CLUSTAL format seed alignment for MF_01355

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NDHL_SYNS9      MDFQALLSQLP------QETLFVLLAYGAVLGTYLIAVPLALYAWINLRWYRMSKFERLG
NDHL_SYNR3      MPFQQLLSQLP------DQALPVLLAYGALGGAYLLVVPLALLLWMNKRWHQMGKIERTA
NDHL_PAUCH      MSFFRYLSDIS------SETRTLLLAYGVLGGLYLILVPLALYWWMNRRWYIMGKIERLF
NDHL_PROM3      MFLQAVTSPIS------INSLMVLAAYVLLGGLYLIVVPLLLYSWMNRRWHCMGKFERLS
NDHL_PROMM      MFLQAVTSPIS------INSLMVLAAYALLGGLYLIVVPLLLYSWMNRRWHCMGKFERLS
NDHL_SYNSC      MDLSSLLSQIP------QDTLLVLLAYTVLGGLYLVVVPLALYAWMNQRWHRMGKLERLG
NDHL_SYNPX      MDLQSLASSIP------QDTLLVILAYALLGGLYLLVVPLALFFWMNSRWTRMGKIERLL
NDHL_SYNS3      MSIENLLSSVS------LDTLLVIGGYVALGGLYLVVMPLLLFFWMNWRWHVMGKIERFS
NDHL_PROMA      -----MANEVF------NSSLFVIGTYLFLGTLYLVFIPLGLYFWMNTRWNYMGKIERLL
NDHL_SYNPW      --METLLNAIP------QETLLVIGAYGALGAAYLVVIPLFLYFWMNRRWTVMGKLERLG
NDHL_PROMS      --MESFFN----------NTFATLIAYIGIIFTYLLVIPLLLFYWMNNRWNIMGKFERLG
NDHL_PROM0      --MESIFN----------NSFATLIAYIGIISTYLLVIPLLLFYWMNNRWNIMGKFERLG
NDHL_PROM2      --METFFN----------NSFATLIAYIGIISTYLLVIPLFLFYWMNNRWNVMGKFERLG
NDHL_PROM9      --MESFFN----------NSFATLIAYMGVITIYLLVIPLLLFYWMNNRWHVMGKYERLG
NDHL_PROM5      --MESILN----------NSVITFVAYVGIISIYLFVIPLILFYWMNNRWNVMGKLERLG
NDHL_PROMP      --MESIFN----------NSFATLVAYVGIVSIYLLVIPLILFYWMNNRWNVMGKFERLI
NDHL_PROM1      MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLFVVPLFLFYWMNNRWNVMGKFERLF
NDHL_PROMT      MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLLVVPLFLFYWMNNRWNVMGKLERLF
NDHL_PROM4      --MASQFAS---------NSLLVLGAYGIIGFLYLVVIPLFLYFWMNIRWNFMNKFERLC
NDHL_SYNE7      ----------------MTVTLIIAALYLALAGAYLLVVPAALYLYLQKRWYVASSWERAF
NDHL_SYNP6      ----------------MTVTLIIAALYLALAGAYLLVVPAALYLYLQKRWYVASSWERAF
NDHL_ACAM1      ----------------MVVNLI---LLLGLLGGYLLVMPAITYFYLQKRWYVASSLERGF
NDHL_CROS5      -----MDTIIDAIASLPQDTLIVAVLYLGLSLLYLLIIPGFVYFYLNSRWYVASSFERAF
NDHL_MICAN      -----MQSI------LTQETIIIALIYLSLSVLYLLVIPAVIYYYLNTRWYVASSWERGF
NDHL_SYNP2      -----MPFD------IPVETLLIATLYLSLSVTYLLVLPAGLYFYLNNRWYVASSIERLV
NDHL_SYNY3      -----MEDLLGL---LLSETGLLAIIYLGLSLAYLLVFPALLYWYLQKRWYVASSVERLV
NDHL_NOSS1      --------------------MIVPLLYLALAGAYLLVVPVALLFYLKLRWYVVSSIERTF
NDHL_TRIV2      --------------------MIVPLLYLALAGAYLLVVPVALMFYLKQRWYVVSSVERTF
