGQSFIITL
NDHI_LOTJA       ------------------------------MFLMVTGFMNYSQQTVRAARYIGQSFMITL
NDHI_POPTR       ------------------------------MFPMVTGFMNYGQQTVRAARYIGQSFMTTL
NDHI_MORIN       ------------------------------MFPMITGFMNYGQQTVRAARYIGQSFMITL
NDHI_BUXMI       ------------------------------MFPMITGFMNYGQQTVRAARYIGQSFMITL
NDHI_SPIOL       ------------------------------MFPMVTGFINYGQQTIRAARYIGQSFMITL
NDHI_CITSI       ------------------------------MFPMVTGFMNYGQQTIRAARYIGQSFMITL
NDHI_COFAR       ------------------------------MFPMLTEFINYGQQTIRAARYIGQGFMITL
NDHI_NICTO       ------------------------------MLPMITEFINYGQQTIRAARYIGQGFMITL
NDHI_NASOF       ------------------------------MLPMITGFINYGQQTLRAARYIGQGFMITL
NDHI_DAUCA       ------------------------------MFSMVTEFMNYSQQTVRAARYIGQGFMITL
NDHI_PELHO       ------------------------------MFPMVTGFMNYGQQTVRAARYIGQSLIITL
NDHI_PIPCE       ------------------------------MFPMITGFMNYGQQTVRAARYIGQSFAITL
NDHI_SOYBN       ------------------------------MFLMVSGFINYSQQTVRAARYIGQGFTITL
NDHI_PHAVU       ------------------------------MFLMVTEFINYSEQIIRAARYIGQGLMITL
NDHI_PHYPA       ------------------------------MFTMVNGFRNYSEQAIQAARYIGQGFMVTL
NDHI_ANTAG       ------------------------------MFSMVNGFRNYSQQAIQASRYIGQGFIVTL
NDHI_MARPO       ------------------------------MFSIINGLKNYNQQAIQAARYIGQGFLVTL
NDHI_ANGEV       ------------------------------MFAMVNGLRSYSQQAIQAARYIGQGFVVTL
NDHI_PSINU       ------------------------------MFSMMNGLQHYGQQALRAARYIGQSFMVTL
NDHI_HUPLU       ------------------------------MFSMVEGLQVYGQQTIQAAKYIGQGFMVTL
NDHI_STAPU       ---------------------------------MINGLKNYSQDALRAARYIGQGFFVTL
NDHI_ZYGCR       ---------------------------------MIKGLQNYSQQALRTARYIGQGFMVTL
NDHI_CHAVU       ------------------------------MFNFINSLKNYSQESFRAARYIGQGFIVTL
NDHI_CHAGL       ---------------------------------MFTGVQNYTQEVIKAAKYIGQGFTITL
NDHI_CHLAT       ------------------------------MFNFINNIQNYSKEAVQAAQYIGQGFMVTF
NDHI_MESVI       ------------------------------MFNFIDNVQTYSKEALQAAKYIGQGFMVTF
NDHI_NEPOL       ------------------------------MFDFLTSLQTYRQEAAQAAQYIGQGFGVTF
NDHI_ADICA       ------------------------------MFLAIIKFQNYGQQVLEAANYIGQGFAVTL
NDHI_TRIEI       ------------------------------MFKFLKQVSDYAKETFQSAKYIGQGLSVTF
NDHI_TRIV2       ------------------------------MLKFLKQVGDYAKEAVQAGRYIGQGLSVTF
NDHI_SYNY3       -----------------------------MFNNILKQVGDYAKESLQAAKYIGQGLAVTF
NDHI_SYNE7       ------------------------------MLKFLKQVGDYAKESLQAAKAIGQGLGVTF
NDHI_THEEB       -------------------------------MKFLNQITNYAKEAVQSAKYIGQGLSVTF
NDHI_SYNJB       -------------------------------MTFLKRVKEYVGDAFRAAKYIGQGMGVVF
NDHI_SYNJA       -------------------------------MTFLKRVGEYVSDAFKAAKYIGQGMGVVF
NDHI_GLOVI       ------------------------------MVKFLEKVGGYARDVLESAKYIGQGMGVVF
NDHI_PROM5       ------------------------------MKDFLQKVNSYIKEAFGAGKYLYDGLSVTF
NDHI_PROMP       ------------------------------MKDFLQKVNSYIKEAFSAGKYLYDGFTVTF
NDHI_PROM0       ------------------------------MKNFLQQINSYIKEAFNAGKYLYNGFSVTF
NDHI_PROMA       ------------------------------MGTFFQKIADYSKDAVSAGKYLLQGLAVTF
NDHI_PROMT       ------------------------------MLGFLEKVADYTKEAVSAAKYLVDGLGVTF
NDHI_SYNSC       ------------------------------MFGFLKQVGDYTRDAVDAARNLAQGFSVTF
NDHI_SYNPX       ------------------------------MFGFLKQVGDYTRDAVDAARNLAQGFSVTF
NDHI_SYNS9       ------------------------------MFGFLKQVGDYTRDAVDAARNLAQGFAVTF
NDHI_SYNS3       ------------------------------MFGFLKQVGDYTRDAVDAARNLTQGLSVTF
NDHI_SYNPW       ------------------------------MFGFLKQVGDYTRDAVDAARNLTQGLAVTF
NDHI_PROMM       ------------------------------MFGFLKKVVDYTRDAADAANYLIQGLAVTF
NUOI1_SYNFM      --------------------------------------MGNLKEILEGGWSLVEGMRVTF
NUOI_CARHZ       -------------------------------------------MTKLNGTGLLKGLAITF
NUOI2_STRAW      -------------------------------------------MAPIPGSGLAKGLAVTL
NUOI2_STRCO      -------------------------------------------MAPVPGSGLAKGLAVTL
NUOI2_ANADE      ---------------------------------MPQTVRAYTGAIRDTVKSFWHGLSITL
                                                                             

NUOI_POLNA       KYM-----------------------FSRKITIQFPEEKTP-----LSPRFRGLHALRRY
NUOI_POLSJ       KYM-----------------------FSRKITVQFPEEKTP-----LSPRFRGLHALRRY
NUOI_METPP       RHF-----------------------LSPAITVQFPEEKTP-----LSPRFRGLHALRRY
NUOI_ACISJ       RYT-----------------------FRRKVTVQFPEEKTP-----LSPRFRGLHALRRY
NUOI_VEREI       RHA-----------------------FRRKVTVQFPEEKTP-----LSPRFRGLHALRRY
NUOI_PARXL       RYT-----------------------FQRKVTVQFPEEKTP-----ISPRFRGLHALRRY
NUOI_RHOFT       KYA-----------------------FRSKITLEYPEEKTP-----LSPRFRGLHALRRY
NUOI_CUPMC       RYL-----------------------FARKITVQFPEEKTP-----MSPRFRGLHALRRY
NUOI_RALSO       RYL-----------------------FARKITVLFPEEKTP-----LSPRFRGLHALRRY
NUOI_BORA1       KYF-----------------------FKRKMTLRYPTEKTP-----ASPRFRGLHALRRY
NUOI_HERAR       RYM-----------------------FSRKITVQFPEEKTP-----QSPRFRGLHALRRY
NUOI_AZOSB       RHF-----------------------FARKITVQFPEEKTP-----QSARFRGLHALRRY
NUOI_AROAE       RHL-----------------------FARKITVQFPEEKTP-----ASPRFRGLHALRRY
NUOI_DECAR       KYF-----------------------FARKITVQYPEEKTP-----QSFRFRGLHALRRY
NUOI_NITEC       RYL-----------------------FAPKVTVHYPEEKTP-----QSPRFRGLHALRRY
NUOI2_NITMU      RNM-----------------------FARKITVYFPEEKTP-----QSPRFRGLHALRRY
NUOI_THIDA       RHL-----------------------FARKVTVQFPEEKTP-----QSPRFRGLHALRRY
NUOI_METFK       RYF-----------------------FARKVTVQFPEERTP-----ISPRFRGLHALRRY
NUOI_NEIMF       KNF-----------------------FARKDTIYFPEEKTP-----QSVRFRGLHAQRRY
NUOI_CHRVO       RYF-----------------------FARKITVQFPEEKTP-----ISPRFRGLHAQRRY
NUOI_ALKEH       KHF-----------------------LSRSVTLEYPEEKTP-----KSPRFRGMHALRRY
NUOI_HALHL       RHMV----------------------FRRSITLEFPEERAP-----KSPRFRGHLALRRY
NUOI2_NITOC      RYL-----------------------FTKKVTVQFPEERTP-----QSPRFRGLHALRRY
NUOI_FRATN       KHF-----------------------FTRKVTVQYPDEKTP-----ISNRFRGLHALRRY
NUOI_XYLFT       KYT-----------------------FRPKYTVLYPMEKFP-----QSPRFRGLHALRRY
NUOI_RUTMC       KEL-----------------------VNKKITVQFPEERTP-----ISPRFRGLHALRRY
NUOI_VESOH       KEL-----------------------VNKKITVQFPEERTP-----ISPRFRGLHALRRY
NUOI_HYDCU       KYL-----------------------FKKKITVRYPEEKTP-----LSPRFRGHHALRRY
NUOI_LEGPA       KYF-----------------------FRKKITVQFPEEQTP-----LSPRFRGLLALRRY
NUOI_COXBU       RYF-----------------------YRKKVTIHYPDEEVP-----SSFRFRGMLALRRY
NUOI_RHIL3       RYF-----------------------FRQKATINYPFEKGP-----VSPRFRGEHALRRY
NUOI_AGRFC       RHF-----------------------FKQKATINYPFEKGP-----VSPRFRGEHALRRY
NUOI1_RHIME      RYF-----------------------FRPKATLNYPFEKGP-----VSPRFRGEHALRRY
NUOI_CHESB       RQF-----------------------FAPKATLNYPHEKGP-----LSPRFRGEHALRRY
NUOI_RHILO       RQF-----------------------FAPKETINYPHEKGP-----VSPRFRGEHALRRY
NUOI_BRUSU       RQF-----------------------FAPKATLNYPHEKGP-----VSPRFRGEHALRRY
NUOI_BARBK       RQF-----------------------FSPKPTINYPYEKGF-----VSHRFRGEHALRRY
NUOI_BRADU       RYF-----------------------FQPKPTLNYPFEKGP-----ISPRFRGEHALRRY
NUOI1_RHOPA      RYF-----------------------FKPKPTINYPFEKNP-----ISPRFRGEHALRRY
NUOI2_RHOP5      RYF-----------------------FKPKPTLNYPFEKGP-----ISPRFRGEHALRRY
NUOI_CAUVC       KYM-----------------------VAPKKTVIYPNERNP-----QSPRFRGEHALRRY
NUOI_HYPNA       REM-----------------------FRRKATVNYPFEKNP-----LSPRFRGEHVLRRY
NUOI_MARMM       RYF-----------------------FAKKATLNYPFEKGP-----LSPRFRGQHALRRY
NUOI_RUEST       KYF-----------------------FAPKATINYPHEKGP-----LSPRFRGEHALRRY
NUOI_ROSDO       KYF-----------------------FAPKATLNYPHEKGP-----LSPRFRGEHALRRY
NUOI_JANSC       KYF-----------------------FAPKVTINYPHEKGP-----LSPRFRGEHALRRY
NUOI1_RHOS1      KYF-----------------------FAPKHTVNYPHEKGP-----LSPRFRGEHALRRY
NUOI_PARDP       RYF-----------------------VSPKPTLNYPHEKGP-----LSPRFRGEHALRRY
NUOI_SPHAL       KYF-----------------------FKPKATINYPFEKNP-----LSPRFRGEHALRRY
NUOI_ERYLH       KYF-----------------------FKPKATINYPFEKNP-----LSPRFRGEHALRRY
NUOI_GRABC       KYF-----------------------FKPKATINYPYEKNP-----ISPRFKGEHALRRY
NUOI_MAGSA       RYM-----------------------FKPKVTINYPYEKGP-----LSVRFRGEHALRRY
NUOI_RHORT       RYM-----------------------LKPKVTINYPFEKGY-----LSPRFRGEHALRRY
NUOI_RICBR       KYF-----------------------FKAKVTINYPYEKSP-----VSPRFKGEHALRRY
NUOI_RICTY       KYF-----------------------FKPKVTINYPYEKSP-----VSPRFKGEHALRRY
NUOI_ANAMM       VSM-----------------------FRPKVTLRYPSEKGP-----LSTRFRGEHALRRY
NUOI_ANAPZ       LAM-----------------------FKPKVTLRYPHEKGP-----LSTRFRGEHALRRY
NUOI_EHRCJ       RYM-----------------------FKPKVTLNYPLEKGP-----LSTRFRGEHALRKY
NUOI_EHRCR       RYM-----------------------FKPKVTLNYPLEKGP-----LSTRFRGEHALRKY
NUOI_EHRRW       RYM-----------------------FKPKVTLNYPLEKNP-----LSTRFRGEHALRTY
NUOI_WOLPM       KYM-----------------------FKPKVTLRYPMEKGP-----LSPRFRGEHALRRY
NUOI_WOLTR       RYA-----------------------FKPKVTLKYPMEKGP-----LSPRFRGEHALRRY
NUOI_NEOSM       WYF-----------------------FAPKVTIKYPQEKGP-----ISLRFRGEHALRRY
NUOI_PELUB       KEI-----------------------FKSKKTINYPFEKGK-----ISPRFRGEHALRRY
NUOI_MAGMM       RYM-----------------------FRPNITIQYPEERTP-----YSPRFRGIHVLRRY
NUOI_SULDN       REMI----------------------RFDIHTIQYPLEKMP-----IGPRYRAVHEMKRL
NUOI_WOLSU       REML----------------------RFNIHTTQYPKEKLP-----LSPRYRAIHELLRL
NUOI_CAMJR       RELLK---------------------RNNSATIKYPFEKVK-----LDNRYRAVHRLMRF
NUOI_HELAH       KEFF-----------------------SPSVTIHYPMEQLP-----LSPRYRAVHNLQRL
NUOI_HELHP       GAFF-----------------------SPKVTIHYPLESAP-----LSPRYRAIHKLQRL
NUOI_ECOLI       LHA-----------------------FAKRETRMYPEEPVY-----LPPRYRGRIVLTRD
NUOI_PECAS       SNA-----------------------FKKRETRMYPEEPVN-----PPPRYRGRIVLTRD
NUOI_SODGM       MQA-----------------------FNKRETRMYPDVPVN-----PPPRFRGRIVLTRD
NUOI_PHOLL       LHA-----------------------FHKRETQMYPEEPVY-----LPPRYRGRIVLTRD
