CLUSTAL format seed alignment for MF_01352

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NDHM_NOSS1      MENATLLKSTTRHIRIFAAEIDRDGELVPSNQVLTLDIDPDNEFNWNEDALQKIYRKFDE
NDHM_TRIV2      MENATLLKSTTRHIRIFAAEIDRDGELVPSNQVLTLDIDPDNEFNWNEDALQKIYRKFDE
NDHM_NOSP7      MDNPMLLKSTTRHVRIFAGEIDRDGDLVPSQQVLTLDIDPDNEFNWNEDALQKVYRKFDE
NDHM_TRIEI      ----MLLKSTTRHIRIFAGTVE-NNELVPDDQALTLDIDPDNELNWNDTAVEQVYRKFDE
NDHM_SYNJA      -----MLKCTTRHVHIFAGEVTADNHFVPRDDLLTLDVDPDNELVWNDAALQKVYARFEE
NDHM_SYNJB      -----MLKCTTRHVHIFAGEVTADNNFVPRDDLFTLDVDPDNELVWTDAALQKVYARFEE
NDHM_THEVB      ----MLLKSTTRHVHIYAGHV-VDGEVHPDTETLTLNVDPDNELEWNEAALAKVEAKFRE
NDHM_GLOVI      -----MLKSTTRHVHIFAADI-RNDNFIASDTKLTLDVDPDNEFIWNDPALQKVYSEFDR
NDHM_SYNP2      ----MLLKSTTRHVRIYTAEIQ-KNELIPSETVLTLDVDPDNEFVWPEESLQKVYRQFDA
NDHM_ACAM1      ----MLLKSTTRHIHIYTAEVE-NNELIPSESVLTLDVDPDNELVWSEDALQRVYAKFDE
NDHM_SYNY3      ----MLVKSTTRHVRIFSAEVQ-GNELIPSNNVLTMDVDPDNEFVWNEDALQQVYRRFDE
NDHM_CROS5      ----MFVKSTTRHIRIYAAEVH-NSELVESDNMLTLDVDPDNEFNWDEDALQKVYRKFDE
NDHM_MICAN      ----MLLKSTTRHIRIYTAEVK-NNQLIESNNVLTLDVDPDNEFNWEEVALNKVYSKFDE
NDHM_SYNP6      ----MLLKSTTRHIRIFTAEIE-GNELQPSDTVLTLDVDPDNEFNWNEEALQKVYRQFDD
NDHM_SYNE7      ----MLLKSTTRHIRIFTAEIE-GNELQPSDTVLTLDVDPDNEFNWNEEALQKVYRQFDD
NDHM_SYNS3      -MADTLLKSTTRHVRLFTARVNEG-RLVPDPNQLTLDLDPDNEFLWNDSCIQTVQQRFRE
NDHM_SYNPW      -MAETLLKSTTRHIRLFTARVENG-DLVPDPEQLTLDLDPDNEFLWTEGTVTTIQTRFRD
NDHM_PROMM      -MNETLLKCTTRHVRIFTARVENN-DLVPDPNQLTLDLDPDNEFLWTESVTKEIQQRFAE
NDHM_PROM3      -MNETLLKCTTRHVRIFTARVENN-DLVPDPDQLTLDLDPDNEFLWTESVIKEIQQRFAE
NDHM_PAUCH      -MANTILKSTTRHIRIFTARVENN-DLIADTSQLTLDIDPDNEFLWEQSTIEKIQSRFKE
NDHM_PROM4      -MTDSILKCTTRHIRIFTARCENN-DLVQDSEHLTLDLDPDNEFIWEELVIGKVHKRFSE
NDHM_PROMA      -MTDPLLKCTTRHIRIFTAITQNN-NLIEDSDHLTMDLDPDNEFLWENQAIEKVQNRFSE
NDHM_PROM1      -MSDTILKCTTRHVRIFTAVVENN-DLILDNGHLTLDIDPDNEFSWSDQSIKKVQDYFRE
NDHM_PROMT      -MSNTILKCTTRHVRIFTAVVENN-DLIFDNGHLTLDIDPDNEFSWSDQSIKKVQDYFRE
NDHM_SYNS9      -MADTLLKCTTRHVRLFTARVDND-DLVPSANELTLDLDPDNEFIWSESCISQVQQRFKQ
NDHM_PARMW      -MADTLLKCTTRHVRLFTARVDNQ-DLVPSADELTLDLDPDNEFLWSDAVVSKVQQRFQQ