NDHL_NOSP7      --------------------MIVALLYLILAGAYLLVIPIAVLFYLKQRWYVASSIERLL
NDHL_TRIEI      ------------MNLDLDTNLIILIIYAALAGAYFLVMPAIVYAYLKTRWYVVSSIERVF
NDHL_THEEB      --------------MAVSTELLVLGVYGALAGLYLLVVPAIVYAYLNARWYVASSFERAF
NDHL_SYNJB      ---------------MASTPSLIGLTYAGLAVLYLLVLPLLSLLYVDKRWTSGSAWEKVL
NDHL_SYNJA      ---------------MLSTSTLIGLTYAALAVLYLLVLPFLFLVYVDKRWNYSGAWEKVL
                                             :   *:. .*     ::. **   .  *:  

NDHL_SYNS9      VYGLVFLFFPGMIVFAPFINLRLSGQGEV------
NDHL_SYNR3      IYGMVFLFFPGLILFAPFINLRMAGQGEA------
NDHL_PAUCH      VYGLVFLFFPGLILLSPFLNMRLKGQGET------
NDHL_PROM3      AYGMVFLFFPGLILFAPFLNLRLNGQGEV------
NDHL_PROMM      AYGLVFLFFPGLILFAPFLNLRLNGQGEV------
NDHL_SYNSC      IYGMVFFFFPGMILFAPFLNFRLSGQGDV------
NDHL_SYNPX      VYGLVFLFFPGMVVFAPFLNFRLSGQGDN------
NDHL_SYNS3      VYGLVFFFFPGMIVFAPFLNLRLSGQGEV------
NDHL_PROMA      IYSLVFLFFPGLILFAPFLNLRMNGQGDV------
NDHL_SYNPW      IYGLVFLFFPGLILFAPFLNLRMSGQGDV------
NDHL_PROMS      IYGLVFLFFPGLILFSPFLNLRLKGSGKG------
NDHL_PROM0      IYGLVFLFFPGLILFSPFLNLRLKGTGKG------
NDHL_PROM2      IYGLVFLFFPGLILFSPFLNLRPKGSGKG------
NDHL_PROM9      IYGLVFLFFPGLILFSPFLNLRLKGSGKG------
NDHL_PROM5      VYGLVFLFFPGLILFSPFLNLRLRGNNEG------
NDHL_PROMP      VYGLVFLFFPGLILFSPFLNLRLRGDSKG------
NDHL_PROM1      IYGLVFLFFPGMVLFAPFLNLRMNGKEES------
NDHL_PROMT      IYGLVFLFFPGMILFAPFLNLRMNGKEGS------
NDHL_PROM4      LYGLVFLFFPWFDFICSFFKPKNSWARRDLAIDSH
NDHL_SYNE7      MYFLVFFFFPGLLLLAPLLNFRPRSRQIPA-----
NDHL_SYNP6      MYFLVFFFFPGLLLLAPLLNFRPRSRQIPA-----
NDHL_ACAM1      MYFLVFFFFPSLLLLSPFLNFRPQPRKI-------
NDHL_CROS5      MYFLMFFFFPGVLLLSPFLNFRPKRRQVNS-----
NDHL_MICAN      MYFLMSFFFPGMLLLSPFLNFRPQRRTLKA-----
NDHL_SYNP2      MYFFVFFLFPGMLLLSPFLNFRPRRREV-------
NDHL_SYNY3      MYFLVFLFFPGLLVLSPVLNLRPRRQAA-------
NDHL_NOSS1      MYFLVFLFFPGLLVLSPFVNLRPRPRKIEV-----
NDHL_TRIV2      MYFLVFLFFPGLLVLSPFVNLRPRPRKIEV-----
NDHL_NOSP7      MYFLVFFFFPGLLVLSPFANFRPQRRQVQV-----
NDHL_TRIEI      MYFLMFLFFPGMLVLSPFLNFRPRKQQIES-----
NDHL_THEEB      MYFLVTFFFPGLLLLAPFINFRPQPRSLNS-----
NDHL_SYNJB      MFFLVLFFFPGMVLLAPFMTFRPKPRSL-------
NDHL_SYNJA      MFFLVLFFFPGMVLVAPFMTFRPKPRSL-------
                 : :: ::** . ..... . :