NUOI_BAUCH       MQA-----------------------FNKRETQMYPDIPIY-----QTSRFRGRIVLTCD
NUOI_SHEON       SHA-----------------------WHPRETLNYPEEAVY-----AAPRYRGRIVLTRD
NUOI_AERS4       SHA-----------------------WRPRETLSYPDESIY-----SPPRYRGRIVLTRD
NUOI_PSEPF       GHG-----------------------FRKRDTLQYPEEQVY-----LPPRYRGRIVLTRD
NUOI_PSEAB       GHA-----------------------FRKRDTLQYPEEPVY-----LPPRYRGRIVLTRD
NUOI_CHRSD       MHA-----------------------FRKRETLQYPEEPVY-----LSPRYRGRIVLTRD
NUOI_ACIAD       THI-----------------------TRKRDTILYPEVPAEE---IVPPRYRGRIVLTRD
NUOI_PSYCK       SHA-----------------------LRPRDTILYPEVPVP-----VPPRFRGRIILSRD
NUOI1_NITOC      LHL-----------------------FQPKATIQYPEERPY-----IPPRWRGRIILSRD
NUOI1_NITMU      LHM-----------------------FRRRVTIQYPDEMPN-----IPPRWRGRIILSRD
NUOI_METCA       KHT-----------------------FSRADTVQYPEQRPK-----LYPRYRGRIVLTRD
NUOI1_RHOP2      RKL-----------------------FVKAETQLYPEEKPK-----LFPRSRGRIVLTRD
NUOI2_RHOPA      RKL-----------------------FVKPETQLYPEQKPK-----LYPRARGRIVLTRD
NUOI1_RHOP5      RKL-----------------------FVKAETVQYPEVRPY-----LPPRSRGRIVLTRD
NUOI2_RHOPB      RKL-----------------------AAKTVTVQYPEVKPQ-----LPPRSRGRIVLTRD
NUOI2_RHOS1      RMI-----------------------FAPTKTVQYPEEKLP-----LAPRTRGRIVLTRD
NUOI_BLOFL       MQA-----------------------FSKRETYMYPDVACK-----LSSRYRGRIVLTRD
NUOI_BLOPB       MQA-----------------------FSKRETRMYPEVPYI-----PSPRYRGRIVLTRD
NUOI_BUCBP       INI-----------------------FSKRETRMYPEESLS-----LSSRYRGRIILSRN
NUOI_BUCAI       ANI-----------------------FSKPETKLYPEEKVY-----LAPRYRGRIILTRN
NUOI_BUCAP       KNI-----------------------FSKSETKMYPEEKLY-----LSPRYRGRVILTRN
NUOI_BUCCC       SNI-----------------------FSFRETRLYPDEPLN-----LSLRYRGRIILTRN
NUOI1_GEOMG      KHI-----------------------FRRSVTVEYPEVKRT-----PAPRYRARIVLTRD
NUOI2_GEOSL      KHI-----------------------FRRPVTVEYPEVKRT-----PAPRYRARIVLTRD
NUOI_PELCD       RYL-----------------------FRRPVTVCYPERKQT-----PAPRYRGRLVLTRD
NUOI2_SYNFM      VHL-----------------------FRKPVTEEYPEVKRA-----LPARTRAVIVLTRD
NUOI2_RHIEC      GYM-----------------------FSSPVTMQYPDTEKW----LPYSRYRGHHFLKRD
NUOI2_RHIME      GYM-----------------------FSRPVTMQYPDKEKW----LPYSRYRGHHFLKRD
NUOI_DEIGD       GKLFQ-----------------------KPVTVSYPEE-----RVTLQPRFRGRHVLTRH
NUOI_DEIRA       GKLFQ-----------------------KPLTVSYPEQ-----RATLQPRFRGRHVLTRH
NQO9_THET8       KYLFS-----------------------KPVTVPYPDA-----PVALKPRFHGRHVLTRH
NUOI_PARUW       KHAFQ-----------------------TPVTLRYPEE-----KRILPARSRGRHYLTKW
NUOI1_SYMTH      KVLFR-----------------------KPVTVDYPYV-----KRPRAPRFRGRHELRTY
NUOI_FRAAA       STMFK-----------------------KPTTEQYPEY-----KKETAPRFHGRHQLNRH
NUOI_FRACC       GTMFK-----------------------KPTTEQYPEE-----KKETAPRFHGRHQLNRH
NUOI_SACEN       STMFR-----------------------KVVTEEYPEV-----KKIPAPRFHGKHQLNRH
NUOI_THEFY       HTMFK-----------------------KVPTVEYPEV-----KAPTMPRFHGRHQLNRW
NUOI_ACIC1       GTMFR-----------------------RVTTEQYPDE-----KKPTMPRYHGRHVLNRH
NUOI2_MYCPA      ASMFK-----------------------KHVTEEYPEK-----PGPVAPRYHGRHQLNRY
NUOI_MYCUA       GSMFK-----------------------KTVTEEYPEK-----PGPVAPRYHGRHQLNRY
NUOI_MYCTU       GSMFK-----------------------KTVTEEYPER-----PGPVAARYHGRHQLNRY
NUOI_MYCSJ       GTLFK-----------------------KPITEEYPEK-----PGPVAPRYHGRHQLNRY
NUOI_MYCS2       GSMFK-----------------------KPITEGYPEK-----PGPVAPRYHGRHQLNRY
NUOI_MYCVP       GSMFK-----------------------KPVTEEYPEK-----PGPVAKRYHGRHQLNRY
NUOI1_MYCPA      SAMFK-----------------------KPVTEGYPEK-----PGPVAPRYHGRHQLNRW
NUOI_RHOJR       STMFK-----------------------KSNTEFYPEE-----KVPTAPRYHGRHQLNRY
NUOI_NOCSJ       RTMFK-----------------------KVVTEQYPFD-----KYPTAPRFHGRHQLNRW
NUOI1_STRAW      KAMFK-----------------------KRLTEQYPEQ-----QKTTAPRFHGRHQLNRH
NUOI1_STRCO      KAMFK-----------------------KRLTEQYPEQ-----QKTTAPRFHGRHQLNRH
NUOI_CUTAK       ETMFR-----------------------KSFTQGYPEKG---KEKPMPPRMHGRHQLNRW
NUOI2_KORVE      SEMFK-----------------------PTTVENYPDGPGVLRGAVFQERFRGMHVLQRD
NUOI1_SOLUE      KEMMG-----------------------PTVTDDYPDAP-----PKFEERFRGVHVLQRD
NUOI1_ANADE      KHFLKNLFFSRDANPDILARKRGGFGHSDNVTLQYPEER-----APYAPAYRGLHRLVPR
NUOI_MYXXD       KHFFRNLFGTRDTNTQVVDRT----GASLMTTVAYPEEK-----PIYPEGYRGLHRLVPR
NUOI_CAMFF       RHFFRNLKDS-----------------SNIDFLEYPEQKP----TDITNRYRGLHRLTKN
NUOI_PELPD       SVFFGNMWKWLTFR-------------KGALTAYYPEELR----ADYSSANRGRHLLTTR
NUOI_BDEBA       KHLLKNLFNQ-----------------KKMMTLNYPEEK-----YEYSPRFKGNHVLTVK
NUOI_LEPIC       KHFIKAAILR------------------KAVTIEFPEKK-----RKYSTRFRGMHTMKRD
NUOI_CYTH3       SHLFK-----------------------KKATIQYPEVQ-----REFAFVYRGKHILKRD
NUOI1_GEOSL      KHM-----------------------FMKPVTLQYPDERPT-----PSPNFRGLHALKVS
NUOI2_AQUAE      KNA-----------------------LRKTITTHYPYEKITP-----PKRFRGYFAHKVV
NUOI1_AQUAE      KNL-----------------------LRRPITTEYPKEKLTP-----PKRFRGAHGHYVW
NUOI1_KORVE      KYQA----------------------PKDCQTEQYPQERPV-----ITDRFRGQPMMKLG
NUOI2_SOLUE      RNQN----------------------PKYIYTEQYPAERPK-----VAERYRGAPRLNIN
NUOI2_SYMTH      REMM----------------------FRPAITVFYPEQRDD-----VPPWFRGIPVLKTD
NDHI_HORVU       SHTN-----------------------RLPITIHYPYEKSIT-----PERFRGRIHFE--
NDHI_WHEAT       SHTN-----------------------RLPITIHYPYEKSIT-----PERFRGRIHFE--
NDHI_AGRST       SHTN-----------------------RLPITIHYPYEKSIT-----PERFRGRIHFE--
NDHI_MAIZE       SHTN-----------------------RLPITIHYPYEKSIT-----SERFRGRIHFE--
NDHI_CALFG       SHAN-----------------------RLPVTIQYPYEKSIT-----SERFRGRIHFE--
NDHI_ACOCL       SHAN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_ILLOL       SHTN-----------------------RLPVTIQYPYEKSIT-----SERFRGRIHFE--
NDHI_AMBTC       SHAN-----------------------RLPVTIQYPYEKSIT-----SERFRGRIHFE--
NDHI_PLAOC       SHAN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_DIOEL       SHTN-----------------------RLPVTIQYPYEKSIA-----SERFRGRIHFE--
NDHI_LOTJA       SHAN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_POPTR       SHVN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_MORIN       SHVN-----------------------RLPITIQYPYEKVIA-----AERFRGRIHFE--
NDHI_BUXMI       SHTN-----------------------RLPVTIQYPYEKLLT-----SERFRGRIHFE--
NDHI_SPIOL       SHAN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_CITSI       SQAN-----------------------RLPVTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_COFAR       SHAN-----------------------RLPITIQYPYEKLIT-----PERFRGRIHFE--
NDHI_NICTO       SHAN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_NASOF       SHTN-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_DAUCA       SHAS-----------------------RLPVTIQYPYEKLIT-----SERFRGRIHFE--
NDHI_PELHO       SHSN-----------------------RFPVTIQYPYEKLMT-----SERFRGRIHFE--
NDHI_PIPCE       SHTN-----------------------RLPVTIQYPYEKSIT-----SERFRGRIHFE--
NDHI_SOYBN       SHAN-----------------------RLPVTIQYPYEKIIS-----SERFRGRIHFE--
NDHI_PHAVU       SHAN-----------------------RLPVTIQYPYEKIIS-----SERFRGRIHFE--
NDHI_PHYPA       DHMN-----------------------RLPMTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_ANTAG       DHMN-----------------------RLPMTIQYPYEKLVP-----SERFRGRIHFE--
NDHI_MARPO       DHMN-----------------------RLPTTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_ANGEV       DHMN-----------------------RLPMTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_PSINU       EHMN-----------------------RLPITVQYPYEKIIP-----SERFRGRIHFE--
NDHI_HUPLU       DHMN-----------------------RLPMTVQYPYEKLIP-----SERFRGRIHFE--
NDHI_STAPU       DHMN-----------------------RTPITIQYPYEKLIP-----SERFRGRIHFE--
NDHI_ZYGCR       DHMN-----------------------RTASTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_CHAVU       NHIN-----------------------RSAITVQYPYEKLIT-----SERFRGRIHFE--
NDHI_CHAGL       DHMN-----------------------RLPVTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_CHLAT       DHMS-----------------------RRPVTIQYPYEKLIP-----SERFRGRIHFE--
NDHI_MESVI       DHMN-----------------------RRAITIQYPYEKLIP-----SERFRGRIHFE--
NDHI_NEPOL       DHMS-----------------------RRPITIHYPYEKLIP-----SERFRGRIHFE--
NDHI_ADICA       DHLN-----------------------RLPITVQYPYEKKLP-----SERFRGRIHFE--
NDHI_TRIEI       DHMS-----------------------RRPVTVQYPYEKLIP-----SERFRGRIHFE--
NDHI_TRIV2       DHMR-----------------------RRPVTVQYPYEKLIP-----GERFRGRIHYE--
NDHI_SYNY3       DHMS-----------------------RRPITVQYPYEKLIP-----SERFRGRIHFE--
NDHI_SYNE7       DHMQ-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_THEEB       DHMR-----------------------RRPITVQYPYEKLIP-----SERFRGRIHFE--
NDHI_SYNJB       DHMG-----------------------RRPVTVQYPFEKLIP-----SERFRGRIHFE--
NDHI_SYNJA       DHMN-----------------------RRPVTVQYPFEKLIP-----SERFRGRIHFE--
NDHI_GLOVI       DHMR-----------------------RKPVTVQYPYEKLIP-----SERFRGRIHFE--
NDHI_PROM5       DHLR-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_PROMP       DHLR-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_PROM0       DHLR-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_PROMA       DHMR-----------------------RRPITVQYPYEKLIP-----SERYRGRIHYE--
NDHI_PROMT       DHMR-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_SYNSC       DHMQ-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_SYNPX       DHMK-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_SYNS9       DHMQ-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_SYNS3       DHMK-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_SYNPW       DHMK-----------------------RRPVTVQYPYEKLIP-----SERYRGRIHYE--
NDHI_PROMM       DHLR-----------------------RRPITVQYPYEKLIP-----SERYRGRIHYE--
NUOI1_SYNFM      RRLL-----------------------RPVVTVQYPREVVTL-----SPAFRGHIELKSF
NUOI_CARHZ       KELW-----------------------KKPVTLEYPEHKEKL-----PPRFHGSFTLH--
NUOI2_STRAW      RTMT-----------------------KKTVTAQYPDAQPEL-----PPRSRGVIGLF--
NUOI2_STRCO      RTMT-----------------------RKTVTEQYPDAQPEL-----PPRTRGVIGLF--
NUOI2_ANADE      SYLA-----------------------RRPTTVQYPDRTPMPVRDMLPPRYRGFLEVDSG
                                                   :*               :.       

