CLUSTAL format seed alignment for MF_01353

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NDHN_THEEB      ----MGLLA-GYQFVKDLESAGALALFVPPEGGFEGRYQRRLRSKGYTTLPMSAPGLGDL
NDHN_ACAM1      ----MPLLATGKKFIRTIEQSGAVGIYVPSEGGFEGRYKRRLRATGYLTLFVSAPGMGDL
NDHN_SYNJB      ----MLLVGSGAKFVQQLEQAGALAIYVTPEGGSEGHYLRRLRGAGYEVVTLSSKGIGDL
NDHN_SYNJA      ----MLLVGSGAKFVQQLEQCGALAIFVTPEGGSEGHYLRRLRGAGYEVVTLSSKGIGDL
NDHN_GLOVI      MPLLNLVLDNGSRFVADVEKHSSIALWAPPEGGIEGNYQRRLRGIGYRTQIITAKGLGDI
NDHN_SYNP6      ----MALITTGSKFLRALEQEGALAVYAPLEGGYEGRYLRRLRSKGYSALTYSARGLGDP
NDHN_SYNE7      ----MALITTGSKFLRALEQEGALAVYAPLEGGYEGRYLRRLRSKGYSALTYSARGLGDP
NDHN_SYNY3      -MLPLPLIANGKGFIRALENDGALAVYAPLEGGYEGRYQRRLRANGYASISLSARGLGDV
NDHN_CROS5      ----MALLTTGKGFVRALEKSGALGVYAPLEGGFEGRYQRRLRTNGYDSLSLTARGLGDV
NDHN_MICAN      ----MALLTTGKPFIRDLEQYGALGVYAPLEGGYEGRYQRRLRATGYNVLHITARGLGDL
NDHN_TRIV2      ----MALITTGNGLIRDLEKFGSVGVYVPLEGGFEGRYRRRLRAAGYTTLQFTARGLGDV
NDHN_NOSS1      ----MALITTGNGLIRDLEKFGSVGVYVPLEGGFEGRYRRRLRAAGYTTLQFTARGLGDV
NDHN_NOSP7      ----MALITTGNGLIRDLEKFGALGVYVPLEGGYEGRYQRRLRAAGYTTLHITAKGLGDV
NDHN_TRIEI      ----MALITTGRGMIRDLEKSGSLAVYPPLEGGFEGRYQRRLRASGYVSESITARGLGDL
NDHN_SYNP2      ----MALLTTGKSFIRTVEKSGAVAVYAPLEGGFEGRYVRRLRCSGYSVVNLTARGLGDV
NDHN_SYNPW      ----MPLLLSGRGFRRELESAGCMAVHAPLEGGAETRLLRRLRAAGYRTHLTSARGLGDP
NDHN_SYNS3      ----MPLLLSGRGFRRELESAGCMAVFAPLEGGAETRLLRRLRGAGYRTQLSSARGLGDP
NDHN_PROM3      ----MPLLLSGRVFRRDLDACGCLAMHVPLEGGSETRLLRRLRAAGYRTQLSSARGLGDP
NDHN_PROMM      ----MPLLLSGRVFRRDLDACGCLAMHVPLEGGSETRLLRRLRAAGYRTQLSSARGLGDP
NDHN_SYNS9      MHAPMPLLLTGRGFRRDLEANGCLAVHAPLEGGAETRLLRRLRGAGYRTRMTSARGLGDP
NDHN_SYNPX      ----MPLLLTGRTFRRDLEAHGCLAVHAPLEGGAETRLLRRLRGAGYRTRLWSARGLGDP
NDHN_SYNSC      ----MPLLLTGQAFRRDLEANGCLAVQAPLEGGAETRLLRRLRGAGYSTRMTSARGLGDP
NDHN_PROMA      ----MPLLLSGRKFRHDLEASGCLAINVPLEGGAETRLLRRLKAAGYKTQITSVRGLGDP