NDHM_SYNSC      -MADTLLKCTTRHVRLFTAALQEE-DLVPSDDQLTLDLDPDNEFLWDAASLAKVQGRFKE
NDHM_SYNR3      -MSDTPLKCTTRHVRIFTATVEDNGELKASSDKLTLDLDPDNEFEWDQPVLAKVQQRFAE
NDHM_PROMS      -MEKMLLKSTTRHVRIFTAEVVDE-ELKFHPNKLTLDLDPDNEFIWNEDSLNKINEKFNE
NDHM_PROM0      -MEKMLLKSTTRHVRIFTAEVVDE-ELKFHPNKLTLDLDPDNEFIWNEDSLNKINEKFNG
NDHM_PROM9      -MEKMLLKSTTRHVRIFTAEVVDN-ELQFHPNKLTLDLDPDNEFIWNEDSLNEINKKFNE
NDHM_PROM2      -MEKMLLKSTTRHVRIFTAEVVDK-ELQFHPNKLTLDLDPDNEFIWNEDSLKKINQKFKE
NDHM_PROMP      -MEKMLLKSTTRHVRIFTADVINN-DLVFHPNKLTLDLDPDNEFIWNEDSLKKVNQRFTE
NDHM_PROM5      -MEKMLLKSTTRHVRIFTAEVVNN-DLKYHPNKLTLDLDPDNEFIWNEESLKKVNQKFTE
                      :*.****:::::.       .      :*:::*****: *       :   *  

NDHM_NOSS1      LVEASSGADLTDYNLRRIGSDLEHYLRSLLQKGEISYNLSARVTNYSLGLPQVAVEDK--
NDHM_TRIV2      LVEASSGADLTDYNLRRIGSDLEHYLRSLLQKGEISYNLSARVTNYSLGLPQVAVEDK--
NDHM_NOSP7      LVEASSGADLTDYNLRRVGSDLEHYLRSLLQLGEISYNLSARVTNYSMGVPQVAIDDKQV
NDHM_TRIEI      LVESYSGSDLTEYNLRCMGSDLEHFVRSLLQSGEISYNLGSRVNNYSLGLPRVDVDAEAK
NDHM_SYNJA      LVEEYRGRDLTEYNLRRIGSDLEHFIRSLLKQGEIAYNLQGRTPNYSMGFPQIPAEEIVG
NDHM_SYNJB      LVEEYRGRDLTEYNIRRIGSDLEHFIRSLLKQGEIAYNLQGRAPNFSMGFPQIPAEEIVG
NDHM_THEVB      LVANAAGEDLTEYNLRRIGSDLEHFIRSLLMQGEIGYNLNSRVRNYSLGIPRVNHS----
NDHM_GLOVI      LVAAYTGLALTEYNLRRIGSDLENFIRGLLQQGEIAYNLDSRVLNFSMGRPQVRGPGQIE
NDHM_SYNP2      LVESNSGEDLTEYNLRRIGSDLEAFIRDLLQKGELRYNLDSRVMNFSMGLPQMDHPDSQG
NDHM_ACAM1      LVETYSGEDLTDYNLRRIGSDLEHYVRSLLQKGIVGYNLSSRVRNFSMGLPQVIASESK-
NDHM_SYNY3      LVESYSGEDLTDYNLRRIGSDLEHFIRDLLQAGKVSYNLDCRVLNYSMGLPKVENQETAG
NDHM_CROS5      LVEAASGEELSDYNLRRIGSDLEHFVRNLLQNGEISYNLKSRVLNYSMGLPKVESPETEG
NDHM_MICAN      LVESYNGEELSEYNLRRIGSDLEHFIRSLLQKGEISYNLNARVQNYSMGLPKLG------
NDHM_SYNP6      LVESYAGQELSEYNLRRIGSELEVLLRQMLQAGEISYNLNCRVLNYSMGVPQAVV-----
NDHM_SYNE7      LVESYAGQELSEYNLRRIGSELEVLLRQMLQAGEISYNLNCRVLNYSMGVPQAVV-----
NDHM_SYNS3      LVEAHAGQPLNDYNLRRIGSELEGSIRQLLQAGQLSYNPDCRVLNYSMGLPRTPELL---
NDHM_SYNPW      LVESYAGQPLNDYNLRRIGTELEGSIRELLQAGSLTYNPDCRVMNYSMGLPRTPELL---
NDHM_PROMM      LVASHAGGELSDYNLRRIGSELEGTIRKLLQAGKLSYNPECRVLNYSMGLPRTPELL---