NUOI_POLNA       ENGE-E-------------------RCIACKLCEAVCPALAITIESDVRED---------
NUOI_POLSJ       DNGE-E-------------------RCIACKLCEAVCPALAITIESEVRDD---------
NUOI_METPP       ENGE-E-------------------RCIACKLCEAVCPALAITIESEVRDD---------
NUOI_ACISJ       ENGE-E-------------------RCIACKLCEAVCPAVAITIESDVRAD---------
NUOI_VEREI       DNGE-E-------------------RCIACKLCEAVCPALAITIESELRAD---------
NUOI_PARXL       ENGE-E-------------------RCIACKLCEAVCPALAITIESETRAD---------
NUOI_RHOFT       ENGE-E-------------------RCIACKLCEAICPAMAITIESEVRAD---------
NUOI_CUPMC       PNGE-E-------------------RCIACKLCEAVCPALAISIESDVRND---------
NUOI_RALSO       PNGE-E-------------------RCIACKLCEAVCPALAITIESDQRDD---------
NUOI_BORA1       PNGE-E-------------------RCIACKLCEAVCPALAITIESDQRED---------
NUOI_HERAR       PNGE-E-------------------RCIACKLCEAVCPAMAITIESEQRDD---------
NUOI_AZOSB       PNGE-E-------------------RCIACKLCEAICPAMAITIESEQRED---------
NUOI_AROAE       PNGE-E-------------------RCIACKLCEAVCPALAITIESEQRDD---------
NUOI_DECAR       PNGE-E-------------------RCIACKLCEAICPALAITIEAEPRDD---------
NUOI_NITEC       PNGE-E-------------------RCIACKLCEAVCPALAITIESEQRDD---------
NUOI2_NITMU      PNGE-E-------------------RCIACKLCEAVCPALAITIESEQRED---------
NUOI_THIDA       PNGE-E-------------------RCIACKLCEAVCPALAITIDSEQRAD---------
NUOI_METFK       PNGE-E-------------------RCIACKLCEAVCPAMAITIESEQRED---------
NUOI_NEIMF       PNGE-E-------------------RCIACKLCEAVCPAMAINIESEERED---------
NUOI_CHRVO       ANGE-E-------------------RCIACKLCEAVCPAMAISIESEQRED---------
NUOI_ALKEH       PNGE-E-------------------RCIACKLCEAVCPALAITIEAGPREDD--------
NUOI_HALHL       PNGE-E-------------------RCIACKLCEAVCPALAITIDSHQRAD---------
NUOI2_NITOC      PNGE-E-------------------RCIACKLCEAVCPALAITIDSEQRED---------
NUOI_FRATN       ENGE-E-------------------RCIACKLCEVVCPALAITINSTERED---------
NUOI_XYLFT       PNGE-E-------------------RCIACKLCEAVCPALAITIDSAKRED---------
NUOI_RUTMC       PNGE-E-------------------RCIACKLCEAVCPANAITIESEMRDD---------
NUOI_VESOH       PNGE-E-------------------RCIACKLCEAVCPANAITIESKMRDD---------
NUOI_HYDCU       ENGE-E-------------------RCIACKLCEAVCPANAITIESEERDD---------
NUOI_LEGPA       PNGE-E-------------------RCIACKLCEAVCPALAITIESEQRED---------
NUOI_COXBU       PNGE-E-------------------RCIACKLCEAVCPACAITIEAGPREAD--------
NUOI_RHIL3       PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI_AGRFC       PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI1_RHIME      PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI_CHESB       PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI_RHILO       PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI_BRUSU       PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI_BARBK       PNGE-E-------------------RCIACKLCEAICPAQAITIEAGPRRND--------
NUOI_BRADU       PNGE-E-------------------RCIACKLCEAVCPAQAITIEAGPRRND--------
NUOI1_RHOPA      PNGE-E-------------------RCIACKLCEAVCPAQAITIEAGPRRND--------
NUOI2_RHOP5      PNGE-E-------------------RCIACKLCEAVCPAQAITIEAGPRRND--------
NUOI_CAUVC       PSGE-E-------------------RCIACKLCEAICPAQAITIEAEPR-ED--------
NUOI_HYPNA       PSGE-E-------------------RCIACKLCEAICPAQAITIEAEPR-ED--------
NUOI_MARMM       ANGE-E-------------------RCIACKLCEAICPAQAITIEAEPR-SD--------
NUOI_RUEST       PNGE-E-------------------RCIACKLCEAVCPAQAITIDAEPR-ED--------
NUOI_ROSDO       PNGE-E-------------------RCIACKLCEAVCPAQAITIDAEPR-DD--------
NUOI_JANSC       PNGE-E-------------------RCIACKLCEAICPAQAITIDAEPR-ED--------
NUOI1_RHOS1      PNGE-E-------------------RCIACKLCEAVCPAQAITIDAEPR-ED--------
NUOI_PARDP       PNGE-E-------------------RCIACKLCEAVCPAQAITIDAEPR-ED--------
NUOI_SPHAL       PNGE-E-------------------RCIACKLCEAVCPAQAITIEAEPR-DD--------
NUOI_ERYLH       PNGE-E-------------------RCIACKLCEAVCPAQAITIESEPR-DD--------
NUOI_GRABC       ANGE-E-------------------RCIACKLCEAVCPALAITIEAEPR-AD--------
NUOI_MAGSA       PNGE-E-------------------RCIACKLCEAICPAQAITIEPEPR-DD--------
NUOI_RHORT       ANGE-E-------------------RCIACKLCEAICPAQAITIEAEPR-TD--------
NUOI_RICBR       ENGE-E-------------------RCIACKLCEAICPAQAIVIEADERE-D--------
NUOI_RICTY       ENGE-E-------------------RCIACKLCEAVCPAQAIVIESDERD-D--------
NUOI_ANAMM       DDGE-E-------------------RCIACKLCEAICPAQAITIEAAERG-D--------
NUOI_ANAPZ       ESGE-E-------------------RCIACKLCEAICPAQAITIEAEERS-D--------
NUOI_EHRCJ       KNGE-E-------------------RCIACKLCEAICPAQAITIEAQERD-D--------
NUOI_EHRCR       KNGE-E-------------------RCIACKLCEAICPAQAITIEAQERD-D--------
NUOI_EHRRW       KNGE-E-------------------RCIACKLCEAICPAQAITIEAQERDTD--------
NUOI_WOLPM       PNGE-E-------------------RCIACKLCEVICPAQAIVIEAEERE-D--------
NUOI_WOLTR       SNGE-E-------------------RCIACKLCEVICPAQAIVIEAEERE-D--------
NUOI_NEOSM       KNGE-E-------------------RCIACKLCEVVCPAQAITIEAAPRESD--------
NUOI_PELUB       PNGE-E-------------------RCIACKLCEAVCPAQAITIESSER-AD--------
NUOI_MAGMM       EGGE-E-------------------RCVACKLCEAICPAQAIYIEIDTESRA--------
NUOI_SULDN       WESDTE-------------------RCIGCGLCEKICISNCIRIDTKLDEN---------
NUOI_WOLSU       LESGNE-------------------RCIGCGLCEKICISNCIRMETSYGED---------
NUOI_CAMJR       IESENE-------------------RCIGCGLCEKICISNCIRMETSLDEN---------
NUOI_HELAH       LDSGSE-------------------RCIGCGLCEKICTSNCIRIITHKGED---------
NUOI_HELHP       LESENE-------------------RCIGCGLCEKICTSNCIRIITDKGED---------
NUOI_ECOLI       PDGE-E-------------------RCVACNLCAVACPVGCISLQKAETKD---------
NUOI_PECAS       PDGE-E-------------------RCVACNLCAVACPVGCISLQKAETKD---------
NUOI_SODGM       PDGD-E-------------------RCVACNLCAVACPVDCISLQKAETKD---------
NUOI_PHOLL       PDGE-E-------------------RCVACNLCAAVCPVGCISLQKAEHED---------
NUOI_BAUCH       PDGY-E-------------------RCVACNLCAVACPVDCISLQKTESKE---------
NUOI_SHEON       PDGD-E-------------------RCVACNLCAVACPVGCISLQKSERDD---------
NUOI_AERS4       PDGD-E-------------------RCVACNLCAVACPVGCISLQKAERDD---------
NUOI_PSEPF       PDGE-E-------------------RCVACNLCAVACPVGCISLQKAETED---------
NUOI_PSEAB       PDGE-E-------------------RCVACNLCAVACPVGCISLQKAETED---------
NUOI_CHRSD       PDGE-E-------------------RCVACNLCAVACPVACISLQKGERDD---------
NUOI_ACIAD       PDGE-E-------------------RCVACNLCAVACPVGCISLQKAEKED---------
NUOI_PSYCK       PDGD-E-------------------RCVACNLCAVACPVGCISLQKAERED---------
NUOI1_NITOC      PDGE-E-------------------RCVACNLCAVACPVDCIALQKTEDEQ---------
NUOI1_NITMU      PDGE-E-------------------RCVACYLCAAACPVDCIALQATEDEH---------
NUOI_METCA       PDGE-E-------------------RCVACNLCAAVCPVDCIALQKTEDVD---------
NUOI1_RHOP2      PDGQ-E-------------------RCVACNLCAAVCPVGCIDLSKAVADD---------
NUOI2_RHOPA      PDGQ-E-------------------RCVACNLCATVCPVGCIDLAKAVADD---------
NUOI1_RHOP5      PDGQ-E-------------------RCVACNLCAVACPVGCIDLAKAVAED---------
NUOI2_RHOPB      PDGQ-E-------------------RCVACNLCAVACPVGCIDLSKAVAED---------
NUOI2_RHOS1      PDGQ-E-------------------RCVACNLCAAACPVDCIDVVKAETPD---------
NUOI_BLOFL       SAGH-E-------------------RCVACNLCAVSCPVGCISLKKSENSE---------
NUOI_BLOPB       SSGR-E-------------------RCVACNLCAVACPVGCISLKKGESTD---------
NUOI_BUCBP       SFGK-E-------------------RCVACGLCSVVCPVSCISLKKSTLKN---------
NUOI_BUCAI       IDGQ-E-------------------RCVACNLCAVVCPVDCISLQKSEKTD---------
NUOI_BUCAP       IDGG-E-------------------RCVACNLCAVVCPVDCISLQKSEKKN---------
NUOI_BUCCC       SNGS-E-------------------RCVACNLCSAVCPVNCISLKKSEEKN---------
NUOI1_GEOMG      PEGG-E-------------------RCVACYLCSAACPVDCISMEATEDGN---------
NUOI2_GEOSL      PDGG-E-------------------RCVACYLCSAACPVDCISMEAAEGEE---------
NUOI_PELCD       PDGE-E-------------------RCVACHLCSAACPVDCISMQAAERED---------
NUOI2_SYNFM      PDGG-E-------------------RCVACYLCSAVCPVSCISMQAAERED---------
NUOI2_RHIEC      EEGE-I-------------------KCVACELCARICPCDCIEVVPYEDEK---------
NUOI2_RHIME      DEGE-I-------------------KCVACELCARICPCDCIEVVPYEDEK---------
NUOI_DEIGD       PDTGLE-------------------KCIGCSLCAAVCPAYAIYVEAAENDPL----NPTS
NUOI_DEIRA       PDTGLE-------------------KCIGCSLCAAACPAYAIYVEAAENDPR----DPVS
NQO9_THET8       PN-GLE-------------------KCIGCSLCAAACPAYAIYVEPAENDPE----NPVS
NUOI_PARUW       ND-GLE-------------------RCVGCELCAIVCPAQAIYVKPAANEPG----HIHS
NUOI1_SYMTH      EN-GLE-------------------MCVGCELCQVACPAAAITVQAAENDPD----NPHS
NUOI_FRAAA       PD-GLE-------------------KCVGCELCAWACPADAIYVEGADNTET----ERYS
NUOI_FRACC       PD-GLE-------------------KCVGCELCAWACPADAIYVEGADNTEA----ERYS
NUOI_SACEN       PD-GLE-------------------KCVGCELCAWACPADAIFVEGGTNTED----ERYS
NUOI_THEFY       PD-GLE-------------------KCIGCELCAWACPADAIYVEAGDNTEE----ERYS
NUOI_ACIC1       PD-GLE-------------------KCIGCELCAWACPADAIYVEGADNTEE----ERYS
NUOI2_MYCPA      PD-GLE-------------------KCIGCELCAWACPADAIYVEGADNTEE----LRYS
NUOI_MYCUA       PD-GLE-------------------KCIGCELCAWACPADAIYVEGADNTDE----QRFS
NUOI_MYCTU       PD-GLE-------------------KCIGCELCAWACPADAIYVEGADNTEE----ERFS
NUOI_MYCSJ       PD-GLE-------------------KCIGCELCAWACPADAIYVEGDDNTAD----ERYS
NUOI_MYCS2       PD-GLE-------------------KCIGCELCAWACPADAIYVEGADNTAD----ERYS
NUOI_MYCVP       PD-GLE-------------------KCIGCELCAWACPADAIFVEGADNTES----ERYS
NUOI1_MYCPA      PD-GLE-------------------KCIGCELCAWACPADAIFVESADNTEA----ERFS
NUOI_RHOJR       AD-GLE-------------------KCIGCELCAWACPADAIYVEGADNTDE----ERFS
NUOI_NOCSJ       PD-GLE-------------------KCVGCELCAWACPADAIYVEGASNSDDPDGGERFS
NUOI1_STRAW      PD-GLE-------------------KCVGCELCAWACPADAIYVEGADNTDE----ERYS
NUOI1_STRCO      PD-GLE-------------------KCVGCELCAWACPADAIYVEGADNTDE----ERYS
NUOI_CUTAK       PD-GLE-------------------KCVGCELCAWACPADAIYVEGADNTDE----ERYS
NUOI2_KORVE      EN-GLE-------------------KCVACFLCAAACPSNCIYIEAAENTET----NRVS
NUOI1_SOLUE      VN-GME-------------------KCVACFLCAAACPSNCIYIEAAENTDK----IRMS
NUOI1_ANADE      ED-GKP-------------------RCVACYMCATICPAQCIYIEAAEYPDDP-------
NUOI_MYXXD       ED-GKP-------------------RCVACYMCATICPAQCIYIEAGEYEDEASD-SEDR
NUOI_CAMFF       EK-GDL-------------------KCVACDMCATACPANCIFITATEIEGSK-------
NUOI_PELPD       AD-GKV-------------------QCVSCNMCATVCPAYCIEIQSAADFNDPFH-P---
NUOI_BDEBA       KD-GSL-------------------RCTACMLCATNCPAECIKITAAEHNDPT-------
NUOI_LEPIC       EQ-GRE-------------------RCTSCFCCMWICPADAIYIEAAEVTPEIQH-LHP-
NUOI_CYTH3       EQ-GRE-------------------NCTACGLCAVSCPAEAITIIADERKKGEEH-LYK-
NUOI1_GEOSL      HDKA---------------------KCVACYLCPTVCPAKCITVEAGEDATH--------