NDHN_PROM4      ----MPLLLSGKEFRDDLESACCLAIQTPLEGGAETRLLRRLKAAGYRTQITSVRGFGDP
NDHN_PROM1      ----MPLLLSGQKFRTDLESFGCLAILSPLEGGAETRLLRRLRASGYQTQITSARGLGDP
NDHN_PROMT      ----MPLLLSGQKFRTDLESFGCLAILSPLEGGAETRLLRRLRASGYQTQVTSARGLGDP
NDHN_PROMS      ----MPLLLSGKKFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDP
NDHN_PROM2      ----MPLLLTGKKFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDP
NDHN_PROM9      ----MPLLLTGKQFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDP
NDHN_PROM0      ----MPLLLTGKKFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDP
NDHN_PROM5      ----MPLLLSGKKFHNDLKKNKCLAMFAPLEGGYETRLLRRMRAKGFKTYITSARGLGDP
NDHN_PROMP      ----MPLLLTGKKFHNDLNKNKCLAMFAPLEGGYETRLLRRMRAKGFKTYITSARGLGDP
NDHN_SYNR3      ----MPLLLTGRAFRRDLERERALAVYAPLEGGAETRLLRRLRAAGYRTELTSARGLGDP
NDHN_PAUCH      ----MPLLLTGQEFRRDLERDGALALFVPLEGGAETRLMRRLRAVGYKAYLTSAKGLGDP
                      ::  *  :   :.   .:.:  . *** * .  **::  *:     :  *:** 

NDHN_THEEB      AAYLTQEHGIRPAHTGKE--------DIRVYFQPPLVTYHLENLPPNAKGLVLWLIDGKR
NDHN_ACAM1      ASYFTDVHGVRPPHLGKN--------QIRTYFLPPFVTYQLENLPPQAKGLALWLYDGKR
NDHN_SYNJB      ASYLTRIHGVRPATLGKS--------ERRTYFFPALIEQYRATLPPKAKGLVFWFYEGHV
NDHN_SYNJA      ASYLTSSHGVRPATLGKS--------QRRTYFYPSLIEQYRATLPPKAKGLVFWFYEGHV
NDHN_GLOVI      SRFLLESHGVRPAHLGKK--------DKRVFTLPPELAIYMDTLPASAKGFVLWIIEGKV
NDHN_SYNP6      AQFLMDIHGVRPPHLGKQ-TIGNEAAVGRVEYVLPLVGYPLQNLPANAKGLVLWLLEGHV
NDHN_SYNE7      AQFLMDIHGVRPPHLGKQ-TIGNEAAVGRVEYVLPLVGYPLQNLPANAKGLVLWLLEGHV
NDHN_SYNY3      EAYLMQVHGVRPAHLGKK-NIAQEGAVGPIYFAQPIAGYQLENLPAQSKGLVLWILEGYI
NDHN_CROS5      SAYLMGVHGVRPPHLGKK-NIGQGAAVGPIYFVPPIAAYQLESLSPQSKGLVLWILEGYI
NDHN_MICAN      SAYLTGIHGVRPPHLGKK-NIGREAAVGPVYFIPPIATYQLENLPPKSKGLVIWIIESFV
NDHN_TRIV2      AAYLTGVHGVRPPHLGKK-SSGNGAAVGNVYYLPPIVGSQLEHLPPKSKGLVLWIIEGHI