NDHM_PROM3      LVASHAGGELSDYNLRKIGSELEGTIRKLLQAGKLSYNPECRVLNYSMGLPRTPELL---
NDHM_PAUCH      LVECHTGADLTDYTLRRIGTELEGTLFSLLQAGELSYNPNARVLNYSMGLPRTTELS---
NDHM_PROM4      LVDSYSGKDLSDYNLRKIGSDLEGTIRQLLQAGELKYNPDCRVLNYSMGLPRTKDLL---
NDHM_PROMA      LVESQVGQELSDYVLRKIGSDLESYIRQMLQAGEVSYNPDSRVLNYSMGLPRTPELL---
NDHM_PROM1      LVELQADNELSDYTLRKIGSLLEDFIRKLLKDGELSYNPNSRVMNYSMGLPRTQELL---
NDHM_PROMT      LVDFQADNELSDYSLRKIGSLLEDFIRKLLKDGELSYNPNSRVMNYSMGLPRTQELL---
NDHM_SYNS9      LVDAAAGGELSDYTLRRIGTDLEGFIRQLLQRGELSYNPEARVQNFSMGLPRTPELL---
NDHM_PARMW      LVEAGAGGELSDYSLRRIGTDLEGYIRQLLQAGELSYNPDGRVQNFSMGLPRTPDLL---
NDHM_SYNSC      LVDAAAGGELSDYTLRRIGTDLEGFIRQLLQAGELSYNPDGRVQNFSMGLPRTPELL---
NDHM_SYNR3      LVDAAAGTELSDYNLRRIGTDLEGFIRQLLQAGELRYNLGARVLNYSMGLPRTPETL---
NDHM_PROMS      LIKERAGKDLDDYELRKIGSEIEGLIKFLLQNGQLSYNPDCRVMNYSMGLPKTNEVL---
NDHM_PROM0      LIKERAGKDLDDYELRKIGSEIEGLIKFLLQNGQLSYNPDCRVMNYSMGLPMTNEVL---
NDHM_PROM9      LIKERAGKDLDDYELRKIGSEIEGLIKILLQNGQLSYNPDCRVMNYSMGLPKTNEVL---
NDHM_PROM2      LINERAGRDLDDYELRKIGSEVEGLIKFLLQNGELSYNPDCRVMNYSMGLPKTNELL---
NDHM_PROMP      LVQERAGKSLDDYELRKIGSEIEGLIKYLLQNGLLSYNPECRVMNYSMGLPKTKEVL---
NDHM_PROM5      LVEERAGKSLDDYELRKIGSEVEGLIKYLLQNSLLSYNPECRVMNYSMGLPKTKEVL---
                *:    .  * :* :* :*: :*  :  :*  . : **   *. *:*:* *         

NDHM_NOSS1      ------
NDHM_TRIV2      ------
NDHM_NOSP7      S-----
NDHM_TRIEI      ------
NDHM_SYNJA      QYIPKG
NDHM_SYNJB      QYIPKG
NDHM_THEVB      ------
NDHM_GLOVI      NRPGQ-
NDHM_SYNP2      AYLQ--
NDHM_ACAM1      ------
NDHM_SYNY3      KYWLDN
NDHM_CROS5      AYNL--
NDHM_MICAN      ------
NDHM_SYNP6      ------
NDHM_SYNE7      ------
NDHM_SYNS3      ------
NDHM_SYNPW      ------
NDHM_PROMM      ------
NDHM_PROM3      ------
NDHM_PAUCH      ------
NDHM_PROM4      ------
NDHM_PROMA      ------
NDHM_PROM1      ------
NDHM_PROMT      ------
NDHM_SYNS9      ------
NDHM_PARMW      ------
NDHM_SYNSC      ------
NDHM_SYNR3      ------
NDHM_PROMS      ------
NDHM_PROM0      ------
NDHM_PROM9      ------
NDHM_PROM2      ------
NDHM_PROMP      ------
NDHM_PROM5      ------