NUOI2_AQUAE      DGTEPQPAFQEWVNRYNILVEYGKSRCVVCLRCKRACPVPQLFEIEGKKLPN--------
NUOI1_AQUAE      DGTEPD--SLKAIEKF-MSYEKAKSRCVACYMCQTACPMPTLFRIEAVQLPN--------
NUOI1_KORVE      -ENGET-------------------LCIGCNLCALACPENLIAMKSDRDPVTK-------
NUOI2_SOLUE      PDNGET-------------------LCISCNLCALACPENLIVVTSERSEVTK-------
NUOI2_SYMTH      LRTGEY-------------------KCTSCMQCAQACPVNVITIEWHQDPETK-------
NDHI_HORVU       -----------------------FDKCIACEVCVRVCPIDLPVVDWRFE---------KD
NDHI_WHEAT       -----------------------FDKCIACEVCVRVCPIDLPVVDWRFE---------KD
NDHI_AGRST       -----------------------FDKCIACEVCVRVCPIDLPVVDWRFE---------KD
NDHI_MAIZE       -----------------------FDKCIACEVCVRVCPIDLPLVDWRFE---------KD
NDHI_CALFG       -----------------------FDKCIACEVCVRVCPIDLPVVHWRLE---------TD
NDHI_ACOCL       -----------------------FDKCIACEVCVRVCPIDLPVVDWRLD---------TD
NDHI_ILLOL       -----------------------FDKCIACEVCVRVCPIDLPVVDWRLE---------TD
NDHI_AMBTC       -----------------------FDKCIACEVCVRVCPIDLPVVDWRFE---------TD
NDHI_PLAOC       -----------------------FDKCIACEVCVRVCPIDLPVVNWRLE---------TD
NDHI_DIOEL       -----------------------FDKCIACEVCVRVCPIDLPVVDWRLE---------KN
NDHI_LOTJA       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TN
NDHI_POPTR       -----------------------FDKCIACEVCVRVCPIDLPVVDWELE---------TN
NDHI_MORIN       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TD
NDHI_BUXMI       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TY
NDHI_SPIOL       -----------------------FDKCIACEVCVRACPIDLPVVDWKLE---------TD
NDHI_CITSI       -----------------------FDKCIACEVCVRVCPIDLPVVDWKFE---------TD
NDHI_COFAR       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TD
NDHI_NICTO       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TD
NDHI_NASOF       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TN
NDHI_DAUCA       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------KD
NDHI_PELHO       -----------------------FDKCIACEVCVRVCPIDLPVVDWKFE---------RD
NDHI_PIPCE       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TD
NDHI_SOYBN       -----------------------FDKCIACEVCVRVCPIDLPVVDWKLE---------TD
NDHI_PHAVU       -----------------------FDKCIACEVCVRVCPIDLPIVDWKLE---------TD
NDHI_PHYPA       -----------------------FDKCIACEVCVRVCPINLPVVDWELK---------KD
NDHI_ANTAG       -----------------------FDKCIACEVCVRVCPINLPVVDWKFK---------KD
NDHI_MARPO       -----------------------FDKCIACEVCVRVCPINLPVVDWELK---------KT
NDHI_ANGEV       -----------------------FDKCIACEVCVRVCPINLPVVDWELK---------ES
NDHI_PSINU       -----------------------FDKCIACEVCVRVCPINLPVVDWELI---------KS
NDHI_HUPLU       -----------------------FDKCIACEVCVRVCPINLPVVDWEFE---------KN
NDHI_STAPU       -----------------------FDKCIACEVCVRVCPINLPVVDWEFQ---------KS
NDHI_ZYGCR       -----------------------FDKCIACEVCVRVCPINLPVVDWEFQ---------KS
NDHI_CHAVU       -----------------------FDKCIVCEVCVRVCPINLPVVDWNFQ---------QD
NDHI_CHAGL       -----------------------FDKCIACEVCVRVCPINLPVVDWEFQ---------KS
NDHI_CHLAT       -----------------------FDKCIACEVCVRVCPINLPVVNWEFQ---------KE
NDHI_MESVI       -----------------------FDKCIACEVCVRVCPINLPVVNWEFQ---------KE
NDHI_NEPOL       -----------------------FDKCIACEVCVRVCPINLPVVDWDYQ---------KS
NDHI_ADICA       -----------------------FDKCIACEVCVRVCPINLPVVDWIFL---------KD
NDHI_TRIEI       -----------------------YDKCIACEVCVRVCPINLPVVDWEFN---------KE
NDHI_TRIV2       -----------------------FDKCIACEVCVRVCPINLPVVDWEFD---------KA
NDHI_SYNY3       -----------------------FDKCIACEVCVRVCPINLPVVDWEFN---------KA
NDHI_SYNE7       -----------------------FDKCIACEVCVRVCPINLPVVDWVYN---------KE
NDHI_THEEB       -----------------------FDKCIACEVCVRVCPINLPVVDWVFN---------KE
NDHI_SYNJB       -----------------------FDKCIACEICVRVCPIDLPVVDWAYN---------PE
NDHI_SYNJA       -----------------------FDKCIACEICVRVCPIDLPVVDWVYN---------TE
NDHI_GLOVI       -----------------------RPKCISCEVCVRVCPINLPVVDYEFN---------KE
NDHI_PROM5       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_PROMP       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_PROM0       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_PROMA       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_PROMT       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_SYNSC       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KA
NDHI_SYNPX       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KA
NDHI_SYNS9       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KA
NDHI_SYNS3       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_SYNPW       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NDHI_PROMM       -----------------------FDKCIACEVCVRVCPINLPVVDWVMN---------KE
NUOI1_SYNFM      ADTG-------------------THKCIACGTCERMCPSNVIKVQGTKA---------QP
NUOI_CARHZ       -----------------------SEKCIACGLCQQACPNKVIKVGSIKD---------EN
NUOI2_STRAW      -----------------------EENCTVCMLCARECPDWCIYIDSHKETVPPAAPGGRE
NUOI2_STRCO      -----------------------EENCTVCMLCARECPDWCIYIDSHKETVPAATPGGRD
NUOI2_ANADE      -------------------------ICTGCQACERACPIGCIQISLEKDAAN--------
                                           *  *  *   *                       

NUOI_POLNA       -GSRRTSRYDIDLTKCIFCGFCEESCPVDSIVETH-ILEYHGEKRGDLYFTKEMLLAVGD
NUOI_POLSJ       -GSRRTSRYDIDLTKCIFCGFCEEACPVDAIVETH-IFEYHGEKRGDLYFTKEMLLAVGD
NUOI_METPP       -GSRRTTRYDIDLTKCIFCGFCEESCPVDSIVETH-IFEYHGEKRGDLYFTKDMLLAVGD
NUOI_ACISJ       -GSRRTTRYDIDLTKCIFCGFCEESCPVDSIVETP-IFEYHGEKRGDLYFTKDMLLAVGD
NUOI_VEREI       -GSRRTTRYDIDLTKCIFCGFCEESCPVDSIVETH-IFEYHGEKRGDLYFTKDMLLAVGD
NUOI_PARXL       -NTRRTTRYDIDLTKCIFCGFCEESCPVDSIVETH-ILEYHGEKRGDLYFTKDMLLAVGD
NUOI_RHOFT       -GSRRTTRYDIDLNKCIFCGFCEESCPVDSIVETS-ILEYHGESRSDLYFTKDMLLAVGD
NUOI_CUPMC       -GTRRTTRYDIDLTKCIFCGFCEEACPVDAIVETH-ILEYHGEKRGDLYFTKDMLLAVGD
NUOI_RALSO       -GTRRTTRYDIDLTKCIFCGFCEEACPVDAIVETH-ILEYHGEKRGDLYFTKDMLLAVGD
NUOI_BORA1       -GTRRTTRYDIDLTKCIFCGFCEESCPVDSIVETH-IHEYHGEKRGDLYFTKDMLLAVGD
NUOI_HERAR       -GSRRTTRYDIDLTKCIFCGFCEESCPVDSIVETH-IFEYHGEKRGDLYYTKEMLLAVGD
NUOI_AZOSB       -GSRRTSRYDIDLTKCIFCGFCEEACPVDAVVETR-VFEYHGEQRGDLYYTKQMLLAVGD
NUOI_AROAE       -GSRRTKRYDIDLTKCIFCGFCEEACPVDAVVETR-VMEYHGEKRGDLYYTKQMLLAVGD
NUOI_DECAR       -GSRRTTRYDIDLTKCIFCGFCEEACPVDAVVETR-IFEYHGEKRGDLYYTKQMLLANGD
NUOI_NITEC       -GTRRTTRYDIDLIKCIFCGFCEEACPVDAIVETR-VLEYHGEVRGDLTYTKEMLLAVGD
NUOI2_NITMU      -GTRRTTRYDIDLTKCIFCGFCEESCPVDSIVETR-ILEYHGEKRGDLIYTKQMLLAVGD
NUOI_THIDA       -GTRRTTRYDIDLTKCIFCGFCEESCPVDSIVETR-ILEYHGEQRGDLIYTKPMLLAIGD
NUOI_METFK       -NTRRTTRYDIDLTKCIFCGFCEESCPVDSIVETR-IFDYHGEKRGDLIYTKPMLLAVGD
NUOI_NEIMF       -GTRRTKRYDIDLTKCIFCGFCEEACPTDAIVETH-IFEYHGEKKGDLHMTKPILLAIGD
NUOI_CHRVO       -GTRRTSRYDIDLTKCIFCGFCEEACPVDAIVETH-IFEYHGEKRGDLYYTKPMLLAIGD
NUOI_ALKEH       -GTRRTTLYEIDMFKCIYCGFCEESCPVDSIVETR-EHEYHMEHREERVFDKARLLANGD
NUOI_HALHL       -GTRRTTRYDIDMFKCIYCGFCEESCPVDSIVLTR-LDTFHMERRDERVADKQKLLAMGD
NUOI2_NITOC      -GTRRTTRYDIDLFKCIYCGFCEESCPVDSIVETR-ILDYHFEERGEHILHKEQLLALGD
NUOI_FRATN       -GTRRTSSYEIDLFKCIFCGYCEESCPVDSIVETN-ILEYHFEERGENIMTKAKLLAIGD
NUOI_XYLFT       -GTRRTTRYDIDLFKCIFCGFCEESCPVDSIVETH-ILEYHFEKRGENIVTKPQLLAIGD
NUOI_RUTMC       -GTRRTIVYDIDLFKCIFCGFCEEACPVDAIVETQ-IFDYAFKSRQGSIMTKERLLEVGS
NUOI_VESOH       -GTRRTTQYDIDLFKCIFCGFCEEACPVDAIVETQ-IFDYVFESRQGSIMTKERLLEVGS
NUOI_HYDCU       -GTRRTTQYDIDMFKCIYCGFCEEACPVDAVVETR-VFEYEFHERGTHIMTKEQLLAFGD
NUOI_LEGPA       -GSRRTTRYDIDMFKCINCGLCEESCPVDSIVVTP-IHHYHISERGQNIMTKEKLLAVGD
NUOI_COXBU       -GSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTP-EMHYSIKDRGENILTKEKLLMIGD
NUOI_RHIL3       -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYFDKARLLDNGD
NUOI_AGRFC       -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYFDKQRLLDNGD
NUOI1_RHIME      -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFSTETREELYYDKEKLLANGD
NUOI_CHESB       -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYYDKDKLLANGD
NUOI_RHILO       -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYYDKDKLLANGD
NUOI_BRUSU       -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYYDKDKLLANGD
NUOI_BARBK       -GTRRTVRYDIDMVKCIYCGFCQEACPVEAIVEGP-NFEFATEMREELYYDKEKLLLNGD
NUOI_BRADU       -GTRRTVRYDIDMVKCIYCGLCQEACPVDAIVEGP-NFEFATETREELFYDKAKLLANGD
NUOI1_RHOPA      -GTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYYDKARLLANGD
NUOI2_RHOP5      -GTRRTERYDIDMVKCIYCGLCQEACPVDAIVEGP-NFEFATETREELYYDKAKLLANGD
NUOI_CAUVC       -GSRRTTRYDIDMVKCIYCGLCQEACPVDAIVEGP-NTEFATETREELYYDKERLLDNGD
NUOI_HYPNA       -GARRTTRYDIDMVKCIYCGFCQEACPVDAIVEGP-NFEFATETREELFYDKERLLANGD
NUOI_MARMM       -GSRRTTRYDIDMTKCIYCGYCQEACPVDAIVEGP-NFEFAAETREELFYDKAKLLENGD
NUOI_RUEST       -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEFATETREELFYDKDKLLANGE
NUOI_ROSDO       -GSRRTTRYDIDMTKCIYCGFCEEACPVDAIVEGP-NFEFSTETREELYYDKDRLLANGE
NUOI_JANSC       -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEFATETREELYYDKEKLLANGE
NUOI1_RHOS1      -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEFSTETREELFYNKDRLLENGA
NUOI_PARDP       -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYATETREELFYDKQKLLANGE
NUOI_SPHAL       -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYATETREELLYDKAKLLANGD
NUOI_ERYLH       -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYSTETREELLYDKAKLLANGD
NUOI_GRABC       -GSRRTTRYDIDMTKCIYCGLCEEACPVDAIVEGP-NLEFATETREELMYNKDRLLANGD
NUOI_MAGSA       -GSRRARRYDLDMTKCIYCGLCQEACPVDAIVEGP-NFEYATETRAELMYNKSKLLANGD
NUOI_RHORT       -GSRRTTRYDIDMTKCIYCGFCEEACPVDAIVEGP-NFEFAAETREELLYNKAKLLANGD
NUOI_RICBR       -GSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGP-NFEFASLTHTALIYDKEKLLQNGD
NUOI_RICTY       -GSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGP-NFEFASLTHTALIYDKERLLYNGD
NUOI_ANAMM       -GSRRTVRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYATETREELMYNKEKLLCNGD
NUOI_ANAPZ       -GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYSTETREELMYNKEKLLANGD
NUOI_EHRCJ       -GSRRTVRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYATETREELMYNKSKLLHNGQ
NUOI_EHRCR       -GSRRTVRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYATETREELMYNKSKLLHNGQ
NUOI_EHRRW       -NSRRTVRYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEYATETREELMYNKSKLLHNGQ
NUOI_WOLPM       -GSRRTTRYDIDMIKCIYCGLCQEACPVDAIVEGP-NFEFATETREELMYNKEKLLRNGE
NUOI_WOLTR       -GSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGP-NFEFATETREELMYNKEKLLRNGE
NUOI_NEOSM       -GSRRATKYDIDMTKCIYCGFCQEACPVDAIVEGP-NFEFARENREDLLYDKKKLLDNGS
NUOI_PELUB       -GSRKTTRYDIDMMKCIYCGLCEESCPVDAIVQGP-NFEFSTETREELYYNKEKLLDNGD
NUOI_MAGMM       -DKRLTKVYDIDLFKCIYCGLCEEACPVEAIVMGP-YLDMAYEDRNARFYKKDQLLANGE
NUOI_SULDN       -SRKEVTEYSINLGRCIFCGYCAEVCPELAITHGG-EYENASDQREHFIMYQDMLTPLDK
NUOI_WOLSU       -GRKKVHEYTINFGRCIFCGFCAEVCPELAIVHGG-RYENASEQRAHFGLKEDMLTPMER
NUOI_CAMJR       -GRKKVGNYSINLGRCIYCGFCAEVCPELAIVHGT-EYENAAEQRSYFGYKQDFLTPIDK
NUOI_HELAH       -NRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGN-RFENASTQRSQYGSKSEFLTSEQD
NUOI_HELHP       -GRKKILNYSINFGRCIYCGLCAEVCPELAIVHGD-LVENASTQRAFFGFKPQLLEHKS-
NUOI_ECOLI       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMGEYKRQDLVYEKEDLLISGP
NUOI_PECAS       -GRWYPEFFRVNFSRCIFCGFCEEACPTTAIQLTP-DFEMGEYKRQDLVYEKEDLLISGP
NUOI_SODGM       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMGEFKRQDLVYEKDDLLISGP
NUOI_PHOLL       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMGEFKRQDLVYEKEELTISGP
NUOI_BAUCH       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMAEFKRQDLVYEKEDLLIRGP
NUOI_SHEON       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMGEYRRQDLVYEKEDLLISGP
NUOI_AERS4       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMGEYRRQDLVYEKEDLLISGP
NUOI_PSEPF       -GRWYPDFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMAEFKRQDLVYEKEDLLISGP
NUOI_PSEAB       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTP-DFEMGEFKRQDLVYEKHDLLISGP
NUOI_CHRSD       -GRWYPEFFRINFSRCIFCGLCEEACPTSAIQLTP-DFEMSEYRRQELVYEKDDLLISGP
NUOI_ACIAD       -GRWYPEFFRINFSRCIFCGMCEEACPTTAIQMTP-DFELGEYVRQDLVYEKENLLISGP
NUOI_PSYCK       -GRWYPEFFRINFSRCIFCGLCEEACPTTAIQMTP-DFEMGEYVRQDLVYEKEHLLISGP
NUOI1_NITOC      -GRWYPEFFRINFSRCIFCGFCEEACPTYAIQLTP-DFEMGEYERPNLVYEKEDLLINGT
NUOI1_NITMU      -ERRYPEFFRINFSRCIFCGFCEEACPTDAIQLTP-DFEMGEYNRKNLVYEKEDLLIDGT
NUOI_METCA       -GRWYPEFFRINFSRCILCGLCEEACPTYAIQLTP-DFELCEYDRRNLVYEKEHLLIQGT
NUOI1_RHOP2      -GRWYPEHFRINFARCIFCGFCEEACPTAAIQLTP-DFELGEWRRDALVYEKHDLLIAGE
NUOI2_RHOPA      -GRWYPEYFRVNFARCIFCGFCEDACPTAAIQLTP-DYELSEWRRDALVYEKHDLLISGE
NUOI1_RHOP5      -GRWYPEHFRINFARCIFCGYCEEACPTAAIQLTP-DFELSEWRRDALVYDKHDLLIAGE
NUOI2_RHOPB      -GRWYPEHFRINFARCIFCGYCEEACPTAAIQLTP-DFELSEWRRDALVYDKKDLLIAGE
NUOI2_RHOS1      -GRWYPESFRINFARCIFCGYCEEACPTSAIQLTP-DVELADYRRGFLQYEKEDLLISGE
NUOI_BLOFL       -GRWYPEFFRINFSRCIFCGMCEEACPTAAIQLIS-DFEMSDYKRSDLVYEKSDLLISGP
NUOI_BLOPB       -GRWYPKFFRINFSRCIFCGMCEEACPTAAIQLTP-DFEMSDFKRHDLVYEKSDLLISGP
NUOI_BUCBP       -NKWYPKFFRINLSRCIFCGLCEEACPTLAIQLIS-DVELSEYKRQDLVYEKDDLLISGQ
NUOI_BUCAI       -GRWYPKFFRINFSRCIFCGLCEEACPTAAIQLMP-DFELSDFKRQDLVYEKKDLLISGP
NUOI_BUCAP       -GRWYPKFFRINFSRCIFCGLCEEACPTAAIQLMP-DFELSDFNRQNLVYEKEDLLISGP
NUOI_BUCCC       -GRWYAKSFQINLSRCIFCGLCEEACPTMAIQLTP-DIELSEFKRKELLYKKKNLLFSGP
NUOI1_GEOMG      -GRRYARWFRINFSRCIFCGLCAEACPTLAIQMTP-DYEICERDIMELVYEKEDLLIDGC
NUOI2_GEOSL      -GRRYARWFRINFSRCIFCGLCAEACPTLAIQMTP-DYEICERDIMELVYEKEDLLIDGC
NUOI_PELCD       -GRRYAAWFRINFSRCIFCGLCTEACPTLALQMTS-EYELATRELLQVIYEKDELLIDGC
NUOI2_SYNFM      -GRRHAAWFRINFARCIYCGLCEEACPTSAIQLTP-FFETCERDILKLVYEKEDLLVDHQ
NUOI2_RHIEC      -GNRHPAKFEIDTARCLFCGLCEDACPADAIALGQ-QYEFSSFSSADLVIGRDDLLAK-P
NUOI2_RHIME      -GNRRPAKFEIDTARCLFCGLCEDACPADAIALGQ-QYEFSSFSSRDLVIGRDDLLAK-P
NUOI_DEIGD       PGERYAKVYEINMLRCIFCGLCEEACPTGAVVLGN-EFEMADYRSRDFVYGKEDMLVGVE
NUOI_DEIRA       PGERYAKVYEINMLRCIFCGLCEEACPTGAVVLGN-EFEMADYRSRDFVYGKEDMLVGVT
NQO9_THET8       AGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGY-DFEMADYEYSDLVYGKEDMLVDVV
NUOI_PARUW       HGERYASDFQINMLRCIFCGYCEEACPTGAIVLSN-QYELSAYTREDMIYTKDRLTEKTP
NUOI1_SYMTH      PGERYGYKYQVDLLRCIFCGMCEEACPTDCLHLTQ-EFELADFTRESLILQKEQLVNRNP
NUOI_FRAAA       PGERYGSVYQINYLRCILCGLCIEACPTRALTMSN-DYELADDSRRDLIFTKEQLLAPLA
NUOI_FRACC       PGERYGRVYQINYLRCILCGLCIEACPTRALTMSN-DYELADDSRQDLIFTKEQLLAPLR
NUOI_SACEN       PGERYGMDYQINYLRCIGCGLCIEACPTRSLTMTN-EYETADDNRRDLIFTKEDLLAPLL
NUOI_THEFY       PGERYGRVYQINYLRCILCGLCVEACPTRALTMTN-EYELADDSRESLIYTKEQLLAPLQ
NUOI_ACIC1       PGERYGRVYQINYLRCIFCGYCIEACPTRALTMSN-EYELADDNRADLIYTKEQLLAPLA
NUOI2_MYCPA      PGERYGRVYQINYLRCIGCGLCVEACPTRALTMTN-DYEMADDNRADLIYEKDRLLAPLL
NUOI_MYCUA       PGERYGRVYQINYLRCIGCGLCIEACPTRALTMTN-DYELADDNRADLIYEKDRLLAPLQ
NUOI_MYCTU       PGERYGRVYQINYLRCIGCGLCIEACPTRALTMTY-DYELADDNRADLIYEKDRLLAPLL
NUOI_MYCSJ       PGERYGRVYQINYLRCIGCGLCIEACPTRALTMTN-DYEMADDNRADLIWGKDKLLAPLQ
NUOI_MYCS2       PGERYGRVYQINYLRCIGCGLCIEACPTRALTMTT-EYEMADDNRADLIWGKDKLLAPLQ
NUOI_MYCVP       PGERYGRVYQINYLRCIGCGLCIEACPTRALTMTN-DYEMADDNRSDLIYGKDKLLAPLE
NUOI1_MYCPA      PGERYGRVYQINYLRCIGCGFCIEACPTRALTMIN-DYEMADDNRADLIYGKDQLLAPLQ
NUOI_RHOJR       PGERYGQVYQINYLRCIGCGLCIEACPTRALTMTN-EYEMADDNRAGLIYEKDRLLAPLE
NUOI_NOCSJ       PGERYGRVYQINYLRCILCGLCIEACPTRALTMTN-EYELADDNRADLIYEKSDLLAPLL
NUOI1_STRAW      PGERYGRVYQINYARCILCGLCIEACPTRALTMTN-EFELADSSRANLIYTKEQLLAGLD
NUOI1_STRCO      PGERYGRVYQINYARCILCGLCIEACPTRALTMTN-EFELADSSRANLIFTKEQLLAGLE
NUOI_CUTAK       PGERYGRVYEINYLRCILCGMCIEACPTRALTMTN-DFKMADTSRAKHIWTKDELLAPLK
NUOI2_KORVE      GAERYAKVYNIDYNRCIFCGYCVEACPTDAITHGH-GFELATFNASNLVYRKEQLLSGKP
NUOI1_SOLUE      GGERYAKVYNIDYNRCIFCGYCVEACPTDAITHGH-GFEAASYNTSTLVKRKEDMLV--P
NUOI1_ANADE      -VEKYPAKFVIDELRCIVCGFCVEACPKDAIRMDSGEHTPPSYERSAQIWDEKRLLRGPP
NUOI_MYXXD       VIEKYPTQFVIDELRCIVCGLCVDACPKDAIRMDTYTHTPPEYTRQNFVYDIPKLLKGAP
NUOI_CAMFF       --EKAPSKFTIDLLECVFCGLCVEACPKDAIRMDTGIFTKVGNTRESFLADIKTLSQREE
NUOI_PELPD       ---KSPDRFEIDYSRCIFCGFCVEACPEDAIRMSKDTPNFPGFDRENMWATQDLLMNWQP
NUOI_BDEBA       -VEKFPISYEIDILRCVFCGFCEEACPVDAIRLGP-EWQTPGVNGANFIYDINHLAYRPN
NUOI_LEPIC       -EDKYAKKFEIDLLRCIFCGMCEEACPKGAIYLDG-PGEMATDNREDLILTKERMMQLVG
NUOI_CYTH3       -EEKYASLYEINMLRCIFCGLCEEACPKDAVYLTE-ELVPAQYNRKDFIYGKDKLVQPLG
NUOI1_GEOSL      --DKYAERYEIDMLRCIFCGYCVEACPVDALKMTG-QFELANYKREDFIFVKERLLEKK-
NUOI2_AQUAE      -GKRVVSVFNMNMLLCTYCGFCVDACPVDCLYQTD-IHENASYTRKDAVLTLEILEQIGR
NUOI1_AQUAE      -GKKKVVRFDMNLLNCLFCGLCVDACPVGCLTMTD-IFELANYSRRNEVLRMEDLEKFAI
NUOI1_KORVE      --KKVMVTYVYDVSRCMFCGLCEEACPTQSLKLGT-GYEMALYSREGMVLDRKVLE----
NUOI2_SOLUE      --RKELVTFTYDTSRCMFCGLCEDACPVDALELTQ-DFEMASYTREGQIWDRQALE----
NUOI2_SYMTH      --KKVCDRFAIDMSRCMLCNFCVEACPFDSLVMGY-DYELCKVNPENLVFEFEDLLRLGL
NDHI_HORVU       IKRKQLLNYSIDFGVCIFCGNCVEYCPTSCLSMTE-EYELSTYDRHELNYNQIALSRLPI
NDHI_WHEAT       IKRKQLLNYSIDFGVCIFCGNCVEYCPTSCLSMTE-EYELSTYDRHELNYNQIALSRLPI
NDHI_AGRST       IKRKQLLNYSIDFGVCIFCGNCVEYCPTSCLSMTE-EYELSTYDRHELNYNQIALSRLPI
NDHI_MAIZE       IKRKQLLNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALSRLPI
NDHI_CALFG       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSAYNRHELNYNQIALGRLPM
NDHI_ACOCL       VRKKQLLNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPM
NDHI_ILLOL       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQISLGRLPM
NDHI_AMBTC       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPI
NDHI_PLAOC       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPI
NDHI_DIOEL       IKKKQLLNYSIDFGFCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPM
NDHI_LOTJA       IRKKRLLNYSIDFGICIFCGNCIEYCPTNCLSMTE-EYELSAYDRHELNYNQIALGRLPM
NDHI_POPTR       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYNRHELNYNQIALGRLPM
NDHI_MORIN       IRKKQLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPM
NDHI_BUXMI       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPM
NDHI_SPIOL       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPI
NDHI_CITSI       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELATYDRHELNYNQIALGRLPM
NDHI_COFAR       IRKKQLLNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQISLGRLPT
NDHI_NICTO       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPM
NDHI_NASOF       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYEFSTYDRHELNYNQIALGRLPM
NDHI_DAUCA       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPM
NDHI_PELHO       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQTALGRLPM
NDHI_PIPCE       IRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPI
NDHI_SOYBN       IRKKQLLNYSIDFGICIFCGNCIEYCPTNCLSMTE-EYELSTYDRHELNYNQIALGRLPV
NDHI_PHAVU       IRKKRLLNYSIDFGICIFCGNCIEYCPTNCLSMTE-EYELSTYDRHELNYNLIALGRLPV
NDHI_PHYPA       VKKKQLKSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSIYDRHDLNYDQIALGRLPI
NDHI_ANTAG       IKKKQLKSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYDQIALGRLPI
NDHI_MARPO       IKKKQLKNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSTYNRHELNYDQIALGRLPI
NDHI_ANGEV       VRKKQLKNYSIDFAVCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNYDQIALGRLPV
NDHI_PSINU       MRKKQLKSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELATYDRHELNYDQIALSRLPF
NDHI_HUPLU       IRKKQLTSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSTYDRHELNHDQIALGRLPL
NDHI_STAPU       MKKKQLKSYSIDFGVCIFCGNCVEFCPTNCLSMTE-EYELSSYDRHELNYDQVALGRLPN
NDHI_ZYGCR       MKKKQLKSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSAYDRHELNYDHVALGRLPF
NDHI_CHAVU       IRKKKLKNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSVYDRHELNYDQIALGRLPF
NDHI_CHAGL       IKKKQLKSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSVYDRHELNYDHIALGRLPI
NDHI_CHLAT       KKKKQLQTYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSVYDRHELNFDNFALGRLPS
NDHI_MESVI       KKKKQLQTYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSVYDRHELNYDNFALGRLPT
NDHI_NEPOL       VKKKQLRSYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSVYDRHELNFDHVALGRVPT
NDHI_ADICA       VKKKKLKNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELSSYNRHELNFDQTALGRLPP
NDHI_TRIEI       TKKKKLKHYSIDFGVCIFCGNCVEYCPSNCLSMTE-EYELAAYDRHELNYDNVALGRLPY
NDHI_TRIV2       TKKKKLNHYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELATYDRHELNYDSVALGRLPY
NDHI_SYNY3       VKKKELKHYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAYDRHDLNYDNVALGRLPY
NDHI_SYNE7       TKKKDLKNYSIDFGACIFCGNCVEYCPTNCLSMTE-EYELATYDRHELNYDNVALGRLPY
NDHI_THEEB       LKKKELKHYSIDFGVCIFCANCVEYCPTNCLSVTE-EYELATYDRHELNYDSVAMGRIPY
NDHI_SYNJB       LKKKELYSYSIDFGVCIFCANCVEFCPTNCLSVTE-DYELATYDRHDLNYHQVAMGRLPS
NDHI_SYNJA       LKKKELYSYSIDFGVCIFCANCVEFCPTNCLSVTE-DYELATYDRHELNYHQVALGRLPS
NDHI_GLOVI       TKKKELNSYSIDFGVCIFCGNCVEYCPTSCLSMTE-EYELSVYDRHELNYDDVALGRLPT
NDHI_PROM5       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELATFDRHNLNFDNVALGRLPT
NDHI_PROMP       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELATFDRHNLNFDNIALGRLPT
NDHI_PROM0       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELATFDRHNLNFDNVALGRLPT
NDHI_PROMA       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAFDRHSLNFDNVALGRLPT
NDHI_PROMT       TKKKELRNYSIDFGACIFCGNCVEYCPTNCLSMTE-EYELSAFDRHSLNYDNVALGRLPT
NDHI_SYNSC       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAFDRHSLNYDNVALGRLPT
NDHI_SYNPX       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAFDRHSLNYDNVALGRLPT
NDHI_SYNS9       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAFDRHSLNYDNVALGRLPT
NDHI_SYNS3       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAFDRHSLNYDNVALGRLPT
NDHI_SYNPW       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAFDRHSLNFDNVALGRLPT
NDHI_PROMM       TKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTE-EYELAAYDRHSLNYDNVALGRLPT
NUOI1_SYNFM      KGAKVATHYVIDFTRCSLCGICVESCPTGTLQYST-EYELAGESRWDGVIDLMQRFEARR
NUOI_CARHZ       NKRK-LASYEMEMKYCLFCGLCVEACPTNALVFNQ-EYELAKYRIEDIKLTLFKREEITT
NUOI2_STRAW      RSRNVLDRFAIDFSLCMYCGICIEVCPFDALFWSP-EFEYAETDIHELTHERDKLREWMW
NUOI2_STRCO      RSRNVLDRFAIDFALCMYCGICIEVCPFDALFWSP-EFEYAETDIRDLTHERDKLREWMW
NUOI2_ANADE      PKQRVVTQFDIDEAKCMFCGLCVEPCPTGSIQHTR-EFEGTHKHIRNLVFRWADPMNPFP
                         :  :   *  *  * : **   :                             

NUOI_POLNA       -------RYENEIAANRAADAKYR------------------------------------
NUOI_POLSJ       -------RYEAEIAANKAADAKYR------------------------------------
NUOI_METPP       -------RYENEIAANKEADAAYR------------------------------------
NUOI_ACISJ       -------RYEPEIAAAKAADAKYR------------------------------------
NUOI_VEREI       -------RYEAEIAAARAADAKYR------------------------------------
NUOI_PARXL       -------RYETEIAANKAADAPYR------------------------------------
NUOI_RHOFT       -------RYEPQIAAARAADAKYR------------------------------------
NUOI_CUPMC       -------RYEPQIAAAKAADAKYR------------------------------------
NUOI_RALSO       -------RFEPEIAANKAADAKYR------------------------------------
NUOI_BORA1       -------RYEADIAQRRAEDAPYR------------------------------------
NUOI_HERAR       -------RYETEIAAARTADAAYR------------------------------------
NUOI_AZOSB       -------RHEQQIAADREQEAKFR------------------------------------
NUOI_AROAE       -------RYEAQIAADREADAKYR------------------------------------
NUOI_DECAR       -------RYEDQIAKDRELDASYR------------------------------------
NUOI_NITEC       -------RYEEQIAKDRAADAPYR------------------------------------
NUOI2_NITMU      -------RYEEQIAKDRAADAGYR------------------------------------
NUOI_THIDA       -------KYEAQIAQDRAQDAKYR------------------------------------
NUOI_METFK       -------KYEEQIAADRAADARYR------------------------------------
NUOI_NEIMF       -------KYEAEIAKRKAADAPYR------------------------------------
NUOI_CHRVO       -------KYEAEIAANKAADAKYR------------------------------------
NUOI_ALKEH       -------KYEAQIAADRAADAPYR------------------------------------
NUOI_HALHL       -------KYESQLAADRAADAPYR------------------------------------
NUOI2_NITOC      -------KYEAQIAADRAADAPYR------------------------------------
NUOI_FRATN       -------KYEAQIAADRLQDKDFR------------------------------------
NUOI_XYLFT       -------RFEAEIAERRAADAAFR------------------------------------
NUOI_RUTMC       -------QNEQAINQARLEDAKYK------------------------------------
NUOI_VESOH       -------QNEQVINQTKFEDAKYK------------------------------------
NUOI_HYDCU       -------KHESQIAADRAADAKYR------------------------------------
NUOI_LEGPA       -------LMETQLAADRAADEKYR------------------------------------
NUOI_COXBU       -------RYEEQIARDRAKDKKYR------------------------------------
NUOI_RHIL3       -------RWEREIARNIAIDSPYR------------------------------------
NUOI_AGRFC       -------RWEREIARNLALDAPYR------------------------------------
NUOI1_RHIME      -------RWEREIARNIAMDSPYR------------------------------------
NUOI_CHESB       -------RWERELARNIALDAPYR------------------------------------
NUOI_RHILO       -------RWERELARNISLDAPYR------------------------------------
NUOI_BRUSU       -------RWEREIARNIAMDAPYR------------------------------------
NUOI_BARBK       -------RWEREIARNILMDAPYR------------------------------------
NUOI_BRADU       -------RWEREIAKAIELDAPYR------------------------------------
NUOI1_RHOPA      -------RWEREIAKAISLDAPYR------------------------------------
NUOI2_RHOP5      -------RWEREIAKHMALDAPYR------------------------------------
NUOI_CAUVC       -------RWERLIAKNLELDAPYR------------------------------------
NUOI_HYPNA       -------RWERLIAKNLELDAPYR------------------------------------
NUOI_MARMM       -------RWEREIAKNLELDAPYR------------------------------------
NUOI_RUEST       -------RWEAEIARNLELDAPYR------------------------------------
NUOI_ROSDO       -------RWEAEIARNLEMDAPYR------------------------------------
NUOI_JANSC       -------RWESAIAHNLELDAPYR------------------------------------
NUOI1_RHOS1      -------RWEAEIARNLELDAPYR------------------------------------
NUOI_PARDP       -------RWEAEIARNLQLDAPYR------------------------------------
NUOI_SPHAL       -------KWERAIAANLAADAPYR------------------------------------
NUOI_ERYLH       -------KWERAIAANLEADAPYR------------------------------------
NUOI_GRABC       -------RWEPEIARRLELDAPYR------------------------------------
NUOI_MAGSA       -------RWEAELAFRIAADAPYR------------------------------------
NUOI_RHORT       -------RWEPELALRLRKDAAYR------------------------------------
NUOI_RICBR       -------RWEQALANKLHKDYEYR------------------------------------
NUOI_RICTY       -------KWEQELTNKLHKDYQYR------------------------------------
NUOI_ANAMM       -------VWEEALDFRIRKNRPYY------------------------------------
NUOI_ANAPZ       -------IWEEALRYRIKKNQPYY------------------------------------
NUOI_EHRCJ       -------VWEEAIDFRIKKNSQFY------------------------------------
NUOI_EHRCR       -------IWEEAIDLRIKKNSQFY------------------------------------
NUOI_EHRRW       -------IWEEAIDLRIKKNSKFY------------------------------------
NUOI_WOLPM       -------VWEDAIALRLKKNRPYY------------------------------------
NUOI_WOLTR       -------IWEEAIALRLKKDVSYH------------------------------------
NUOI_NEOSM       -------KWESALIKMLNRNDTTH------------------------------------
NUOI_PELUB       -------RWENVLAANIKADNSHR------------------------------------
NUOI_MAGMM       -------SWRAEIDARLNADAKYR------------------------------------
NUOI_SULDN       MKAGTQKEFEGFGAITPHEDERVKKTPLAY------------------------------
NUOI_WOLSU       FMNQGQKEFPGFGALSQDADSKVKKTPLAYFTPKGEENV---------------------
NUOI_CAMJR       LKN--QVEFEGAGSLRKDANLWVKKTPNYYDAMLESALENQNTQEQGENK----------
NUOI_HELAH       AKDCSHAEFLGFGFVSPNYNERMQATPLDYVQEPSKEESKKETPTSPEANKGDENV----
NUOI_HELHP       ----SLLEFGGFGSISVNADERVKTTPLSYCTQDSQ---NMLSESAPQEN---TNV----
NUOI_ECOLI       GKYP---EYNFYRMAGMAIDGKDKGEAENE-AKPIDVKSLLP------------------
NUOI_PECAS       GKYP---EYNFYRMAGMAIDGKDKGEAENE-AKPIDVKGLLP------------------
NUOI_SODGM       GKYP---EYNFYRMAGMAIAGKDKGEAENE-AKPIDVKGLLP------------------
NUOI_PHOLL       GKYP---DYNFYRKTGVAIDGKSKGEADNE-AKPIDVKSLLP------------------
NUOI_BAUCH       GKYP---EYNFYRMAGIACNDKLKGHAENE-TRPINVKDLLP------------------
NUOI_SHEON       GKYP---DYNFYRMSGMAIDGKPKGDAENE-AKPIDVKSLLP------------------
NUOI_AERS4       GKYP---DYNFYRMSGMAIDGKPKGDAEHE-AKPIDVKSLLP------------------
NUOI_PSEPF       GKNP---DYNFYRVAGMAVAGKPKGAAQNE-AEPINVKSLLP------------------
NUOI_PSEAB       GKNP---DYNYYRVAGMAIAGKPKGAAQNE-AEPINVKSLLP------------------
NUOI_CHRSD       GKDH---NYNFYRVAGLSIAGKGKGEAQNE-AEPIDVKSLMP------------------
NUOI_ACIAD       GKYP---DYNFYRVAGMAIDGKEKGQAQKE-SAPIDVRSLLP------------------
NUOI_PSYCK       GKYP---DYNYYRVTGMAVADKPKGAAQNE-AAPIDLRSLLP------------------
NUOI1_NITOC      GKYP---DYNFYRVAGMAIGGKTKGEAENE-ESPVDVRSLMP------------------
NUOI1_NITMU      GKYP---GYNFYRVAGVAIGGKNKGGAENE-APPVDPHSLLP------------------
NUOI_METCA       GKYP---GYSFYRVAGKAIAGKDKGQAENE-APPIDVHSLLP------------------
NUOI1_RHOP2      GKVR---GYRYWSVAGKAIDGKDKGCAENE-SPPVDLKGLLP------------------
NUOI2_RHOPA      GKVR---GYRYWSVAGKAIPGKDKGEAEHE-APPVNLKGLLP------------------
NUOI1_RHOP5      GKVR---GYRYWSVAGKAIQGKDKGEADHE-APPVDLKGLLP------------------
NUOI2_RHOPB      GKVR---GYRYWSVAGKAITGKDKGDAEHE-APPVDLKGLRP------------------
NUOI2_RHOS1      GKHP---GYRYWDVAGKTIAGKAQD--------PVDPKDLCP------------------
NUOI_BLOFL       GKYK---NYDFYQISGVKYSNKYKKESSFE-EKPISVKTILP------------------
NUOI_BLOPB       GKYL---EYDFYQFSGKEILDKKKGDAIKE-SKPINVKNILP------------------
NUOI_BUCBP       GKYL---DYDFYKFSGVEVGTKNKGELDFE-SHPIDVKTLLP------------------
NUOI_BUCAI       GKYP---NYDFYNFSGVTLKGKKTGDLEIQ-ARPIDVKDLLP------------------
NUOI_BUCAP       GKYP---DYDFYRFSGVVIKDKKVDKLEGQ-LKPVNVKDLLP------------------
NUOI_BUCCC       GKFS---KYDFYSISGVNTTYDLKKNLSKKISNCVDVTDLLP------------------
NUOI1_GEOMG      GKDP---AYNFYRHAGIGVTQP-RGAGERE-EEPVDARGLMP------------------
NUOI2_GEOSL      GKDA---GYNFYRHAGIGVAQP-RGAGECE-EEPVDVRGLMP------------------
NUOI_PELCD       GKNA---EYNFYRRAGIGVVAP-RGANPGE-SSPEDVKSNLP------------------
NUOI2_SYNFM      GKDK---EYNFYKYAGVTTDVGGKGEHVQE-DEPVDLRSNLP------------------
NUOI2_RHIEC      GKAA---TGGGVVSARLNTKKDVLVETKEM-QGYNWWRNIRRT-----------------
NUOI2_RHIME      GKAM---TGGGVVAARLNTERDVLVEASEP-RGYNWWRNIRRK-----------------
NUOI_DEIGD       GSLPQRREAQRTGKPVRLGFKVPKGPRPELEGVEYPR-----------------------
NUOI_DEIRA       GSRPQRREALSAGRPVRLGFQVEGGPRAELEGVEYP------------------------
NQO9_THET8       GTKPQRREAKRTGKPVKVGYVVPY-VRPELEGFKAPTEGGKR------------------
NUOI_PARUW       G---------ESGRD----------PSREI------------------------------
NUOI1_SYMTH      S-----------------GFKVPMNVYPPFRRKAVNA-----------------------
NUOI_FRAAA       AGMEAPPHPMRLGSSETDYYVRDPDAPLPWQVTDEQRAAAGGSDSSTDRAADVIDRRTAG
NUOI_FRACC       EGMEAPPHPMRLGSSETDYYTRDPDAPLPWQASGQEQVAGQAAEL---EAADVIARRTAG
NUOI_SACEN       PGMEQPPHPMRLGNDEQDYYVRGPELARQAGVPEGETVETGPEEA----------RR---
NUOI_THEFY       QGMEAPPHPMRLGETEKDYYRLGRDDNAAARADEQNSEAVQ-------------------
NUOI_ACIC1       PGMEPPPHPMRLGDT-KDYYRGTPAAHMLSGEDDAASETTLDRSD---------------
NUOI2_MYCPA      PEMTAPPHPRAPGATDKDYYLGNVTAHGLR---EAQRAGEPR------------------
NUOI_MYCUA       PEMTAPPHPRAAGATDKDYYLGNVTAEGLR---ETQKTGESR------------------
NUOI_MYCTU       PEMAAPPHPRTPGATDKDYYLGNVTAEGLRGVRESQTTGDSR------------------
NUOI_MYCSJ       DGMLAPPHPMAPGATDDDYYLGRIGPVT----------EDVR------------------
NUOI_MYCS2       EGMQAPPHDMAPGKTDDDYYLGNVTPITPV----PSGTEDAR------------------
NUOI_MYCVP       PGMEAPPHAMAPDSTDDDYYLGNIKPAA----------RDAR------------------
NUOI1_MYCPA      PGMAAPPHPMAPGSTERDYYLLDNIAAANR---------EAR------------------
NUOI_RHOJR       PGMVESPHPMAPGATAEDYYRGTVTGGAAAAAQDESEVDDTAGDRP--------------
NUOI_NOCSJ       PGMEQPPHPMRLGDDEGAYYRGEFAAPAPTAP---GSSTEAGA-----------------
NUOI1_STRAW      DNMVDSPHAIYPGMDEQDYYRGLVTEAAPGTERQVAVSKGEKPQDE-----GVEA-----
NUOI1_STRCO      EGMVDSPHAIYPGTDEQDYYRGLVTEAAPGTVQQVAHSKGEVVQEGDSTFGATEPASEEV
NUOI_CUTAK       EGMEQPPHPRRLGDDEDDYFNGLPPSGQDDVRTGPANSGATAHRDDDNDTQHKDEEAA--
NUOI2_KORVE      AHIGANEIFASDSREQQRLDQKAAK-----------------------------------
NUOI1_SOLUE      VPPGAKPPSMADEVPAGAH-----------------------------------------
NUOI1_ANADE      VSYQYDPWLRRGSPSIPPDKLEEMRARAKPFPTVATDEASQTPGFSVRALAAEAKDRAQA
NUOI_MYXXD       VSHPSDPWNKREGSEEPHHVHKEAHTRIGE-GLVELKLPHGEHGGHGKALPAGAQAGHQA
NUOI_CAMFF       GSF---------------------------------------------------------
NUOI_PELPD       ASDAAKSYPGSGQAHQEVHP----------------------------------------
NUOI_BDEBA       LKGGILTHVDDEERHKAGI-----------------------------------------
NUOI_LEPIC       GPIIGERQ----------------------------------------------------
NUOI_CYTH3       TSAHPKTYKPYKK-----------------------------------------------
NUOI1_GEOSL      ------------------------------------------------------------
NUOI2_AQUAE      DWQRRREREPDRIWIDDEQRMKLWGENNVKLPKPEEV-----------------------
NUOI1_AQUAE      DFKQRRGNEPDRIWPNDEEREKLWGKIEWSG-----------------------------
NUOI1_KORVE      ---------HRTAPEPYEK-----------------------------------------
NUOI2_SOLUE      ---------EGPRPTQYKC-----------------------------------------
NUOI2_SYMTH      KYSK----AEEPGPKATRSSTPPWVFHGLTNATEDDIQDIHGYLGRPPLPKGYEPELKPQ
NDHI_HORVU       SIMGDYTIQTIRN-SSESKINEEKSSNSRTITDY--------------------------
NDHI_WHEAT       SIMGDYTIQTIRN-SSESKINKEKSSNSRTITDY--------------------------
NDHI_AGRST       SIMEDYTIQTIRN-STKSKIDEDKSSNSRTITDY--------------------------
NDHI_MAIZE       SIMGDYTIQTIRN-SPQSKIDEEKSWNSRTITDY--------------------------
NDHI_CALFG       SVIEDYTIRTTRN-STQIKIAMDKPLNARTVTNF--------------------------
NDHI_ACOCL       SVIEDYTIRTTTN-LTPIKIAKNKPLGSRTITN---------------------------
NDHI_ILLOL       SVIGDYTIQTIMN-STQMKIAMDKSLDSRTITNY--------------------------
NDHI_AMBTC       PVVGDYTIQTIMN-SNQTKIAMNKPLDSRTITNY--------------------------
NDHI_PLAOC       SVIGDYTIRTIMN-STQIKIATGKPLDSKTITNY--------------------------
NDHI_DIOEL       SVIGDYTIQTVLN-WTQIKIDKNKLLDSRTITNY--------------------------
NDHI_LOTJA       SVIDDYTIRTIQ-------IK---------------------------------------
NDHI_POPTR       SVIDDYTIRTILN-SPQSLIKMVKPPLIKD------------------------------
NDHI_MORIN       SVIDDYTIRTILN-SPQIKNK---------------------------------------
NDHI_BUXMI       SAIGDYTIRTIMN-SPQTKIKTSMDKPFDSRTITNH------------------------
NDHI_SPIOL       SITDDYTIRTILN-SPQTKEKACD------------------------------------
NDHI_CITSI       SVIDDFTIRTVLN-SPQRKNV---------------------------------------
NDHI_COFAR       SVIDDYTIRTISN-SPQIKNG---------------------------------------
NDHI_NICTO       SVINDYTIRTISN-LPQIKNE---------------------------------------
NDHI_NASOF       SVIDDYTIRTILN-SPQRING---------------------------------------
NDHI_DAUCA       SIINDYTTRTILN-LPMK------------------------------------------
NDHI_PELHO       PVIDDYTIRTIFN-LPKIKSK---------------------------------------
NDHI_PIPCE       SVIEDYTIQTNNYELNSYKKMTDKPLDSEKITN---------------------------
NDHI_SOYBN       SVIDDYTIRTIQIKFN--------------------------------------------
NDHI_PHAVU       SVIDDYTIRTIQIK----------------------------------------------
NDHI_PHYPA       SVIEDSTIKTISNLSYLSKGSIEGHSNSRNVTNF--------------------------
NDHI_ANTAG       SIIEDRTIESISSFDFSSKKIMEEHSKSRTVTKFLD------------------------
NDHI_MARPO       SIIEDSTIENIFNLTSLPKGKIEGHIYSRNITNIVN------------------------
NDHI_ANGEV       SVVQDPTTQTVSGLNYLSKGVMEGHPDSRSVTNF--------------------------
NDHI_PSINU       SIVQDSTIQAHSSLGYLS------------------------------------------
NDHI_HUPLU       SVVEDSTIRVISGLTKLPKGTMDGHSASKNVTNFLH------------------------
NDHI_STAPU       PASKDPLVHPILGLGYLQKKLLTQSTESKTITNFDKS-----------------------
NDHI_ZYGCR       PAAKDPMVQPVYGIGYLEKGIVERTKGSKTITTLSTN-----------------------
NDHI_CHAVU       NSFQDALVTKAS------------------------------------------------
NDHI_CHAGL       SSIKDPMVYGVNGLSYLEKNIIQDNTNKDTVTGPYNKE----------------------
NDHI_CHLAT       MVENDAMVKNMKGLGYLPKGVIESHASS--------------------------------
NDHI_MESVI       MVNNDSMVKGIKGLGYLPKGIIEGHIDNQ-------------------------------
NDHI_NEPOL       SVVQDTLVTPVLGLGYLPKGELSSLP----------------------------------
NDHI_ADICA       PASEDVSIQLVLNSRNSFRR----------------------------------------
NDHI_TRIEI       KVTNDPMVTPMRELAYLPKGVIDPHTVPHTSRRAGLRPEEILEQIEAEKTAAEKTAAEIT
NDHI_TRIV2       KVTDDPMVTPLRELVYLPKGVLDPHDLPANAPRAGARPEDLVEKTEA-------------
NDHI_SYNY3       KVTEDPMVTPLRELGYLPKGVIEPHNLPKGSQRAGQHPEDLVKAE---------------
NDHI_SYNE7       KVTDDPMVTPFREFAYLPKGEYDPHVVPSDRPRAGQRPEELVDQYKQAAAANEEN-----
NDHI_THEEB       KVTQDPMVTPIREFAYLPAGVMSGHDLPAGAQRAGERPEAIANTAKSSEN----------
NDHI_SYNJB       KVTEDPMVTPLREFAYLPKGVIDPHDLPAGSQRAGKRPEEILAEMRAAKAAKEAEAKAAK
NDHI_SYNJA       KVTEDPMVTPLREFAYLPKGVIDPHDLPTGSQRAGKRPEEILAEMRAAKAAEAKEDKTAA
NDHI_GLOVI       RVTDDPVVRPIRELAYLPKGVMDGHLEDPGSRRAGELPEEIVARLRPADHSSGTDANKKE
NDHI_PROM5       NVTTDPSVKPLRELAYLPKGVMDPHEVSSSDARVGKLPEEVYDWMKPK-TNEMSDPAVKL
NDHI_PROMP       NVTTDPSVKPLRELAYLPKGVMDPHEVPPSDVRVGKLPEEVYDWMKPK-LNDIKNPTVEP
NDHI_PROM0       NVTTDPSVKPLRELAYLPKGVMDPHEVPSSDTRVGKLPEEVYDWMRSE-SNEKKDKASNP
NDHI_PROMA       SVTSDPSVMPLRELGYLPEGVMDPHELPKDSSRAGKLPIEIMDWMKNKESNKSEDNNLDI
NDHI_PROMT       SVTSDPSVRPLRELPYLPKGIMDPHELPANQLRAGKLPSQIIKELQAD-KSEEEGKNNSS
NDHI_SYNSC       SVTTDPSVVPLRELAYLPAGEMDPHGVASDRPRAGQLPAQVLETLTPPAKPTAKNDGQ--
NDHI_SYNPX       SVTTDPSVQPLRELAYLPAGEMDPHGVPNDRPRAGQLPSQVLETLAPPAKVGAKNEGQ--
NDHI_SYNS9       SVTTDPSVQPLRELVYLPAGEMDPHTVSADRPRAGKLPAEVLETLAP-----VKDEGQ--
NDHI_SYNS3       SVTTDPSVQPLRELVYLPAGEVQPHGVSPDRPRAGKLPEQILEELKAAGSMKAAEDERES
NDHI_SYNPW       SVTTDPAVQPLRELAYLPAGEVQPHGVDPSRPRAGQRPDQVLSSLKQNAGGSAGNEGE-S
NDHI_PROMM       SVTTDPSVQPLRELAYLPKGVMDPHDVPANQPRAGQLPAEALKSLSLQQESVQGDEGE-S
NUOI1_SYNFM      PQSL--------------------------------------------------------
NUOI_CARHZ       GEGSENA-----------------------------------------------------
NUOI2_STRAW      TVPAPPALDPAAEEPKEIAAARKTAEKLAAAQAAAAQTDAAQAEAAQAEAAAEAGSAAEG
NUOI2_STRCO      TVPAPPALDPGAEEPKELAAARKAADKLAAQQ----QPD-------------QPGPDHPG
NUOI2_ANADE      VYKVDKNAEYYPRVPLGSLVRQRLETMAWDRSAPQFLPPEPPKPAEAKPAAKAAPAAKPA
                                                                             

NUOI_POLNA       ------------------------------------------------------
NUOI_POLSJ       ------------------------------------------------------
NUOI_METPP       ------------------------------------------------------
NUOI_ACISJ       ------------------------------------------------------
NUOI_VEREI       ------------------------------------------------------
NUOI_PARXL       ------------------------------------------------------
NUOI_RHOFT       ------------------------------------------------------
NUOI_CUPMC       ------------------------------------------------------
NUOI_RALSO       ------------------------------------------------------
NUOI_BORA1       ------------------------------------------------------
NUOI_HERAR       ------------------------------------------------------
NUOI_AZOSB       ------------------------------------------------------
NUOI_AROAE       ------------------------------------------------------
NUOI_DECAR       ------------------------------------------------------
NUOI_NITEC       ------------------------------------------------------
NUOI2_NITMU      ------------------------------------------------------
NUOI_THIDA       ------------------------------------------------------
NUOI_METFK       ------------------------------------------------------
NUOI_NEIMF       ------------------------------------------------------
NUOI_CHRVO       ------------------------------------------------------
NUOI_ALKEH       ------------------------------------------------------
NUOI_HALHL       ------------------------------------------------------
NUOI2_NITOC      ------------------------------------------------------
NUOI_FRATN       ------------------------------------------------------
NUOI_XYLFT       ------------------------------------------------------
NUOI_RUTMC       ------------------------------------------------------
NUOI_VESOH       ------------------------------------------------------
NUOI_HYDCU       ------------------------------------------------------
NUOI_LEGPA       ------------------------------------------------------
NUOI_COXBU       ------------------------------------------------------
NUOI_RHIL3       ------------------------------------------------------
NUOI_AGRFC       ------------------------------------------------------
NUOI1_RHIME      ------------------------------------------------------
NUOI_CHESB       ------------------------------------------------------
NUOI_RHILO       ------------------------------------------------------
NUOI_BRUSU       ------------------------------------------------------
NUOI_BARBK       ------------------------------------------------------
NUOI_BRADU       ------------------------------------------------------
NUOI1_RHOPA      ------------------------------------------------------
NUOI2_RHOP5      ------------------------------------------------------
NUOI_CAUVC       ------------------------------------------------------
NUOI_HYPNA       ------------------------------------------------------
NUOI_MARMM       ------------------------------------------------------
NUOI_RUEST       ------------------------------------------------------
NUOI_ROSDO       ------------------------------------------------------
NUOI_JANSC       ------------------------------------------------------
NUOI1_RHOS1      ------------------------------------------------------
NUOI_PARDP       ------------------------------------------------------
NUOI_SPHAL       ------------------------------------------------------
NUOI_ERYLH       ------------------------------------------------------
NUOI_GRABC       ------------------------------------------------------
NUOI_MAGSA       ------------------------------------------------------
NUOI_RHORT       ------------------------------------------------------
NUOI_RICBR       ------------------------------------------------------
NUOI_RICTY       ------------------------------------------------------
NUOI_ANAMM       ------------------------------------------------------
NUOI_ANAPZ       ------------------------------------------------------
NUOI_EHRCJ       ------------------------------------------------------
NUOI_EHRCR       ------------------------------------------------------
NUOI_EHRRW       ------------------------------------------------------
NUOI_WOLPM       ------------------------------------------------------
NUOI_WOLTR       ------------------------------------------------------
NUOI_NEOSM       ------------------------------------------------------
NUOI_PELUB       ------------------------------------------------------
NUOI_MAGMM       ------------------------------------------------------
NUOI_SULDN       ------------------------------------------------------
NUOI_WOLSU       ------------------------------------------------------
NUOI_CAMJR       ------------------------------------------------------
NUOI_HELAH       ------------------------------------------------------
NUOI_HELHP       ------------------------------------------------------
NUOI_ECOLI       ------------------------------------------------------
NUOI_PECAS       ------------------------------------------------------
NUOI_SODGM       ------------------------------------------------------
NUOI_PHOLL       ------------------------------------------------------
NUOI_BAUCH       ------------------------------------------------------
NUOI_SHEON       ------------------------------------------------------
NUOI_AERS4       ------------------------------------------------------
NUOI_PSEPF       ------------------------------------------------------
NUOI_PSEAB       ------------------------------------------------------
NUOI_CHRSD       ------------------------------------------------------
NUOI_ACIAD       ------------------------------------------------------
NUOI_PSYCK       ------------------------------------------------------
NUOI1_NITOC      ------------------------------------------------------
NUOI1_NITMU      ------------------------------------------------------
NUOI_METCA       ------------------------------------------------------
NUOI1_RHOP2      ------------------------------------------------------
NUOI2_RHOPA      ------------------------------------------------------
NUOI1_RHOP5      ------------------------------------------------------
NUOI2_RHOPB      ------------------------------------------------------
NUOI2_RHOS1      ------------------------------------------------------
NUOI_BLOFL       ------------------------------------------------------
NUOI_BLOPB       ------------------------------------------------------
NUOI_BUCBP       ------------------------------------------------------
NUOI_BUCAI       ------------------------------------------------------
NUOI_BUCAP       ------------------------------------------------------
NUOI_BUCCC       ------------------------------------------------------
NUOI1_GEOMG      ------------------------------------------------------
NUOI2_GEOSL      ------------------------------------------------------
NUOI_PELCD       ------------------------------------------------------
NUOI2_SYNFM      ------------------------------------------------------
NUOI2_RHIEC      ------------------------------------------------------
NUOI2_RHIME      ------------------------------------------------------
NUOI_DEIGD       ------------------------------------------------------
NUOI_DEIRA       ------------------------------------------------------
NQO9_THET8       ------------------------------------------------------
NUOI_PARUW       ------------------------------------------------------
NUOI1_SYMTH      ------------------------------------------------------
NUOI_FRAAA       EHSRADEVPAHGAGSERPR-----------------------------------
NUOI_FRACC       EHSRADEVPAHGAGSERPR-----------------------------------
NUOI_SACEN       ------------------------------------------------------
NUOI_THEFY       ------------------------------------------------------
NUOI_ACIC1       ------DHSATYEEAERP------------------------------------
NUOI2_MYCPA      ------------------------------------------------------
NUOI_MYCUA       ------------------------------------------------------
NUOI_MYCTU       ------------------------------------------------------
NUOI_MYCSJ       ------------------------------------------------------
NUOI_MYCS2       ------------------------------------------------------
NUOI_MYCVP       ------------------------------------------------------
NUOI1_MYCPA      ------------------------------------------------------
NUOI_RHOJR       ------------------------------------------------------
NUOI_NOCSJ       ------------------------------------------------------
NUOI1_STRAW      ------------------------------------------------------
NUOI1_STRCO      IRR---------------------------------------------------
NUOI_CUTAK       ------------------------------------------------------
NUOI2_KORVE      ------------------------------------------------------
NUOI1_SOLUE      ------------------------------------------------------
NUOI1_ANADE      ARK---------------------------------------------------
NUOI_MYXXD       VVTQQGPIQVTKFIK---------------------------------------
NUOI_CAMFF       ------------------------------------------------------
NUOI_PELPD       ------------------------------------------------------
NUOI_BDEBA       ------------------------------------------------------
NUOI_LEPIC       ------------------------------------------------------
NUOI_CYTH3       ------------------------------------------------------
NUOI1_GEOSL      ------------------------------------------------------
NUOI2_AQUAE      ------------------------------------------------------
NUOI1_AQUAE      ------------------------------------------------------
NUOI1_KORVE      ------------------------------------------------------
NUOI2_SOLUE      ------------------------------------------------------
NUOI2_SYMTH      FRKPAEEAAEAQQAEAAGQPAAEPGKTNGEEAGQP-------------------
NDHI_HORVU       ------------------------------------------------------
NDHI_WHEAT       ------------------------------------------------------
NDHI_AGRST       ------------------------------------------------------
NDHI_MAIZE       ------------------------------------------------------
NDHI_CALFG       ------------------------------------------------------
NDHI_ACOCL       ------------------------------------------------------
NDHI_ILLOL       ------------------------------------------------------
NDHI_AMBTC       ------------------------------------------------------
NDHI_PLAOC       ------------------------------------------------------
NDHI_DIOEL       ------------------------------------------------------
NDHI_LOTJA       ------------------------------------------------------
NDHI_POPTR       ------------------------------------------------------
NDHI_MORIN       ------------------------------------------------------
NDHI_BUXMI       ------------------------------------------------------
NDHI_SPIOL       ------------------------------------------------------
NDHI_CITSI       ------------------------------------------------------
NDHI_COFAR       ------------------------------------------------------
NDHI_NICTO       ------------------------------------------------------
NDHI_NASOF       ------------------------------------------------------
NDHI_DAUCA       ------------------------------------------------------
NDHI_PELHO       ------------------------------------------------------
NDHI_PIPCE       ------------------------------------------------------
NDHI_SOYBN       ------------------------------------------------------
NDHI_PHAVU       ------------------------------------------------------
NDHI_PHYPA       ------------------------------------------------------
NDHI_ANTAG       ------------------------------------------------------
NDHI_MARPO       ------------------------------------------------------
NDHI_ANGEV       ------------------------------------------------------
NDHI_PSINU       ------------------------------------------------------
NDHI_HUPLU       ------------------------------------------------------
NDHI_STAPU       ------------------------------------------------------
NDHI_ZYGCR       ------------------------------------------------------
NDHI_CHAVU       ------------------------------------------------------
NDHI_CHAGL       ------------------------------------------------------
NDHI_CHLAT       ------------------------------------------------------
NDHI_MESVI       ------------------------------------------------------
NDHI_NEPOL       ------------------------------------------------------
NDHI_ADICA       ------------------------------------------------------
NDHI_TRIEI       DK----------------------------------------------------
NDHI_TRIV2       ------------------------------------------------------
NDHI_SYNY3       ------------------------------------------------------
NDHI_SYNE7       ------------------------------------------------------
NDHI_THEEB       ------------------------------------------------------
NDHI_SYNJB       AAAE--------------------------------------------------
NDHI_SYNJA       EQSN--------------------------------------------------
NDHI_GLOVI       GE----------------------------------------------------
NDHI_PROM5       NK----------------------------------------------------
NDHI_PROMP       NK----------------------------------------------------
NDHI_PROM0       NN----------------------------------------------------
NDHI_PROMA       NINSLKVEKDSK------------------------------------------
NDHI_PROMT       DMVPNKLNSTNK------------------------------------------
NDHI_SYNSC       -SSSEAKEGDA-------------------------------------------
NDHI_SYNPX       -STGTTQEGEA-------------------------------------------
NDHI_SYNS9       -SSKAVLKEDA-------------------------------------------
NDHI_SYNS3       SSSASNMEESAG------------------------------------------
NDHI_SYNPW       ATSTNTSKGSAE------------------------------------------
NDHI_PROMM       LQDASDQDQPSG------------------------------------------
NUOI1_SYNFM      ------------------------------------------------------
NUOI_CARHZ       ------------------------------------------------------
NUOI2_STRAW      APDAAPKPQEGEA-----------------------------------------
NUOI2_STRCO      QPDESG--QEGRT-----------------------------------------
NUOI2_ANADE      AAAPAAPAAAAPAAAPAPAKPAAAPAPAAAAAPAAPAAEAPAAPAAPAANPESK