NDHN_NOSS1      AAYLTGVHGVRPPHLGKK-SSGNGAAVGNVYYLPPIVGSQLEHLPPKSKGLVLWIIEGHI
NDHN_NOSP7      AAYLTRIHGVRPPHLGKK-STGSGAAVGQVYYLPPILDSHLEQLPPKSKGLVLWIIEGHI
NDHN_TRIEI      AMYLTGVHGVRPPHLGKK-TVGNGPAVGYVYYVPPIVNYKLEHLPPKAKGLVLWIMEGQI
NDHN_SYNP2      AAYLTQYHGIRPPHLGKKDIAGSGAAVGLRYYVPGIASYQLENLPQKSKGIILWIIEGFV
NDHN_SYNPW      EVFLFQKHGVRPPHLGHQSVGRGA----AVGEVHDVMPLLGEVFLG-DKPVVLWLLEGQV
NDHN_SYNS3      EVFLFQKHGIRPPHLGHQSVGRGA----AVGEVQEVMPLLGESMLG-TKPVVLWLLEGQV
NDHN_PROM3      EVFLFQLHGIRPPHLGHQSVGRNG----AVGEVQQVMPQLAELFVD-NVPVVLWLLEGQV
NDHN_PROMM      EVFLFELHGIRPPHLGHQSVGRNG----AVGEVQQVMPQLAELFVD-NAPVVLWLLEGQV
NDHN_SYNS9      EVFLTQKHGIRPPHLGHNCVGRGA----AVGEVQQVVPLIGDLLDG-DDSVALWILEGQV
NDHN_SYNPX      EVFLTQKHGIRPPHLGHQSVGRGA----AVGEVQEVVPQLGDLLDG-DAQVALWLLEGQV
NDHN_SYNSC      EVFLTQKHGIRPPHLGHQSVGRGA----AVGEVQEVAPQLGDLFES-DAPVALWLLEGQV
NDHN_PROMA      EAFLLKLHGIRPPHLGHQNVGRNG----ALGEVQQVIPQVNELLAG-EKSVVLWLLEGQV
NDHN_PROM4      EVFLLKLHGIRPPHLGHQNIGRNG----ALGEVQEVIPQLHELLSE-EQPLALWLLEGQV
NDHN_PROM1      VVFLTQLHGIRPPHLGHQNVGRNG----ALGEVQQVIPQLNELLVE-DKPLVLWLLEGQV
NDHN_PROMT      VVFLTQLHGIRPPHLGHQNVGRNG----ALGEVQQVIPQLNELLVE-DKPLVLWLLEGQV
NDHN_PROMS      EVFLLKLHGVRPPHLGHQSVGRNG----ALGEVQQVIPQASELFNENDKNKLLWLLEGQV
NDHN_PROM2      EVFLLKLHGVRPPHLGHQSVGRNG----ALGEVQQVIPQASELFNENDKNKLLWLLEGQV
NDHN_PROM9      EVFLLKLHGVRPPHLGHQSVGRNG----ALGEVQQVIPQASELFNENDKNKLLWLLEGQV
NDHN_PROM0      EVFLLKLHGVRPPHLGHQSVGRNG----ALGEVQQVIPQASELFNENDKNKLLWLLEGQV
NDHN_PROM5      EVFLLNLHGIRPPHLGHQSIGRNG----ALGEVQQVIPQASELFNENDKDKLLWLLEGQV
NDHN_PROMP      EVFLLKLHGIRPPHLGHQSIGRNG----ALGEVQQVIPQASELFNENDKDKLLWLLEGQV
NDHN_SYNR3      EAFLLGLHGVRPPHLGHHCVGRDA----AVGEVQLVMPQLGPALAS-GAPVVLWMLEGQV
NDHN_PAUCH      EAYLLKLHEQHVPHLGRRMSTEGKPEGKSVGHVPKVMPMLGPLLEG-KSPILLWLLEGQV
                  ::   *  : .  *:                          :        :*: :.  

NDHN_THEEB      LSKQEFAYLAQLTQTLPKFKVVVEVGGDRVVRWEPLADWVAAA----
NDHN_ACAM1      LAKQELAYLSAITASEPRLKVVVELGGARSFEWQPLSDIVAAA----
NDHN_SYNJB      FSQQELSYLVKLSREDKGVKFVVELGRERSIRWQPLQSA--------
NDHN_SYNJA      LSRQELSYLVKLSQEDKGVKFVVELGRERSIRWQPLQSA--------
NDHN_GLOVI      LSLFELESLVGLPAAVPKLKVIVEVGSDYNIRWMPLEQAVSKMAEGR
NDHN_SYNP6      LSPQELSYFVTLPQAEPRLKVVIEMGGDRGFSWQPLAAVAEAA----
NDHN_SYNE7      LSPQELSYFVTLPQAEPRLKVVIEMGGDRGFSWQPLAAVAEAA----
NDHN_SYNY3      LSQTEIQDLISLTKRVPKLKVVLEMGGDRVFRWQPLLDCLQAA----
NDHN_CROS5      LSKAELEYLVSLPQQEPRIKVVVELGGERYFRWEPLENLIAVA----
NDHN_MICAN      LSSEEKQYLINLSQQEPRLKFVLELGGERYFRWQPLSKSLIAA----
NDHN_TRIV2      LSDQEVEFLTDLPKLEPRVKVVVERGGDRTFRWKALKDTFSASYQAV
NDHN_NOSS1      LSDQEVEFLTSLPSLEPRVKVVVERGGDRTFRWKALKDTFSASYQAV
NDHN_NOSP7      LSNEELEYLTNLPQLEPRVKVVIERGGDRAFRWTSLEKTLLAS----
NDHN_TRIEI      LSSQEIEYLTVLPKSEPRVKVIVEMGGDRFFRWTPLQNTLVPA----
NDHN_SYNP2      LSRQEQEYLVSLTQDNPQIKVVVEMGGDRQFSFKPLADLLV------
NDHN_SYNPW      LSRSELLSLCDLCRREPRLKIVVEMGGARSLRWQPMTQLLAA-----
NDHN_SYNS3      LSRSELSALCDLCRREPRLKVVVEMGGARSLRWQPLKELLSN-----
NDHN_PROM3      LSRSELLALCDLCKRESRLRVVVEMGGARSLNWQPMSTLLGV-----
NDHN_PROMM      LSRSELLALCDLCKRESRLRVVVEMGGARSLNWQPMSTLLGD-----
NDHN_SYNS9      LSRSELLSLCDLCKREPRLRIIVEMGGARSLRWQPMKALLGA-----
NDHN_SYNPX      LSQSELRSLCDLCSREPRLRIIVEMGGARSLRWQPMSGLLAS-----
NDHN_SYNSC      LSRSELLSLCDLCKREPRLRIIVEMGGARSLKWEPMTTYLKA-----
NDHN_PROMA      LSRSEILSLCDLCDKEPRLKIVIEMGGARALRWQSMRSFIQ------
NDHN_PROM4      LSRSELLALCDLSEKDPQLKIVVEMGGERKLKWQSMRKFLEQ-----
NDHN_PROM1      LSKSELLAISNLCQKEPRIKIVIEMGGARSIKWQPLNEFINKD----
NDHN_PROMT      LSKSELLAINNLCQKEPRIKIVIEMGGARSIKWQPLNEFINKD----
NDHN_PROMS      LSQSELESLIEICTNDNKLTIVVEMGGSRKLEWKPLSNYILDEFES-
NDHN_PROM2      LSQSELESLIEICTNDNKLTIVVEMGGSRKLEWKPLSNYILDEFES-
NDHN_PROM9      LSQSELESLIEICTNDNKLSIVVEMGGSRKLEWKPLSNYILDEFES-
NDHN_PROM0      LSQSELESLIEICTKDNKLTIVVEMGGSRKLEWKSLSNYILDEFEN-
NDHN_PROM5      LSQSELENLIKLPTADNKLKIVVEMGGSRKLEWKSLNDYVLNEF---
NDHN_PROMP      LSQSELESLIKICTSDNKLKIVVEMGGSRKLEWKSLNDYILNEF---
NDHN_SYNR3      LSSAEQASLLALCEREPRLHMVLELGGSRSLRWKPLRAALAA-----
NDHN_PAUCH      LSSSELSAISNLPKREPRLKIVVEMGGARALRWESLGKLVESR----
                ::  *   :  :      . .::* *    . : .: