CLUSTAL format seed alignment for MF_01356

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NDHK1_CYAP4      --------------MNTLPVK--------------------QSQLINPIAAP--------
NDHK_THEEB       ----------------MTNTT--------------------SPAILNPIARP--------
NDHK1_ACAM1      -------------------MQ--------------------DQQIINPISQS--------
NDHK_CROS5       --------------MSPNPTSDLSAIEQ-----------LQKEKILNPAARG--------
NDHK_MICAN       --------------MSPNPTSEFKQIIE-----------QQSEKILNPIERT--------
NDHK_SYNP2       --------------MVMNPTS----FEQ-----------QQTEKLLNPMGRS--------
NDHK1_SYNY3      --------------MSPNPANP-TDLER-----------VATAKILNPASRS--------
NDHK_GLOC7       --------------MSPNLTSSSDLFTQ-----------EQKEKLLNPINHS--------
NDHK_NOSP7       --------------MVLNSNLT-----T-----------QDKQRIINPIERT--------
NDHK_TRIEI       --------------MVLSPN--------------------QNQKIINPIEESP-------
NDHK_SYNP6       --------------MVLTNP----------------------AEIRNPAAPP--------
NDHK1_GLOVI      -------------------MD--------------------IKNLLNPIERP--------
NDHK2_GLOVI      --------------MFNDRPQ--------------------TDRMFFPPERP--------
NDHK_SYNJA       -----------------MTSQ--------------------EPEVLFPASAP--------
NDHK2_SYNY3      --------------MSTST---------------------HALTLQNPIQAP--------
NDHK2_ACAM1      --------------MKPQS---------------------LEANIINPITPL--------
NDHK2_CYAP4      ---------------MSTP---------------------LDHSIRNPISSA--------
NDHK_PROMA       --------------MNNIPSIE------------------AVKDIRSGTCGPV-------
NDHK_PROM4       -MHGAKVHLNGANPLTDLPSIN------------------AVRDIREATCGPV-------
NDHK_PROMT       ---------MELNPLKKSPSSE------------------AVRNLREASCGPV-------
NDHK_PROMM       -------------MS-VTPSID------------------AVRDLRAASCGPV-------
NDHK_SYNS9       -------------MP-ESPSIS------------------AVRDLREATCGPI-------
NDHK_SYNPW       -------------MAGESPSIQ------------------ALRDLREASCGPVAGAAD--
NDHK_SYNR3       -------------MS--DTSLD------------------SMRDLRAASCGPV-------
NDHK_PAUCH       ----------------MTPSID------------------ALRDFRASTCNLV-------
NDHK_PROMP       --------------MNNSLSPK------------------AIRELREETCNPL-------
NDHK_ANGEV       --------------MVLASNHSNIEIK-------------SDIPLINSMES---------
NDHK_PSINU       ---------------------MNITI--------------------NPMES---------
NDHK_PHYPA       --------------MVLNSNYDNYKNKI---------T-NSMKPLINSVNP---------
NDHK_MARPO       --------------MVLNFKFFTCENSL---------EDNSTTMLKNSIES---------
NDHK_HUPLU       --------------MVLVYKYFSCENEI---------E-NSIKPVINLMES---------
NDHK_ANTAG       --------------MVLVPKYLNFESDL---------A----ESVTNSMDS---------
NDHK_DIOEL       ---------------------------------------------MNLIEF---------
NDHK_LEMMI       ---------------------------------------------MNLIEF---------
NDHK_MAIZE       ---------------------------------------------MSLIEF---------
NDHK_LOTJA       ---------------------------------------------MNSIEF---------
NDHK_FAGEA       ---------------------------------------------MNSVEF---------
NDHK_PELHO       ---------------------------------------------MNSVEF---------
NDHK_PIPCE       ---------------------------------------------MNSMKF---------
NDHK_CYCTA       ---------------------------------------------MGSTES---------
NDHK_CRYJA       ---------------------------------------------MNPIES---------
NDHK_STAPU       --------------MVINSELFRSSNSF---------QEEGFESVTNGLSF---------
NDHK_CHAGL       --------------MVLNANT-QFQNSF---------NEDLFDSIKNPVKT---------
NDHK_ZYGCR       -----------------------------------------MKPISNPMGL---------
NDHK_MESVI       --------------MVIKSVGIES-----DKN-----SDTNERLINYNIEK---------
NDHK_CHLAT       --------------MVINQKNLSSPVAPYDKSGSQSSTKADIPSINYTVDHSFQKRETSG
NDHK_NEPOL       --------------MVISSL-------------------SNSQPLNAPVSS---------
NDHK_CHAVU       --------------MVLVYLNSNLNLRS--------LKETNHDFLINSTER---------
NDHK_ADICA       --------------MVLTSDHLDKKNIR-------KIEYKGEDSFSNSMSK---------
NUOB2_THEYD      -------------------------------------MLPSTND-KQLIEVEE-------
NUOB1_THEYD      -------------------------------------MIHVVDTVTEPVEIEQ-------
NUOB_GEOLS       ----------------------------------------------------M-------
NUOB_DESDA       ------------------------------MGEVVTKSGGAVHTGGQPLEVSKD------
NUOB_CAMC1       ------------------------------------------------MAKHQI------
NUOB_NITSB       ------------------------------------------------MAQHQV------
NUOB_SULNB       ------------------------------------------------MAQHQV------
NUOB_SULDN       ------------------------------------------------MAQHKI------
NUOB_WOLSU       ------------------------------------------------MAQHEV------
NUOB_CAMHC       ------------------------------------------------MAKHKI------
NUOB_HELPJ       ------------------------------------------------------------
NUOB_DECAR       ----------------------------------------------MAIEGV--------
NUOB_VESOH       ----------------------------------------------MAIEGL--------
NUOB_FRAP2       ----------------------------------------------MGIGNE--------
NUOB_XYLFA       ----------------------------------------------MGVIQAIDRLMTNP
NUOB_HALHL       ----------------------------------------------MGVEGI--------
NUOB_BORPD       ----------------------------------------------MAIDGI--------
NUOB_METPP       ----------------------------------------------MGIEGV--------
NUOB_ACIF2       ----------------------------------------------MGIEGI--------
NUOB_NEIG1       ----------------------------------------------MGIEGV--------
NUOB_GRABC       ------------MQSQYPSAHAPTADEAMLWNREALPPGPGQEAVLRGITGEM-------
NUOB1_ACICJ      --------------------MNAVQQPDIAWNRDHLDPGAEQEAVIRGITGEI-------
NUOB2_GLUDA      ---------------MSAANATGEGQDAIAWNREMLPPGPEQDAVIKGITGEI-------
NUOB_RHOCS       ------------MGVIATPPPSVQGPSSQVPSSAPIPPGPVQDAYLQAVQQEMQ------
NUOB_RHORT       ------------MGV-STPVIVPRG-------GAPVPPGPDQDLILGQVAREIE------
NUOB_MAGSA       ------------MNPSAGGILSPDH-------AAALPPGPAQDALLKAVTTEIS------
NUOB_RHOFT       -----------------------------------------------MIEGI--------
NUOB_COXBR       -----------------------------------------------MQQLL--------
NUOB_AGRVS       -----------MGVSQSDHQTLVAPQPKGILDPATGKPVGNDSTFFGEINDELA------
NUOB_OCHA4       -----------MGLTTA-NTTLVAPQPKGILDPRTGKPVGSDDAFFNDLNSELS------
NUOB_RHILO       -----------MGLNDS-SGTLVAPKPKGIIDPNTGRPVGEDDPFFLEINNELA------
NUOB_BARBK       -----------MGLVFN-NSTIVAPQAKGIIDPNTSKLIGANDQFFQDMNAELS------
NUOB_METS4       ----------MALDTPLSRAPAIAPEPKGILDPATGLPIGATDPTFLSINDELA------
NUOB_AZOC5       -------------MTPSATKPLVSEAPKGIIDPSTGRPILSDDPFYKEINAELA------
NUOB2_RHOPS      ------MQQQASAMRPEGAQPLIARAPSGIIDPNTGKPVGADDPFFLGVNRELS------
NUOB_OLICO       -------MGLNPTQVSTSGSPQVSQPATGVLDPRTGQPVGADDRYFLEINHELS------
NUOB_METSB       ------------------MGLTPAPQEGLVINPATDRPLAANDPYFLSINDKLA------
NUOB2_RHIEC      ----------------MPSFTQPHSAPRNFQFPGQQR---QGDPTMGTINAELA------
NUOB_PARL1       --------------MGVTNPDKVISNTPGVVDPATSVPAWQDDAFFRQATDQLA------
NUOB_PELUB       --------------------MNLENKNKEIPEE------------FKKLAEDFS------
NUOB_PHEZH       -----------MEERRPGMGVIVPAGEAGRTTVEG-YDPKLHDPYFDGVSQRLA------
NUOB_CAUSK       --------MIVPPNSAAPSSSLVPAGSAARSTVQG-YDPKLHDPYFDGLSGQLA------
NUOB_MARMM       ----------------MASDLTPHAGMAGRATVPG-YDPKKHDPFFDGVSDALA------
NUOB_HYPNA       ---------------MSDNSYKPYALGAARAGVDGGFKPGNDDPFYSGLSDQLA------
NUOB_SPHWW       ------------------MGVTLDSALNPHKPEGFGEVVAPDPDYFKALQAEVN------
NUOB_SPHAL       ------------------MPGQMPVAPGTN----------PDQSFFDDLSGEVG------
NUOB_ROSDO       ------------------MTVATNVNAAGV----------DREVATQELNRELQ------
NUOB_MAGMM       --------------------------------------------MIEELHQEVS------
NUOB_LEGPC       -------------------------------------------MAVAELEKKV-------
NUOB_ANAMM       ------------------------------------MENQQHQVLEQELWQGYK------
NUOB_ANAPZ       -------------------------------------MGECDQILENDLWQGYK------
NUOB_WOLPM       ---------------------------------------MTNQILSNDDWGRYK------
NUOB_EHRRW       ------------------------------------MINKHNSVLHNQFWQSYN------
NUOB_NEOSM       ---------------------------------------MGNGFSDVNALSNVS------
NUOB2_BURMS      ---------------------------------------MANHPLTLE------------
NUOB2_CHRVO      ----------------------------------------MDSP-SLE------------
NUOB2_AZOSB      ----------------------------------------MQTP-TLH------------
NUOB_RICTY       ----------------------------------MKNDFYQEDELLNSCLT---------
NUOB_ORITI       ---------------------------------MSENTFSDTTSIYNQNLS---------
NUOB_DEHM1       ------MELDSGKPLSLLTLDEIDQHEGGIIQSFRTGHTTPYPDPADWLNSEEP------
NUOB1_SALAI      ----------------------------------------MQVPAVLG------------
NUOB1_SALTO      ----------------------------------------MQVPAVLG------------
NUOB2_STRCO      ---------------------------MNPGEPADPAPVPLPEPKRLGTL----------
NUOB2_STRGG      ----------------MGLTSRPTPASRQPASPPPADPVLLPEPKRLGVL----------
NUOB2_ANADE      -------------------------------------MAARMDPGIGGEV----------
NUOB1_ANADF      -------------------------------------MTARTMDAGTGDV----------
NUOB2_SORC5      ------------------------MTSNLNLMAPPRGWEAKYESDGGGVI----------
NUOB_PELLD       -------------------------------------MGLLDAGFSRDN-----------
NUOB2_CHLT3      -------------------------------------MGLLDQKFDKGG-----------
NUOB1_CYTH3      -------------------------------------MSLLDHKFGQGG-----------
NUOB_AMOA5       -------------------------------------MDTISNKTGEGG-----------
NUOB_RUBXD       -----------------------------------MGLMQKFD------E----------
NUOB_BACCN       ---------------------------------MAINFEELHPQEQAELE----------
NUOB_HYDS0       --------------------------------------------MASSING---------
NUOB_AQUAE       ---------------------------------------------MVAINS---------
NUOB_SULSY       ----------------------------------------------MAMTS---------
NUOB_BACTN       ---MEITKKPKIKSIPYDEFIDNES-----------------LEKLVKELNTG-------
NUOB_BACV8       ---MEV-KKPTIKSIPYEDFKDNEY-----------------LENMVKQLNEG-------
NUOB_AZOPC       --------------MKTEDFRDNEY-----------------LEEYLKELWGN-------
NUOB_CARHZ       --------------MEIKTIQ----------------------SEEEKLIG---------
NUOB_DESRM       --------------MEIKDQDKAANPVAKDEMYEETVKRLKKLGAEPAVIGEV-------
NUOB_CLOB8       --------------MEVNFKQ---------------------DKEIQEQIE---------
NUOB_MOOTA       ----------------MAVTR---------------------LKPADPQIP---------
NUOB_HELMI       --------------MEIDKNVDTLS-----------------EGQVDELIK---------
NUOB_DESHY       --------------MDVAKEKE--------------------LREAEALME---------
NUOB2_CHLAD      --------------MADIDP-----------------------NQLELERQ---------
NUOB1_ROSS1      --------------MSDDRE-----------------------IQLEAEKH---------
NUOB2_HERA2      --------------MSDLQ------------------------TQMDLEQQ---------
NUOB2_SYMTH      --------------MSQARHELDWL------------NDEVVVSEIDVVNENV-------
NUOB_DESVM       --------------MAAQDCPVRPP-------------VIAPATGGVDAP----------
NUOB2_OPITP      --------MESPLTPSAQPAPMPSL-------------VAATGPSTPEIPPEV-------
NUOB_ACIAD       --------------MKYTLTRANPD-----------------ANQYPLQERQV-------
NUOB_PSYWF       --------------MKYTLTRANPD-----------------ADTYPAQTRQT-------
NUOB_PSEMY       --------------MQYKLTRVD--P-------------NAPNEAYPIGQREL-------
NUOB_CHRSD       --------------MQYTLTRADQEP-------------APDGASYPLGRRES-------
NUOB_AERS4       --------------MKYTLTRID--P-------------DAPVERYPQEQSQT-------
NUOB_SODGM       --------------MDYTLTRAEPD--------------GDNER-YPLQKQEI-------
NUOB_BAUCH       --------------MNYTLTRILSN--------------SKENR-KSLQEDDS-------
NUOB_BLOFL       --------------MKYTLTLARTNQ-------------DDDSV-YPEQDQKP-------
NUOB_BLOPB       --------------MKYTLTTARTDN-------------SEDEQ-YPLQEKKI-------
NUOB_BUCAI       --------------MNYTLTKADSD--------------NN-NKKYPKQTIES-------
NUOB_BUCAP       --------------MNYTLTRAER---------------KS-QRHYPNETTQS-------
NUOB_BUCCC       --------------MKYTLTRVNTK--------------NSISKKYPLRSLKK-------
NUOB_BUCBP       --------------MKYTLTRVNIS--------------DD-DQNYPREKKIQ-------
NUOB2_ACICJ      --------------MRFTFGKGATGQQLSTTAPLLRGLGTAGQPAAPSPGGG--------
NUOB1_GLUDA      --------------MRWSLTR-------------------PGEEPG-TPRDA--------
NUOB_METCA       --------------MRWSLTR-------------------ADQTPAPKPGGQ--------
NUOB1_NITMU      --------------MRWSLSK------------------PSDKPSGPATPGSSI------
NUOB1_NITOC      --------------MRWRLSK------------------PQAATSIEQSKGS--------
NUOB_SHEWM       --------------MRWQLSK---------------------PEIIPTSTQT--------
NUOB2_RHOPB      --------------MSYTLQR-------------------------PGEDISV-------
NUOB1_RHOS5      --------------MSWTIGR-------------------------PGAEAP--------
NUOB_METI4       ---------------------------------------------MVQT-----------
NUOB_AKKM8       ---------------------------------------------MVTTNEPNI------
NUOB1_OPITP      ---------------------------------------------MVSSN----------
NUOB1_CHLT3      ---------------------------------------------MSGQ-----------
NUOB_SALRD       ---------------------------------------------MAGS-----------
NUOB1_ANADE      -----------------------------------------MASELDGLP----------
NUOB2_ANADF      -----------------------------------------MASELDNLP----------
NUOB_MYXXD       ------------------------------------------MADADLAN----------
NUOB1_SORC5      ------------------------------------------MGEVKAGG----------
NUOB_PELPD       ------------------------------------------------------------
NUOB_ARCB4       ------------------------------------------------------------
NUOB_CAMFF       ------------------------------------------------------------
NUOB_BDEBA       ----------------------------------MHNEQVQGLVSHDGMT----------
NUOB_FLAPJ       --------------------------------------------MSSNIN----------
NUOB2_CYTH3      ---------------------------------------------MSDIK----------
NUOB_LEPBP       ---------------------------------------------MGLTE----------
NUOB_LEPIN       ---------------------------------------------MGLSD----------
NUOB1_KORVE      MSNYAPADPRASSNRYRYNGTCMTNPSERFDNLVGSDQSFEQLRRATFGEQP--------
NUOB2_SOLUE      -----MEKPMASSG-----------PAELFTRV-------DDYSVANAAAAA--------
NUOB_MYCA9       ---------------------------------------------MGLEEKL--------
NUOB_NOCFA       ---------------------------------------------MGLEEKL--------
NUOB1_STRGG      ---------------------------------------------MGLEEKL--------
NUOB_ACIC1       ---------------------------------------------MGIEEKI--------
NUOB_NOCSJ       ---------------------------------------------MGIEEKL--------
NUOB_THEFY       ---------------------------------------------MGLEEKL--------
NUOB2_SALTO      ---------------------------------------------MGIEEKL--------
NUOB_FRASN       ---------------------------------------------MGLEEKL--------
NUOB_SACEN       ---------------------------------------------MGLEEKL--------
NUOB_CUTAK       --------------------------------------------MAEYDADV--------
NUOB1_SYMTH      ---------------------------------------------MSADGVFR-------
NUOB1_CHLAD      ---------------------------------------------MGIEEKA--------
NUOB2_ROSS1      ---------------------------------------------MGIEQKA--------
NUOB1_HERA2      ---------------------------------------------MGLEEKA--------
NUOB_PARUW       ---------------------------------------------MGMNHQQ--------
NUOB_DEIRA       ---------------------------------------MPLKELIDRDWQEL-------
NQO6_THET8       ---------------------------------------MALKDLFERDVQEL-------
NUOB2_KORVE      ---------------------------------------------MSWIENKF-------
NUOB1_SOLUE      --------------------------------------------MSSFIQNQF-------
NUOB_THERP       ---------------------------------------------MGMSAAQS-------
NUOB2_RHIME      ---------------------------------------------MAGVNDAI-------
                                                                             

NDHK1_CYAP4      -------------EVPQELQENIILTSLNDVY----SWCRLSSLWPLMYGTACCFIE-FA
NDHK_THEEB       -------------EVPQELAENIILTSLNDVY----DWARLSSLWPLMYGTACCFIE-FA
NDHK1_ACAM1      -------------QIPQELSENVILSSVSDLY----DWARLSSLWPLMYGTACCFIE-IA
NDHK_CROS5       -------------QVTQDLSENIILTTVDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_MICAN       -------------KVTQDLSENVILTTVDDLY----NWARLSSLWPMLYGTACCFIE-FA
NDHK_SYNP2       -------------QVTQDLSENVILTTVDDLY----NWARLSSLWPLLYGTACCFIE-FA
NDHK1_SYNY3      -------------QVTQDLSENVILTTVDDLY----NWAKLSSLWPLLYGTACCFIE-FA
NDHK_GLOC7       -------------QVTQDLSENVILTTVDDLY----NWARLSSLWPLLYGTACCFIE-FA
NDHK_NOSP7       -------------NVTQDLSENVILTTVDDLY----DWARLSSLWPLLFGTACCFIE-FA
NDHK_TRIEI       -------------TVTQELSENIVLTTVDDLY----NWAKLSSLWPLLYGTACCFIE-FA
NDHK_SYNP6       -------------EITQGLSENVILTTLDDLY----NWARLSSLWPLMYGTACCFIE-FA
NDHK1_GLOVI      -------------EVTSELTNNVVLTTLNDLY----NWARLSSVWPLMYGTSCCFIE-FA
NDHK2_GLOVI      -------------EVTSELSNNVVLTTLNDLY----NWARLSSVWPLMYGTACCFIE-FA
NDHK_SYNJA       -------------QVTTDLSNNVVLTTVNDLY----NWAKMSSLWPLLYGTACCFIE-FA
NDHK2_SYNY3      -------------QVTKELSENVILTCLDDIY----NWARLSTLYPMMFGTACCFME-FM
NDHK2_ACAM1      -------------EVTQELSDNVILTALDDLY----DWVKMSSLYPFMFGTACCFME-FM
NDHK2_CYAP4      -------------EVPPELSENIILTSLDDIY----NWARISSIYPLMYGTACCFIE-FA
NDHK_PROMA       ----------AAPAVTSDLSENIILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_PROM4       ----------GAPNVTNELSENIILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_PROMT       ----------GTPTVTNDLSENIILTSLEDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_PROMM       ----------GAPSVTSDLSENIILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_SYNS9       ----------GTPEVTNELSENIILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_SYNPW       ----------GAPTVTQDLSENVILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_SYNR3       ----------GSPEVTTDLSENVILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_PAUCH       ----------GTPTVTNDLSENIILTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_PROMP       ----------GAPQVTTDLSENIIMTSLDDLH----NWARLSSLWPLLYGTACCFIE-FA
NDHK_ANGEV       ------------YSLDKNMSNSIISTNLNDFS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_PSINU       ------------LVSKPNTSNSIILTNLNDFS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_PHYPA       ------------AFSNQENPNSVILTTFNDFT----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_MARPO       ------------SFINKTLTNSIILTTFNDFS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_HUPLU       ------------SLLDKTTSNSIVLTTFNDFS----NWARLSSLWPLLYGTSCCFIE-SA
NDHK_ANTAG       ------------SLPDETTSDSIILTTFNDFS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_DIOEL       ------------TLLDQTTPNSVISTTSNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_LEMMI       ------------PSLDQTMPNSVISTTLNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_MAIZE       ------------PLLDQTSSNSVISTTLNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_LOTJA       ------------PLIDRTTQNSVISTTLNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_FAGEA       ------------LPLDRITPNSVISTTSNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_PELHO       ------------PLLDRRTKNSVISTTSNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_PIPCE       ------------PLLDRTTQSSVISTTLNDLS----NWSRLSSLWPLLYGTSCCFIE-FA
NDHK_CYCTA       ------------PLLGQTTPNSVISTTLNDLS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_CRYJA       ------------SLLDQTTSNSVISTTLNDLS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_STAPU       ------------SITEENISDSVILTTFHDFT----NWIRLSSLWPLLYGTSCCFIE-FA
NDHK_CHAGL       ------------SSDKEELSNSIILTTLNDFS----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_ZYGCR       ------------SPTKQNVYDSVVLTTLQDVS----NWVRLSSLWPLLYGTSCCFIE-FA
NDHK_MESVI       ------------PQVTQNVSNQLILTTLNDLY----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_CHLAT       K-----ELSEATPQVTQSLSNQLILTTLNDLY----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_NEPOL       ------------SPITQELANNLILTTLNDLY----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_CHAVU       ------------LTTNQILSTSVILTTMNDLT----NWARLSSLWPLLYGTSCCFIE-FA
NDHK_ADICA       ------------LPLQGGMSDSIFMASISDFS----NWSRLSSLWPLLYGTSCCFIE-FA
NUOB2_THEYD      -------------GTKIIKGSNVIITTLDKVV----NWGRSNSLWPLTFGLACCAIE-MM
NUOB1_THEYD      -------------GIKIVPAANTIITTLDKIA----SWGRCSSLWPLTFGLACCAIE-MM
NUOB_GEOLS       -------------GVNQPLGGNVTVTSLDKLV----NWVRKSSIWPMTFGLACCAIE-MM
NUOB_DESDA       -------------GLRFFPGAGAVIGPLNALV----NWGRAGSIWPVTFGLACCAIE-MM
NUOB_CAMC1       -------------NYAANGGLPVVLTTVDKLV----QWGRSNSLWALSYGLACCAIE-MM
NUOB_NITSB       -------------NYASNAGLPVALTTVDKLV----NWGRTNSLWVLTYGLACCAIE-MM
NUOB_SULNB       -------------NYASAAGLPIALTSVDKLV----NWGRSNSLWPLTYGLACCAIE-MM
NUOB_SULDN       -------------NYTQNGGLPVALTSIDKIV----NWGRSNSLWAMTYGLACCGIE-MM
NUOB_WOLSU       -------------NYLKSGGLPVVLTTVDHLV----NWGRSNSLWALTYGLACCAIE-MM
NUOB_CAMHC       -------------DYTRENGLPVVLTTIDKLV----NWGRSNSLWAMNYGLACCAIE-MM
NUOB_HELPJ       -----------------MQQAPVILSTLDKLL----NWGRSNSLWPLTYGLACCAIE-MM
NUOB_DECAR       ------------------LQEGFVTTTADKLI----NYMRTGSLWPMTFGLACCAVE-MI
NUOB_VESOH       ------------------IKQGFVTMSLDRVI----NWARTGSLWPMTFGLACCAVE-MM
NUOB_FRAP2       -------------------NKGFITASADALI----NWVRTGSLWPVTTGLACCAVE-MM
NUOB_XYLFA       IPDGQVDDILRPQGESPLLQKGYVTTSVDALL----NWARTGSMWPMTFGLACCAVE-MM
NUOB_HALHL       ------------------LERGYVTTSADKLI----NWARTGSLWPMTFGLACCAVE-MM
NUOB_BORPD       ------------------LKQGFITTSADKFL----NWAKTGSMWPMTFGLACCAVE-MM
NUOB_METPP       ------------------LKEGFITTSADKLI----NWSKTGSLWPMTFGLACCAVE-MM
NUOB_ACIF2       ------------------LEKGFVTTSIDTVV----NWSRTGSLWPMTFGLACCAVE-MM
NUOB_NEIG1       ------------------LKKGFITTSADTVL----NHMRTGSLWPVTFGLACCAVE-MM
NUOB_GRABC       ------------------ADKGFVVANLDKLV----NWARTGSLWPMTFGLACCAVE-MI
NUOB1_ACICJ      ------------------AGKGFVVANLDRLV----NWARTGSLWPMTFGLACCAVE-MI
NUOB2_GLUDA      ------------------TEKGFVVASLDKLV----NWGRTGSLWPMSFGLACCAVE-MI
NUOB_RHOCS       -------------------DKGYLVARFDALM----DWARTGSLWPMTFGLACCAVE-MI
NUOB_RHORT       -------------------EKGFVLSNVDSLV----NWARAGSLWPMTFGLACCALE-MI
NUOB_MAGSA       -------------------DKGFVLASVDAVV----NWARTGSLWPMTFGLACCAVE-MM
NUOB_RHOFT       ------------------LKEGFITTSYDSVM----NWAKTGSLWPMSFGLACCAVE-MM
NUOB_COXBR       ------------------TKEGFLLTSLDDLM----RWARSGSLWPMTFGLACCAVE-MM
NUOB_AGRVS       -------------------DKGFLVTSTQALI----TWARTGSLMWMQFGLACCAVEGLM
NUOB_OCHA4       -------------------DKGFIVTSADALI----TWARTGSLMWMTFGLACCAVE-MM
NUOB_RHILO       -------------------DKGFLVTSTEALI----TWARSGSLMFMTFGLACCAVE-MI
NUOB_BARBK       -------------------DKGFLVTSVDSLI----TWARTGSLMWMSFGLACCAVE-MM
NUOB_METS4       -------------------DRGFLLTTADDLI----TWARTGSLMWMTFGLACCAVE-MM
NUOB_AZOC5       -------------------DKGFLVTTVDDLI----TWARTGSLMWMTFGLACCAVE-MM
NUOB2_RHOPS      -------------------DKGFFVAATDDLI----TWARTGSLMWMTFGLACCAVE-MM
NUOB_OLICO       -------------------DKGFFVAAADDLI----TWARTGSLMWMTFGLACCAVE-MM
NUOB_METSB       -------------------DKGFLVTSTDELI----NWARTGSLMWMTFGLACCAVE-MM
NUOB2_RHIEC      -------------------DKGFLVTSTDELI----TWARTGSLMWMTFGLACCAIE-MM
NUOB_PARL1       -------------------DKGFVLTTVDDLI----NWSRTGSLMWMTFGLACCAVE-MM
NUOB_PELUB       -------------------KNGFITTSLDNLI----NWSRAGSLHWMTFGLACCAVE-MM
NUOB_PHEZH       -------------------DKGFVTAAADDLI----TWARTGSLMWMTFGLACCAVE-MM
NUOB_CAUSK       -------------------DKGFVTAAADDLI----TWARTGSLMWMTFGLACCAVE-MM
NUOB_MARMM       -------------------DKGFVVAAADDLV----TWARTGSLMWMTFGLACCAVE-MM
NUOB_HYPNA       -------------------DKGYFTAAADDLI----SWARTGSLMWMTFGLACCAVE-MM
NUOB_SPHWW       -------------------DKGFLVTSAEELF----QWARTGSLWWMTFGLACCAVE-MI
NUOB_SPHAL       -------------------DKGFLVTSTEDLF----NWARTGSLWWMTFGLACCAVE-MI
NUOB_ROSDO       -------------------DKGFLLTSTEDII----NWARTGSLHWMTFGLACCAVE-MM
NUOB_MAGMM       -------------------DRGFLLTSADKLV----NWGRSMSMWPMTFGLACCAVE-MM
NUOB_LEGPC       ----------------------FELTTVEKLV----GWARSGSMWPMTFGLACCAVE-MM
NUOB_ANAMM       -------------------DRGFVVTKFSDLVDSVVRWSRSGSLWPMTFGLACCAVE-MM
NUOB_ANAPZ       -------------------DQGFVVTQFSDLIERVLKWARSGSLWPMTFGLACCAVE-MM
NUOB_WOLPM       -------------------KEGFLVTKFGDLTDYVMNWARSGSLWPMTFGLACCAVE-MM
NUOB_EHRRW       -------------------HRGFMVTKLSDLMSYVSSWARSNSLWPMTFGLACCAVE-MM
NUOB_NEOSM       -------------------SDGYLVAKLDDLI----NWARSGSLWPMTFGLACCAVE-MM
NUOB2_BURMS      -------------------KDGFIVTTLDAAM----AAAQKNSLWYMTFGLACCAVE-MM
NUOB2_CHRVO      -------------------KDGFLLTTLDGLF----GRAQSGSLWYLSFGLACCAVE-MM
NUOB2_AZOSB      -------------------GDGFLLTRLDTLC----DMVRSNSMWYLTFGLACCAVE-MM
NUOB_RICTY       -------------------NRGFLLSKIDEVI----SWARANSLWPMTFGLACCAVE-MM
NUOB_ORITI       -------------------NQGFILANLENLV----SWARTRSLWPMTFGLACCAIE-MM
NUOB_DEHM1       -------------------PPGVFVTSVEKVL----NWSRHYSLWPVMFGLACCAIE-MM
NUOB1_SALAI      -------------------------EPIRFVL----NWGRRYSLWVFNFGLACCAIE-FI
NUOB1_SALTO      -------------------------EPIRFVL----NWGRRYSLWVFNFGLACCAIE-FI
NUOB2_STRCO      --------------------ARLAPEPMKVVL----NWGRRYSLWVFNFGLACCAIE-FI
NUOB2_STRGG      --------------------SRLAPEPMKVVL----NWGRRYSLWVFNFGLACCAIE-FI
NUOB2_ANADE      --------------------TLLHTSQLDNLI----NLARASSLYYLTFGLACCGIE-LM
NUOB1_ANADF      --------------------TLFHTSQLDKLI----NMARENSLWYLLFGLACCGIE-LM
NUOB2_SORC5      --------------------TTSVDQTVNWLL----NWGRSNSVWYMLFGLACCAIE-LM
NUOB_PELLD       ----------------------VLVAPVDAVL----NWARLSSLWPMGFGLACCAIE-MM
NUOB2_CHLT3      ----------------------VVITAAENVL----NWARLSSLWPMGFGLACCAIE-MM
NUOB1_CYTH3      ----------------------IVVSQLEDVL----NWARLSSLFPMSFGLACCAIE-MM
NUOB_AMOA5       ----------------------VIMVALEDLL----NWAERSSLWPITFGLACCAIE-MM
NUOB_RUBXD       --------------------PNIITTSTDKLF----NWARKNSLWPLQFGLACCAIE-MM
NUOB_BACCN       --------------------RNIFFTTLEQIK----GWARSNSLWPMTFGLACCAIE-MM
NUOB_HYDS0       --------------------NGFITTTVDELL----SWGRRNALWPVTIGLACCAIE-MM
NUOB_AQUAE       --------------------NGFVTTTVEELL----RWGRRNSLWPVTIGLACCAIE-MM
NUOB_SULSY       --------------------SGIILTTVEEVL----SWGRRNSLWPVSVGLACCAIE-MM
NUOB_BACTN       -------------------GANVFLGVLDDL----VNWGRSNSLWPLTFATSCCGIE-FM
NUOB_BACV8       -------------------GTKVLVGCLDDL----INWGRSNSLWPLTFATSCCGIE-FM
NUOB_AZOPC       -------------------GANIAIAKLNDL----INWGRSNSVWPLTFATSCCGIE-FM
NUOB_CARHZ       --------------------KNVFLTTLDAV----FNWARGNSLWPLTFGLACCAIE-VM
NUOB_DESRM       -------------------ARTVSVGPLEKL----LNLARANSLWPMGFGLACCAIEGLM
NUOB_CLOB8       --------------------KNIILTKLDDT----LNYFRAHSFWPLTFGLACCAIE-MM
NUOB_MOOTA       --------------------DNIILSTVDAM----LNYCRAHSFWPVTFGLACCAIE-MM
NUOB_HELMI       --------------------KNIIMTSLEAV----FNWARGNSLWPLSSGLACCAIE-MM
NUOB_DESHY       --------------------KNVLLTSIDKV----LNWGRGHSFWPVTFGLACCAIE-MM
NUOB2_CHLAD      ---------------------GILLTTVNRF----YNWGRRSSIWPMAFGLACCAIE-MM
NUOB1_ROSS1      ---------------------GVFLTTMQRF----YNWGRRSSIWPLSFGLACCAIE-MM
NUOB2_HERA2      ---------------------GVLFTTINKL----YNWGRRSSVWPMQFGLACCAIE-MI
NUOB2_SYMTH      -------------------IAGKLPDVIKKV----LGWGYGNSTWPLGFGIACCAIE-MM
NUOB_DESVM       ---------------------IVNVAPVQKI----LDVCRAMSLWPMTFGLACCAIE-MM
NUOB2_OPITP      -------------------SQIARFAKLDDL----LALGRANSLWPLTFGLACCAIE-MM
NUOB_ACIAD       ---------VNDPL-QEEVNKNVFMTRLEDVLHNVVNWGRKNSVWPFNFGTSCCYVEYAT
NUOB_PSYWF       ---------VNNPI-EDEVNRNVFMGKLEDMVHASANWGRKNSLWPFNFGTSCCYVEYAT
NUOB_PSEMY       ---------VSDPLLEDQVHKNIYMGKLEEVLNGAINWGRKNSLWPYNFGLSCCYVEMTT
NUOB_CHRSD       ---------TSDPM-QEQVHRNVFTGKLEDVLNSTVNWGRKHSLWPYNFGLSCCYVEMTT
NUOB_AERS4       ---------VDDPL-AQDATRGIMMGRLEEVLQDTVNWGRKNSLWPYNFGISCCYVEMCT
NUOB_SODGM       ---------VADPL-EQHVHRSVYLGKLERALHNAVNWGRGNSLWPYNFGLSCCYVEMTT
NUOB_BAUCH       ---------ATLLI-EQHVNSNIYLGKLKHILKSIVKWGRGNSLWPYNFGLSCCYVEMTT
NUOB_BLOFL       ---------VADPL-DKQIEKNVYFGKLKNLLHKAVNWGRSNSLWPYNFGLSCCYVEMTT
NUOB_BLOPB       ---------VTDPL-EKNIQRNVFFGKLSAFLHKIVNWGRGNSLWPYNFGLSCCYVEMTT
NUOB_BUCAI       ---------VSDPL-EEYLKKNIFMGKITQLLHKLVNWGRKNSLWPYNFGLSCCYVEMVS
NUOB_BUCAP       ---------TIDPI-EGYLKKNILMGKVTKLLHKIVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_BUCCC       ---------TSDPI-KKQIKNNIFFGTISKYMQYIMNWGRKNSLWPYNFGLSCCYVEMVS
NUOB_BUCBP       ---------VSDPT-KKYIQKNVFMGTLSKVLHNLVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB2_ACICJ      -------------TFTDAVRRNVALGRLEDM----VAWGRKYSIWPFNFGLSCCYVEMAT
NUOB1_GLUDA      -------------TMTETVKRNLVMGRLQDF----VSWGQKNSIWPFNFGLSCCYVEMAT
NUOB_METCA       -------------TYEEALRRNILFARLDDL----VRWGRKNSIWPFNFGLSCCYVEMAT
NUOB1_NITMU      ---------IRDNGFEEDGRRSVLLTRLQDL----VAWGRKNSVWPYNFGLSCCYVEMAT
NUOB1_NITOC      --------------FEDAIRRNLLFAQLQDL----VAWGRKNSLWPYNFGLSCCYVEMVT
NUOB_SHEWM       --------------MQEVVEKNLLVTRLEDL----VAWGRSNSLWPFNFGLSCCYVEMAT
NUOB2_RHOPB      ---------------EEHMARTSLFARLEDL----VAWSRKNSLWPFNFGLSCCYVEQVT
NUOB1_RHOS5      ---------------EDRMAASHLFTRLDDL----VAWSRKHSLWPFNFGLSCCYVEMAT
NUOB_METI4       ----------KTLTYNSPIEGDVVVTRLDAA----INWMRKNSLWPMPMGLACCAIELMA
NUOB_AKKM8       ---------YETGVLDSNAEGNFVYTTLDAA----INWIRKNSLWPMPMGLSCCAIEFMA
NUOB1_OPITP      ----------TDLTYSSAIEGGIVVSKADAV----INWIRTNSMWPMPMGLACCAIELMQ
NUOB1_CHLT3      ---------------QGM-GDGFLTTTLDAI----TNWGRANSIWPMPMGLSCCAIEMMA
NUOB_SALRD       ---------------SGTNGQGFFTTRVDTF----LNWARSNSLMPMPMGLACCAIEMMG
NUOB1_ANADE      ----------VIATRREEA-EGFLQGLVSKS----LGWARKYSLFTYPFVTACCGMEYMT
NUOB2_ANADF      ----------VITTRREEA-QGFLQGLVSKG----LGWARKYSLFQYPFVTACCGMEFMT
NUOB_MYXXD       ----------IVTTRRDES-MGWLQSIVSKG----LGWARKYSLFTYPYATACCGMEYMS
NUOB1_SORC5      ----------PSTRVMEGSEHGFATTRVDAL----LNWAKKYSLFQYPFVTACCGMEYMA
NUOB_PELPD       -----------------MAMMEYLTTRKDEL----IGWVRKFSIFPYPFVTACCGMEFMA
NUOB_ARCB4       ----------MGLGVESKLGDSIVTTRLDHA----VNWGRSYSLWPMAFGTACCGIEFMA
NUOB_CAMFF       ------------MGIENLVQNDVVLTRLDAL----FNWGRKNSLWPMIFGTACCAIEFMS
NUOB_BDEBA       ----------GTQAVDDMSRGFAFTSKLDAI----VAWGRKNSLWPMPYGTACCGIEFMS
NUOB_FLAPJ       ----------IVEAPEGVTGEGFFATKLNDV----VGLARANSMWPLPFATSCCGIEFMA
NUOB2_CYTH3      ----------IEEKPDGLEGPGFFATSLDSV----IGLARKNSLWPLPFATSCCGIEFMA
NUOB_LEPBP       ----------TLSKPGEMFGDMFQVATLDNV----VQWGQSFSLWPYPFATACCGIEYMS
NUOB_LEPIN       ----------LSKTPGQALGDMVQLGNVESV----IQWGRSYSLWPYPFATACCGIEYMS
NUOB1_KORVE      -------------------EEGIVLTTLDNA----VNWIRKNSIWPMTFGLACCAIEMMS
NUOB2_SOLUE      -------------------NEGIVMTTLDAA----VNWARKNSIWPMTFGLACCAIEMMS
NUOB_MYCA9       -------------------PSGFLLSTVETL----AGYVRKGSLWPATFGLACCAIEMMS
NUOB_NOCFA       -------------------PSGFLLSTVESF----AGYLRKGSVWPATFGLACCAIEMMA
NUOB1_STRGG      -------------------PSGFVLTTVEQA----AGWVRKSSVFPATFGLACCAIEMMT
NUOB_ACIC1       -------------------PGGFLLTTVEKA----VGWVRKSSLWPATFGLACCAIEMMA
NUOB_NOCSJ       -------------------PSGVLLSTVEGL----AGYMRKASFWPASFGLACCAIEMMT
NUOB_THEFY       -------------------PSGVLLTTVEQI----VGFVRKTSMWPATFGLACCAIEMMA
NUOB2_SALTO      -------------------PAGVLLTSVEKF----VNWSRKSSVWGATFGLACCAIEMMA
NUOB_FRASN       -------------------PGGVLLTTVEKL----ANWSRRSSLWPATFGLACCAIEMMS
NUOB_SACEN       -------------------PNGILLANVEKL----VNWTRKTSVWPAAFGLACCAIEMMT
NUOB_CUTAK       -------------------PAGIVMTSMEAI----VGWLRKTSFWPLTMGLACCAIEMIS
NUOB1_SYMTH      ------------------DQGGFVTTTVDSF----LRWAQSNSIWPLTFGLACCAIEMMN
NUOB1_CHLAD      ------------------GNLGIVTTTLETV----VNWGRTNAMWPLLFGLACCAIEMMG
NUOB2_ROSS1      ------------------GDMGIVTASLEQL----VNWSRSSAMWPLLFGLACCAIEMMG
NUOB1_HERA2      ------------------GDLGIVTTTLEGV----VNWGRTKAMWPMLFGLACCAIEMMA
NUOB_PARUW       ------------------EKTPFLIAPLEKL----VNWARSNSLWPAQFGLACCAIEMMS
NUOB_DEIRA       ------------------ESEGVLFSSLEKL----VAWGRSNSLWPATFGLACCAIEMMS
NQO6_THET8       ------------------EREGILFTTLEKL----VAWGRSNSLWPATFGLACCAIEMMA
NUOB2_KORVE      -------------------EKNFLLSSVDYV----FNWARKSSVWPMTFGLACCAIEMIT
NUOB1_SOLUE      -------------------EQNFITTNVDHV----FNWARKSALWPLTFGLACCAIEMIA
NUOB_THERP       -------------------HPNIITTTADWL----FSWARRSSLWWLQFGLACCAIEMIS
NUOB2_RHIME      -------------------RDSVLFTTADSI----ISWSRRSALWPETFGIACCAIEMIS
                                                           :        :** :*   

NDHK1_CYAP4      AMIGSRFDFDRFG-LVPRCSPRQADLLITAGTITMKMAPALVKLYEQMPEPKYVIAMGAC
NDHK_THEEB       AMIGSRFDFDRFG-LVPRNSPRQADLIITSGTITMKMAPALVRLYEQMPSPKYVIAMGAC
NDHK1_ACAM1      AMIGSRFDFDRFG-LVPRSSPRQADLIITAGTVTMKMAPALVRLYEQMPDPKYVIAMGAC
NDHK_CROS5       ALIGSRFDFDRFG-LVPRSSPRQADLIITAGTITMKMAPALVRLYEEMPDPKYVIAMGAC
NDHK_MICAN       ALIGSRFDFDRFG-LVPRSSPRQADLIITAGTITMKMAPALVRLYEEMPEPKYVIAMGAC
NDHK_SYNP2       ALLGSRFDFDRFG-LVPRSSPRQADLILVAGTVTMKMAPALVRLYEEMPEPKYVIAMGAC
NDHK1_SYNY3      ALIGSRFDFDRFG-LVPRSSPRQADLIITAGTITMKMAPALVRLYEEMPEPKYVIAMGAC
NDHK_GLOC7       ALIGSRFDFDRFG-LVPRSSPRQADLIITAGTITMKMAPALVRLYEQMPDPKYVIAMGAC
NDHK_NOSP7       ALIGSRFDFDRFG-LIPRSSPRQADLIITAGTITMKMAPQLVRLYEQMPEPKYVIAMGAC
NDHK_TRIEI       ALIGSRFDFDRFG-LVPRSSPRQADLLITAGTITMKYTPTLVRLYEQMPEPKYVIAMGAC
NDHK_SYNP6       ALIGSRFDFDRFG-LVPRCSPRQADLLITAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK1_GLOVI      GLIGSRFDFDRFG-LVPRASPRQADLIITAGTVTMKMAPALVTLYEQMPEPKYVIAMGAC
NDHK2_GLOVI      GLIGSRFDFDRFG-LVPRASPRQADLIITAGTITMKFAPALVTLYQQMPEPKYVIAMGAC
NDHK_SYNJA       AMLGSRFDFDRFG-LLPRSSPRTADLIITAGTVTMKMAPALVKLYQQMAEPKYVIAMGAC
NDHK2_SYNY3      AAFGPRFDLERFG-SIPRATPRQADLMITAGTITMKYAPALVQLYEQIPEPKYVIAMGAC
NDHK2_ACAM1      GAYASRFDMERFG-MIPRATPRQADLLITAGTITMKYAPALVRLYEQMPEPKYVMAMGAC
NDHK2_CYAP4      AMIASRFDMERFG-MFPRASPRQADLIILAGTLTMQMAVPTRRLYDQMPEPKYVIAMGAC
NDHK_PROMA       ALIGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPDPKYVIAMGAC
NDHK_PROM4       ALIGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPDPKYVIAMGAC
NDHK_PROMT       ALIGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPDPKYVIAMGAC
NDHK_PROMM       ALIGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK_SYNS9       ALLGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK_SYNPW       ALLGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK_SYNR3       ALIGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK_PAUCH       ALIGSRFDFDRFG-LVPRSSPRQADLIIVAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK_PROMP       ALIGSRFDFDRFG-LVPRSSPRQADLLIVAGTVTMKMAPALVRLYEQMPEPKYVIAMGAC
NDHK_ANGEV       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_PSINU       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLIRLYEQMPEPKYVIAMGAC
NDHK_PHYPA       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_MARPO       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_HUPLU       SLIGSRSDSDRYG-LVPRSSPRQADLVITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_ANTAG       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_DIOEL       SLIGSRFDFDRYG-LVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMAEPKYVIAMGAC
NDHK_LEMMI       ALIGSRFDFDRYG-LVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_MAIZE       SLIGSRFDFDRYG-LVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_LOTJA       SLIGSRFDFDRYG-LVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_FAGEA       SLIGSRFDFDRYG-LVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_PELHO       SLIGSRFDFDRYG-LVPRSSPRQADLVLTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_PIPCE       SLIGSRFDFDRYG-LVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_CYCTA       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPGPKYVIAMGAC
NDHK_CRYJA       SLIGSRFDFDRYG-LVPRSSPRQADLLITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_STAPU       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_CHAGL       ALIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_ZYGCR       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_MESVI       CLLGSRFDFDRFG-LVPRCSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_CHLAT       SLLGSRFDFDRFG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPEPKYVIAMGAC
NDHK_NEPOL       CLIGSRFDFDRFG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMPDPKYVIAMGAC
NDHK_CHAVU       SLIGSRFDFDRYG-LVPRSSPRQADLIITAGTVTMKMAPSLVRLYEQMAEPKYVIAMGAC
NDHK_ADICA       SLIGSRFDFDRYG-LVPRSSPRQADLIVTAGTITMKMAPSLIRLYEQMPEPKYVIAMGAC
NUOB2_THEYD      AAGASHLDLDRFG-ILFRASPRQADVIIIAGTVTYKMAPIVKRVYDQMPEPKYVIAMGSC
NUOB1_THEYD      ATAASHYDLDRFG-IIMRATPRQADVMIIAGTVTKKMAPVIVNLYHQMPEPRYVIAMGSC
NUOB_GEOLS       ATGASHNDLDRFG-IIFRASPRQADCIIIAGTVTKKMLPVIQTVYEQMPEPKWVIAMGAC
NUOB_DESDA       ATGAAHHDLDRFG-IIFRASPRQADCMVVAGTLSKKMAPVLRRVYDQMPEPRYVLAMGSC
NUOB_CAMC1       ASGASRYDFDRFG-TIFRASPRHSEVMIIAGTLTKKHAEFTRRLYDQMPEPKWVISMGSC
NUOB_NITSB       ASGASRYDFDRFG-VIFRASPRQSDVMIVAGTLTKKHAEFIRRLYDQMAEPKWVISMGSC
NUOB_SULNB       ASGASRYDFDRMG-TIFRASPRQADVMILAGTLSKKHSEFARRLYDQMTEPKWVISMGSC
NUOB_SULDN       ASGASRYDFDRFG-TIFRASPRQSDVMIVAGTLTKKHAEFIKRLYDQMTEPKWVISMGSC
NUOB_WOLSU       ASGAGRYDFDRFG-TIFRASPRQADVMIVAGTLTKKHAEFIRRLYDQMSEPKWVISMGSC
NUOB_CAMHC       ATGASRYDFDRFG-TIFRASAKQSEVMVIAGTLSKKHAELARRLYDAMPEPKWVISMGSC
NUOB_HELPJ       ATGGSRFDFDRFG-TIFRASPRQSDVMIIAGTLTKKHAEFMRRLYDQMPEPKWVISMGSC
NUOB_DECAR       HAGVSRYDLDRFG-VVFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMAEPRWVISMGSC
NUOB_VESOH       EAGSSRYDLDRFG-IVFRPTPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPKWVISMGSC
NUOB_FRAP2       HAGAARYDLDRFG-IVFRPSPRQSDVLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSC
NUOB_XYLFA       HAGAARLDLDRYG-IVFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSC
NUOB_HALHL       HTAAGRYDMDRNG-LIFRPSPRQSDVMIVAGTLCNKMAPALRKVYDQMPEPKWVISMGSC
NUOB_BORPD       HAGAARYDLDQFG-IIFRPSPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRWVVSMGSC
NUOB_METPP       HAGAARYDIDRFG-MLFRPSPRQSDLMIVAGTLCNKMAPALRRVYDQMAEPRWVLSMGSC
NUOB_ACIF2       HAGAARYDLDRFG-LLFRPSPRQSDLMIVAGTLVNKMAPALRKVYDQMPEPRWVVSMGSC
NUOB_NEIG1       HAGMARYDLDRFG-IIFRPSPRQADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSC
NUOB_GRABC       HAYMPRYDLDRFG-VIPRASPRQSDVMIVAGTLTNKMAPALRRVYDQMPEPRWVISMGSC
NUOB1_ACICJ      HAYMPRWDLDRFG-IIPRNSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSC
NUOB2_GLUDA      HAYMPRYDLDRMG-IIPRGSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSC
NUOB_RHOCS       HAYMARYDLDRFG-VIPRPSPRQSDVMIVAGTVCNKMAPALRKVYDQMAEPRWVISMGSC
NUOB_RHORT       HCACARYDLDRFG-TVFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMAEPRWVISMGSC
NUOB_MAGSA       HAGCSRYDMDRFG-VVFRPSPRQSDLMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSC
NUOB_RHOFT       HAANARYDISRFGAEVFRASPRQSDLIIVAGTLCNKMAPAFRKVYDQMSEPRRVISMGSC
NUOB_COXBR       QCASSRYDLDRFGAGLFRPSPRQSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSC
NUOB_AGRVS       QASGPRYDMERFG-VAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_OCHA4       HISMPRYDAERFG-IAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_RHILO       HTSMPRYDSERFG-VAPRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_BARBK       QCSMPHYDNERFG-YAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_METS4       QMSMPRYDAERFG-FAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_AZOC5       QVSMPRYDVERFG-FAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB2_RHOPS      QLSMPRYDAERFG-FAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_OLICO       QVSMPRYDVERFG-FAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_METSB       QASMPRYDVERFG-FAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB2_RHIEC      QMSMPRYDIERFG-VAPRASPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_PARL1       QTSMPRYDAERFG-VAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_PELUB       QTAMPRYDLERFG-AAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_PHEZH       QASMPRYDLERYG-FAPRASPRQSDVMIVAGTLVNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_CAUSK       HSAMPRYDLERYG-FAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_MARMM       QASMPRYDVERFG-FAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_HYPNA       HAGNPRYDLERFG-MAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_SPHWW       HVNMPRYDLERFG-AAPRASPRQSDVMIVAGTLCNKMAPALRRVYDQMSEPKYVISMGSC
NUOB_SPHAL       HVNMPRYDMERFG-VAPRASPRQSDVMIVAGTLCNKMAPALRRVYDQMSNPKYVISMGSC
NUOB_ROSDO       HTAMPRYDMERFG-TAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_MAGMM       NAGASRYDLDRFG-VVFRGSPRQSDVIIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC
NUOB_LEGPC       HVGAARYDLDRFG-IIFRPSPRQSDVMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSC
NUOB_ANAMM       HTAASRYDLDRYG-VMFRASPRQADVMIVAGTLTNKMAPALRRVYDQMAEPKYVISMGSC
NUOB_ANAPZ       HTAASRYDLDRYG-IMFRASPRQADVMIVAGTLTNKMAPALRRVYDQMADPKYVISMGSC
NUOB_WOLPM       HTASSRYDLDRYG-IMFRASPRQSDVMIVAGTLTNKMAAALRKVYDQMADPKYVISMGSC
NUOB_EHRRW       HTAASKYDLDRYG-IMFRASPRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSC
NUOB_NEOSM       HFTASRYDMDRFG-MIFRPSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPKYVISMGSC
NUOB2_BURMS      HAAGARYDMDRFG-MIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSC
NUOB2_CHRVO      HAAAARYDMDRFG-WIPRATPRQADLMIVAGTLTNKMAPAMRKVYDQMSEPRYVLSMGSC
NUOB2_AZOSB      QAAASRYDMDRFG-MIPRASPRQADLIIVAGTLTNKMAPAIRKIYDQMAEPRYVISMGSC
NUOB_RICTY       QAAASRYDMDRFG-MLFRPSPRQSDLMIVAGTLTNKMAPALRKVYDQMTEPKWVLSMGSC
NUOB_ORITI       QTAGSRYDMDRYG-MLFRPSPRQADVMIVAGTLTNKMAPALRRVYDQMTEPKWVISMGSC
NUOB_DEHM1       CMAASRWDLARFGMDIFRASPRQADLMIVAGTLTWKMAPWLKRIYDQMPEPKWVLAMGAC
NUOB1_SALAI      ATSMSRHDFMRLGVIPFAHGPRQADLMVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGAC
NUOB1_SALTO      ATSMSRHDFMRLGVIPFAHGPRQADLMVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGAC
NUOB2_STRCO      AASMARHDFIRLGVIPFAPGPRQADLMVVSGTVTDKMAPAVKRLYEQMPEPKYVISFGAC
NUOB2_STRGG      AASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTDKMAPAVKRLYEQMPEPKYVISFGAC
NUOB2_ANADE      QTGGPRADLMRFGAIPRA-SPRQADFMIVAGTLTYKMAERARLLYDQMPEPKYVISMGSC
NUOB1_ANADF      QFGGPRADVMRFGAIPRA-SPRQADFMIVAGTLTYKMAERAKLLYDQMPEPKYVISMGSC
NUOB2_SORC5      QTGGPRGDLERFGAAPRP-SPRSSDLFIIAGTLTYKMATRVKRLYDQMSEPRFVISMGSC
NUOB_PELLD       ATNASNYDLERFGIFPRS-SPRQSDLMIVAGTVSMKMAERVVRLYEQMPEPRYVLSMGSC
NUOB2_CHLT3      ATNASNYDLERFGIFPRS-SPRQSDLMIVAGTVTFKMAERVVRLYEQMPEPRYVLSMGSC
NUOB1_CYTH3      QTFTSGYDLDRFGVIPRP-SPRQSDVMIVAGTVTFKMADRIRRLYEQMPEPRYVISMGSC
NUOB_AMOA5       GAYASHYDLDRLGVIPRN-SPRQADVMIVSGTVTFKMADSIRRLYDQMPEPRYVISMGSC
NUOB_RUBXD       STGMAHNDLERFGAGFFAGSPRQADVMIVSGTVSTKMAERMTRLYEQMPEPKWVIAMGAC
NUOB_BACCN       GVGSSHYDLDRFGS-FFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSC
NUOB_HYDS0       HAAASRFDIDRLG-MIFRASPRQADVLIVAGTVVNKVAPMLKLVWDQMPEPKWCISMGGC
NUOB_AQUAE       HTAASRFDLDRLG-VIFRASPRQADVLIVAGTVVNKVAPMLKLIWDQMPDPKWCISMGGC
NUOB_SULSY       HTAASRFDTDRLG-IIFRGSPRQSDVLIVAGTVVNKVAPMLRLIYEQMPDPKWVISMGGC
NUOB_BACTN       ALGAARYDMARFGFEVARASPRQADMIMVCGTITNKMAPVLKRLYDQMPDPKYVVAVGGC
NUOB_BACV8       AVGAARYDFARFGFEVARASPRQADMIMVAGTITHKMAPVLKRLYDQMADPKYVIAVGGC
NUOB_AZOPC       CLGAARYDFARFGWEVTRNSPRQADVVFCCGTIVHKMAPVLKRLYDQMSEPKYVIALGSC
NUOB_CARHZ       AAGGPKYDFSRFGYEVWRPSPRHADLMIVAGTITKKMQPLVLRLYEQMAEPKYVIAMGSC
NUOB_DESRM       AANMARFDLARFGYEVMRASPRQADVMLVCGTVTKKAAPFVVRLYEQMAEPKYVIAMGSC
NUOB_CLOB8       AAGGARYDIARFGYEVFRASPRQADLMIVAGTITEKMAPIVKKIYDQMPEPKWVIAMGSC
NUOB_MOOTA       AAGGARYDIARFGYEVFRPSPRQADLMIVAGTVTRKMAPLVRRLYEQMPAPKWVIAMGSC
NUOB_HELMI       ATGASRFDMARFGYEVFRPSPRQADLIIIAGTLTWKMAPAIQRVYEQMPEPKWIIAMGSC
NUOB_DESHY       AAGGPRVDISRFGYEVFRASPRHADVMIVAGTCTRKMAPLLRMIYDQMPEPKWVIAMGSC
NUOB2_CHLAD      AFGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGAC
NUOB1_ROSS1      ATGLARFDLARFGAEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGAC
NUOB2_HERA2      AAAASRYDISRFGSELFRASPRQADVMIVAGTVTKKMVPQVVRLFNQMPEPRYVISMGAC
NUOB2_SYMTH      AACSSKYDIARFGSEAMRMSPRQADVMIVAGTVNEKMAVVVRRLYDQMSEPKFVIAMGAC
NUOB_DESVM       AVGMARFDISRFGAEVFRPSPRQSDLMIVAGTVTRKMAPALVRLYEQMPAPRYVMALGNC
NUOB2_OPITP      AAGMARFDISRFGAEVFRPSPRQADVMIVAGTVNKKMAPAVKLLYDQMLEPKWVIAMGQC
NUOB_ACIAD       TL-TGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGAC
NUOB_PSYWF       TL-TAVHDLSRFGAEVIRASPRQADVMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGSC
NUOB_PSEMY       AF-TAPHDVARFGAEVIRASPRQADFMVIAGTCFIKMAPVIQRLYEQMLEPKWVISMGSC
NUOB_CHRSD       AF-TAPHDVARFGSEVIRASPRQADFMVIAGTCFIKMAPVIQQLYDQMLEPKWVISMGSC
NUOB_AERS4       AF-TSPHDVARFGAEVIRASPRQADFMVIAGTPFIKMAPVIQRLYEQLLEPKWVISMGAC
NUOB_SODGM       SF-TAVHDVARFGSEVIRASPRQADFMVVAGTPFTKMAPVIQRLYDQMLEPKWVISMGAC
NUOB_BAUCH       SF-TAVHDVARFGSEVIRASPRQADFMVIAGTPFIKMAPVIKRLYDQMLEPKWVISMGSC
NUOB_BLOFL       AF-TAVHDVARFGSEVLRSSPRQSDFMVIAGTPFLKMVPIIQRLYDQMLEPKWVISMGSC
NUOB_BLOPB       AF-TAIHDVARFGSEVLRASPRQADFMVIAGTPFLKMVPVIQRLYDQMLEPKWVISMGAC
NUOB_BUCAI       AF-TSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGAC
NUOB_BUCAP       AF-TSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGAC
NUOB_BUCCC       AF-TSIHDISRFGSEVLRTSPRQADFMVIAGTPFIKMAPVIQRLYDLMLEPKWVISMGSC
NUOB_BUCBP       SF-TSVHDISRFGSEVLRASPRQADFMVIAGTPFIKMVPIIQRLYDQMLEPKWVISMGSC
NUOB2_ACICJ      AF-TSKFDIARFGSEVLRATPREADLIVISGTVFVKMAPVIKYLYDQMLEPRWVISMGAC
NUOB1_GLUDA      AF-TSKYDIARFGSEVLRATPREADLIVISGTVFVKMAPIVKYLYDQMLEPRWVISMGSC
NUOB_METCA       AF-TSRFDIARFGSEVIRASPRQADLMVISGTVFRKMAPVVKHLYDQLLEPKWIISMGSC
NUOB1_NITMU      SF-TSKYDLARFGSEVIRASPRQADLIVISGTVFIKMAPVLQRLYDQMLEPRWVISMGSC
NUOB1_NITOC      SF-TSKYDIARFGAEVIRATPREADLMVISGTVFIKMAPVIKRLYEQMMEPRWVISMGSC
NUOB_SHEWM       SF-TSRHDIARFGSEVIRATPREADLIVISGTVFLKMAPVIKHLYDQMLEPKWVICMGSC
NUOB2_RHOPB      AL-TSVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGAC
NUOB1_RHOS5      AL-TPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYQQMREPRWVISMGAC
NUOB_METI4       SA-CARFDISRFGAEVMRFSPRQCDVMIVAGTVTYKMAYSVKRIYEQMPDPKWVISMGAC
NUOB_AKKM8       VA-CSRYDLSRFGSEVTRFSPRQADVMIVAGTVTYKMALAVRRIWDQMPEPKWCIAMGAC
NUOB1_OPITP      VG-NGRFDIARFGAEVMRFSPRQSDCMIVAGSVTYKMAPQIRRIYDQMMSPKWVIAMGAC
NUOB1_CHLT3      MA-GPRYDIARFGAEVFRFSPRQSDLMIVAGTVTYKMATVVKKIWDQMPEPKWCIAMGAC
NUOB_SALRD       FA-GPKYDSARFGSEAMRFSPRQADLMIVAGWCSYKMSHAIRRVWDQMGDPKWCIAMGAC
NUOB1_ANADE      MA-SARYDSDRFGAAMPRFSPRQADLLMVVGTVNCKQAPILQRIYEQMADPKWVMAFGVC
NUOB2_ANADF      VA-SARYDLDRFGAALPRFSPRQADLLIVVGTVNCKQAPILRRVYEQIAEPKWVVAFGVC
NUOB_MYXXD       VA-ASRHDISRFGAEFPRFSPRQADLLMVVGTINLKQAPILKRVYEQMAEPKWVVAFGVC
NUOB1_SORC5      MA-SPRFDMARFGAEVPRFSPRQADLLWVVGTISQRQAPALKRIYEQMADPKWVLAFGTC
NUOB_PELPD       VA-STLYDTDRFGAALPRFTPRQSDLLMVVGTITHKEAPVIKRVYDQMCDPKWVMAFGAC
NUOB_ARCB4       VA-GAKYDVSRFGAEVVRFSPRQADLLIVAGTISYKQAPILKKIYEQMCEPKWVISMGAC
NUOB_CAMFF       AV-SSKHDLSRFGAEVMRFSPRQADLMIIAGTISFKQAPILKEIYDQMCEPKWVVSMGAC
NUOB_BDEBA       VM-GPKYDLARFGAEVARFSPRQADLLVVAGTITEKMAPVIVRIYQQMLEPKYVLSMGAC
NUOB_FLAPJ       TM-ASHYDLARFGSERVSFSPRQADMLMVMGTISKKMAPILRQVYEQMAEPRWVIAVGAC
NUOB2_CYTH3      TM-ASTYDIARFGAERPSFSPRQADVLLVMGTIAKKMGPVLRHVYEQMAEPKWVVAVGAC
NUOB_LEPBP       TA-CADYDIARFGAERPSFSPRQADMILVLGTITYKMAPVLRQIYDQLAEPKFVISVGAC
NUOB_LEPIN       TA-CSDYDIARFGAERPSFSPRQADMILVLGTITYKMAPVLRQIYDQMAEPKFVISVGAC
NUOB1_KORVE      MG-ASRFDIARFGAEVFRPSPRQSDLMIIAGRVSQKMAPVIRHLYLQMPEPKWVISMGAC
NUOB2_SOLUE      MS-ASRFDIARFGAEVFRGSPRQSDLMIIAGRVSNKMAPVIRHLYQQMPEPKWAISMGAC
NUOB_MYCA9       TA-GPRFDIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAMGVC
NUOB_NOCFA       TG-AGRFDIARFGMEAFRASPRQADLMIVAGRVSQKMAPVLRQVYDQMAEPKWVLAMGVC
NUOB1_STRGG      TG-AGRYDLARFGMEVFRGSPRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVC
NUOB_ACIC1       TG-AGRYDLARFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVC
NUOB_NOCSJ       SG-GPKHDLGRFGMEVFRASPRQADVMIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVC
NUOB_THEFY       AG-GPRFDIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRTIYDQMAEPKWVIAMGVC
NUOB2_SALTO      AG-GPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVC
NUOB_FRASN       TG-AGRYDLSRFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMPEPKWVLSMGVC
NUOB_SACEN       VG-GSRYDIARFGMERFSATPRQADLMVVAGRVTNKMAPVLRQVYDQMPEPRWVIAMGVC
NUOB_CUTAK       YG-GPRADAARWGHEVFRASPRQADLMIVSGRVSQKMAPVVRQLYDQMPEPKWVISMGAC
NUOB1_SYMTH      LASGPRYDIARFGSEAFRASPRQADLIFISGRVSNKMAPVIKRVYSQMLEPKWVVAFGAC
NUOB1_CHLAD      AQ-ASNYDLSRFGMELNRASPRQADLMIVAGRVSRKMAPVVRRLYDQMPEPKWVIAMGDC
NUOB2_ROSS1      AQ-GANYDLSRFGMEINRASPRQADLMIVAGRVSRKMAPVVRRLYDQMADPKWVIAMGDC
NUOB1_HERA2      GQ-ASNYDMSRFGLELMRASPRQADLMIVAGRVSRKMAPVLRRLYDQMPEPKWVVAMGDC
NUOB_PARUW       TA-ASRYDLARFGMEVFRASPRQSDVMIVAGRVSQKMAPVLQTIYEQMLEPKWVIAMGDC
NUOB_DEIRA       ST-NARNDMSRFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVISMGAC
NQO6_THET8       ST-DARNDLARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGAC
NUOB2_KORVE      AS-TARYDIARFGSEVFRPSPRQSDLMIVAGTVTLKMAPVVQRIYEQMPEPKWVMAMGAC
NUOB1_SOLUE      SS-TSRFDIARFGAEVFRPSPRQSDLMIVAGTVTLKMAPVLKRIWDQMPDPKWCISMGAC
NUOB_THERP       SA-MPRFDLAERFGMLYRASPRQADLMIVAGTVTKKMAPVVRQLYDQMADPKWVISMGSC
NUOB2_RHIME      AG-CARYDLDRF-GVVFRPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTC
                        *  .         .: .: .   *    :       ::  :  *:  :..* *

NDHK1_CYAP4      TITGGMFS-TDSPTAVRGVDKLIPVDIYLPGCPPRPEAIMDAIVKLRKKIGNEHLDER-G
NDHK_THEEB       TITGGMFS-SDSYSAVRGVDKLIPVDVYLPGCPPRPEAIMDAIVKLRKKIANEHINER-G
NDHK1_ACAM1      TITGGMFS-SDSTTAVRGVDKLIPVDVYLPGCPPRPEAVMDAIVKLRKKIANEDVRER-G
NDHK_CROS5       TITGGMFS-SDSTTAVRGVDKLIPVDVYIPGCPPRPEAIFDAIIKLRKKVSNETIQERST
NDHK_MICAN       TITGGMFS-SDSTTAVRGVDKLIPVDVYIPGCPPRPEAIIDAIIKLRKKVANESIQERGT
NDHK_SYNP2       TITGGMFS-SDSTTAVRGVDKLIPVDLYIPGCPPRPEAIIDAIIKLRKKVSNETIQERSL
NDHK1_SYNY3      TITGGMFS-SDSTTAVRGVDKLIPVDVYIPGCPPRPEAIFDAIIKLRKKVANESIQER-A
NDHK_GLOC7       TITGGMFS-SDSTTAVRGVDKLIPVDVYIPGCPPRPEAIFDAIVKLRKKVANDSIQVR--
NDHK_NOSP7       TITGGMFS-VDSPTAVRGVDKLIPVDVYLPGCPPRPEAIIDAIIKLRKKISNESIQER-D
NDHK_TRIEI       TITGGMFS-MDSPTAVRGVDKLIPVDVYIPGCPPRPEAIIDAVIKLRKKIANDSLQER-G
NDHK_SYNP6       TITGGMFS-ADSTTTVRGVDKLLPVDVYIPGCPPRPEAIIDAIVKLRKKVANDSIQER-G
NDHK1_GLOVI      TITGGMFS-TDSYTTVRGVDKLIPVDVYIPGCPPRPEAIFDAIVKLRKKMATEDVRDRYE
NDHK2_GLOVI      TITGGMFS-TDSPTTVRGVDKLIPVDVYIPGCPPRPEAIFDAIIKLRKKMATEDFRERYD
NDHK_SYNJA       TISGGMFS-SDSYTAVRGVDKLIPVDVYIPGCPPRPEAIMDAIVKLRKKIAAEDMRER-G
NDHK2_SYNY3      TITAGMFS-ADSPTAVRGVDKLIPVDVYIPGCPPRPEAVIDGIIKLRKKVAGESRQDY-T
NDHK2_ACAM1      TITGGMFS-ADSPSAVRGVDKLIPVDVYIPGCPPRAEAVLDAITKLRKKIANESLQER-D
NDHK2_CYAP4      MITGGMFS-ADSPTALRGADKLLPIDVYIPGCPPRPEAILDAVTKLRKKIANESPQER-Q
NDHK_PROMA       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVGNESFLER-K
NDHK_PROM4       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVGNESFQER-E
NDHK_PROMT       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVANESISER-S
NDHK_PROMM       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVGDESVAER-I
NDHK_SYNS9       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVGDESLAER-S
NDHK_SYNPW       TITGGMFS-ADSTTAVRGVDKLIPVDLYMPGCPPRPEAIFDAVIKLRKKVANESVADR-R
NDHK_SYNR3       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVGDEAIAER-G
NDHK_PAUCH       TITGGMFS-SDSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVGNEALRER-G
NDHK_PROMP       TITGGMFS-ADSTTAVRGVDKLIPVDLYLPGCPPRPEAIFDAVIKLRKKVANESILER-N
NDHK_ANGEV       TITGGMFS-TDSYSTVRGIDKLIPVDVYLPGCPPKPEAIIDAIIKLRKKVAQETYRDRTK
NDHK_PSINU       TITGGMFS-TDSYSTVRGVDKLIPVDIYLPGCPPKPEAIIDAVIKLRKKVAQETYKDQKR
NDHK_PHYPA       TITGGMFS-TDSYSTVRGVDKLIPVDIYLPGCPPKPEAIIDAIIKLRKKIAQETYKDKSK
NDHK_MARPO       TITGGMFS-TDSYTTVRGVDKLIPVDIYLPGCPPKPEAIIDAIIKLRKKIAQEIYEEKKI
NDHK_HUPLU       TITGGMFS-TDSYSTVRGVDKPIPVDVYLPGCPPKPEAIIDAIVKLRKRVAQETYESKIR
NDHK_ANTAG       TITGGMFS-TDSYSTVRGVDKLIPVDIYLPGCPPKPEAIIDAIIKLRKGVAREVHERKDK
NDHK_DIOEL       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISREISEDRVM
NDHK_LEMMI       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISREIYEDRIG
NDHK_MAIZE       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDALTKLRKKIAREIIEDRTL
NDHK_LOTJA       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPESILDAITKLRKKISREIHEDQTS
NDHK_FAGEA       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISWEIYEDRIQ
NDHK_PELHO       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISREIYEDRVR
NDHK_PIPCE       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAILDAITKLRKKVSREIYEDKIG
NDHK_CYCTA       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAIIKLRKKVAREIYEDRTK
NDHK_CRYJA       TITGGMFS-TDSYSTVRGVDKLIPVDIYLPGCPPKPEAIIDAIIKLREKIAQEISEDRNE
NDHK_STAPU       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAVIKLRKKVGQETAHEKKN
NDHK_CHAGL       TITGGMFS-TDSYSTVRGVDKLIPVDIYLPGCPPKPEAIIDAVIKLRKKVGQETYFERAK
NDHK_ZYGCR       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAIVDAIIKLRKKVAQENGQDRLN
NDHK_MESVI       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAVIKLRKKVAQENLVERGK
NDHK_CHLAT       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAVIKLRKKVAQEDFVERNN
NDHK_NEPOL       TITGGMFS-TDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAVIKLRKKVAQEQTAERRG
NDHK_CHAVU       TITGGMFS-TDSYSTVRGVDKLIPVNVYLPGCPPKPEAIIDGVIKLRKQIAQENTNQKHF
NDHK_ADICA       TITGGMFS-TDSYSTVRGVDKLIPVDIYLPGCPPKPEAIMDAVTKLRKKIARNRFVNRAS
NUOB2_THEYD      ACTGGIF---NTYSTVQGADQFLPVDVYVPGCPPRPEALMYGVLKLKEKIMRE-------
NUOB1_THEYD      ACSGGIF---NTYSTVQGVDEILPVDVYIPGCPPRPEALIEGLLKLQEKIKTEP------
NUOB_GEOLS       ACSGGIF---DTYSVVQGIDEALPVDVYIPGCPPRPEALLYGLMKLQDKIMQE-------
NUOB_DESDA       ACSGGLF---QSYAVTQGVDQVVPVDVYVPGCPPRPEALFDGFIRLQEIINKE-------
NUOB_CAMC1       ANTGGMF---NTYSTVQGVDRIIPVDIYIPGCAPRPETLQYALMMLQKKIRKQS------
NUOB_NITSB       ANTGGMF---NTYATVQGVDRVIPVDIYLPGCAPRPETLQYAVMLLQKKLRKRS------
NUOB_SULNB       ANTGGMF---NTYATVQGVDRIIPVDIYLPGCAPRPETLQYALMMLQKKIRRES------
NUOB_SULDN       ANTGGMF---NTYATVQGVDRIIPVDLYLPGCAPRPETLQYGVMLLQKKIRANK------
NUOB_WOLSU       ANTGGMF---NTYATVQGCDRIIPVDVYLPGCAPRPETLQYAVMVLQQKIRREK------
NUOB_CAMHC       ANTGGMF---NTYAVVQGCDRIIPVDIYLPGCAPRPETLQYALMILQKKIRREK------
NUOB_HELPJ       ANTGGMF---NTYATVQGADRVVPVDIYLPGCAPRPETLQYALMVLQDKIRRSK------
NUOB_DECAR       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIIQLQNKIRRTNTIAR--
NUOB_VESOH       AN-GGGYY-HYSYAVIRGCDRIVPVDIYVPGCPPTAEALLYGIMQLQDKIRRTNTIART-
NUOB_FRAP2       AN-GGGYY-HYSYSVVRGCDRIIPVDIYVPGCPPTAEALVYGIIQLQNKIIRKDTIARK-
NUOB_XYLFA       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGILQLQKKIWRTQTNAG--
NUOB_HALHL       AN-GGGYY-HYSYSVTRGCDRIVPVDIYVPGCPPTAEALYYGILQLQNKIRRTNTIAR--
NUOB_BORPD       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLLQMQNKIRLTNTIAR--
NUOB_METPP       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGILQLQAKIRRENTIAR--
NUOB_ACIF2       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIFGLIQLQKKIRRTNTIAR--
NUOB_NEIG1       AN-GGGYY-HYSYSVVRGADRVVPVDVYVPGCPPTAEALIYGLIQLQQKIKRTSTIARDE
NUOB_GRABC       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGIMQLQKKIRRTGTILRG-
NUOB1_ACICJ      AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGITQLQKKIRRTGTIFRE-
NUOB2_GLUDA      AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGIFQLQKKIRRTGTILRG-
NUOB_RHOCS       AN-GGGYY-HYSYSVVRGVDRIVPVDIYVPGCPPTAEALVYGVLQLQKKIKNGNRLIRT-
NUOB_RHORT       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTSEALLYGVLQLQKKIKRTGALYR--
NUOB_MAGSA       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPSAEALMYGILQLQKKIRRTGSILR--
NUOB_RHOFT       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGIIQLQHKIRRTQTIARA-
NUOB_COXBR       AN-GGGYY-HYAYSVVRGCDRIVPVDVYVPGCPPTAEALFYGIMQLRNKIRYRNIFDRKD
NUOB_AGRVS       AN-GGGYY-HYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIER--
NUOB_OCHA4       AN-GGGYY-HYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILMLQKKIRRTGTIER--
NUOB_RHILO       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPSAEALLYGILLLQKKIRRTGTIER--
NUOB_BARBK       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGSIER--
NUOB_METS4       AN-GGGYY-HYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGVLLLQKKIRRTGTIER--
NUOB_AZOC5       AN-GGGYY-HYSYAVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQRKIRRTGTIER--
NUOB2_RHOPS      AN-GGGYY-HYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIER--
NUOB_OLICO       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVLLLQKKIRRIGTIER--
NUOB_METSB       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPSAEALLYGILLLQRKIRRTGTIER--
NUOB2_RHIEC      AN-GGGYY-HYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILLLQRKIRRNGSIER--
NUOB_PARL1       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILALQKKIRRTGTLDR--
NUOB_PELUB       AN-GGGYY-HYSYSVVRGCDKIVPVDIYVPGCPPSAEALLYGILQLQKKIRNKGSFER--
NUOB_PHEZH       AN-GGGYY-YFSYSTVRGCDRVVPVDVYVPGCPPTAEALVYGVLQLQKKIRRTGTIVR--
NUOB_CAUSK       AN-GGGYY-YYSYSVVRGCDRIVPIDIYVPGCPPTAEALVYGVLQLQKKIRRTGTIER--
NUOB_MARMM       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGILQLQKKIRREGSIER--
NUOB_HYPNA       AN-GGGYY-HYSYSVVRGCDRIVPVDIYIPGCPPTAEALVYGFLQLQKKIRREGSIER--
NUOB_SPHWW       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGIMQLQRKIRRIGTLER--
NUOB_SPHAL       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRTGTIER--
NUOB_ROSDO       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGIMQLQRKIRRTGTIVR--
NUOB_MAGMM       AN-GGGYY-HYSYSVVRGCDRILPVDVYIPGCPPTAEAVMYGIMQLQKKINREGQVYSGW
NUOB_LEGPC       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGIIQLQNKIRRK-PVLEA-
NUOB_ANAMM       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILCLQQKIIRGNPGVRGA
NUOB_ANAPZ       AN-GGGYY-HYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGLLCLQQKILRNGQGTWRA
NUOB_WOLPM       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGMLCLQNKIKRTRNG----
NUOB_EHRRW       AN-GGGYY-HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILCLQQKINRTATST---
NUOB_NEOSM       AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGVLCLQKKINRQRNFIRR-
NUOB2_BURMS      AN-GGGYY-HYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPK
NUOB2_CHRVO      AN-GGGYY-HYSYAVVRGCDRIVPVDVYVPGCPPTAEALLYGLMQLQAKIRRDDTASRRE
NUOB2_AZOSB      AN-GGGYY-HYSYSVARGCDRILPVDIYIPGCPPTAEALLYGLIQLQNKLKRP-----PA
NUOB_RICTY       AN-GGGYY-HFSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFKYDS
NUOB_ORITI       AN-GGGYY-HYSYSVVRGCDKIVPVDIYVPGCPPTPEALLYGILQLQKKINRTQQVKFKR
NUOB_DEHM1       GT-SGGLF-RDSYSVVPGFNMVVPVDVYVPGCPPRPEALLRAIMDIHEKIDKTRIIKR--
NUOB1_SALAI      SNCGGPYW--DSYSVTKGVDQLIPVDVYVPGCPPRPEALLHGILRLQEKIAAEGAGVGGV
NUOB1_SALTO      SNCGGPYW--DSYSVTKGVDQLIPVDVYVPGCPPRPEALLHGILRLQEKIAAEEAGVGGV
NUOB2_STRCO      SNCGGPYW--DSYSVTKGVDQIIPVDVYVPGCPPRPEALLQGILKLQEKIARESLGERYG
NUOB2_STRGG      SNCGGPYW--DSYSVTKGVDQIIPVDVYVPGCPPRPEALLQGILKLQEKIARESLAERYA
NUOB2_ANADE      SNCGGLFQ--LGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPWSTKRR
NUOB1_ANADF      SNCGGLFQ--LGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLIRLQELIRSEPWATKRR
NUOB2_SORC5      SNCGGLFQ--YAYSVCKGVDQIIPVDVYVPGCPPRPEALLEGLLKIQEKIKSE-RALGRR
NUOB_PELLD       SNCGGPYW-EHGYHVLKGVDRVIPVDVYVPGCPPRPEALIGGLMKVQELIRMEQIGMSRQ
NUOB2_CHLT3      SNCGGPYW-EHGYHVVKGVDRIIPVDVYVPGCPPRPEALIGGLMKVQELIREEKFAGDRR
NUOB1_CYTH3      SNCGGPYW-EHGYHVVKGVDRIVPVDIYVPGCPPRPEALIGGFLKLQEKIRKETLVAPK-
NUOB_AMOA5       ANCGGPYW-QHGYHVVKGVDRIIPVDVYVPGCPPRPEALIGGILKLQEKIKAKLTYS---
NUOB_RUBXD       AISGGPFL--DGYSVLMGADRVIPVDVYVPGCPPRPEALIFGIMTLQKKIEREQQVGYEK
NUOB_BACCN       ATAGGPYV--NSYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIRYEAKTGKQV
NUOB_HYDS0       ASAGGPFP---TYSTLQGIDRIIPVDVYIPGCPPTPQGLIYGLLELQRKIREKKVTRYEK
NUOB_AQUAE       ASAGGPFP---TYSTLQGVDRIIPVDVYIPGCPPTPQGLIYGILQLQRKIKEQGITKYDK
NUOB_SULSY       ASAGGPFP---TYPTLQGVDRIIPVDVYIPGCPPTPQALLWGILELQKKIKAK---KEGK
NUOB_BACTN       AVSGGP--FKKSYHVLNGVDKILPVDVYIPGCPPRPEAFYYGMMQLQRKVKIE-------
NUOB_BACV8       AISGGP--FKKSYHVLNGVDKILPVDVYIPGCPPRPEALLYGMIQLQRKVKLE-------
NUOB_AZOPC       AISGGP--FKSSYHTIMGIDKIIPVDVYIPGCPPRPDAMIYGMIQLARKIKVQ-------
NUOB_CARHZ       AISGGP--FVDSYHVVPGANTFLPVDVYIPGCPPRPEALLYGWLELKRKIQNP-------
NUOB_DESRM       AISGGP--FVDSYSVVPGVDKLIPVDVYIPGCAPRPDAVIHGFMKLKEKIINP-------
NUOB_CLOB8       ATSGGP--FVDSYNVVPGADTFLPVDVYIPGCPPRPEALIHGLLTLKEKIIHP-------
NUOB_MOOTA       AISGGP--FVDSYNVVPGVDTIVPVDVYVPGCAPRPEALINGLLALKKKVINP-------
NUOB_HELMI       ACTGGP--FADSYAVVPGVDKVIPVDVYVPGCPPRPEALLDGFLKLKAKIQNP-------
NUOB_DESHY       ASAGGP--FADSYSMLTGVDKIVPVDVYIPGCPPRPESLVYGLLQLQHKVNHP-------
NUOB2_CHLAD      ATSGGP--FRDGYNVLRGIDLLIPVDVYVPGCPPRPEALLHALMTLQEQIDRQKLGRVRW
NUOB1_ROSS1      ATSGGP--FRDGYNVLRGIDLLIPVDVYIPGCPPRPEALLHALMTLQKQIDAQRLNQVRW
NUOB2_HERA2      ATSGGP--FRDGYNVVRGVDLYVPVDVYIPGCPPRPEALLHALMTLQAQIDVQSLQQVRW
NUOB2_SYMTH      ASNGGP--YWDTYNVVDGVHKVVPVDVYVPGCPPRPEALLQGLMEIQEMIKT--------
NUOB_DESVM       AISGGPFNFEGQYAIVEGVDNLVPVDVYVPGCPPRPEALLEGLFQIQHKITGR-------
NUOB2_OPITP      AISGGPFKYPGQYAVVEGVDQLFPVDVYVPGCPPRPEALIEGILKLEEKITGK-------
NUOB_ACIAD       ANSGGM---YDIYSVVQGVDKIIPVDVYVPGCPPRPEALIQALMLLQDQIQ---------
NUOB_PSYWF       ANSGGM---YDIYSVVQGVDKIIPVDVYVPGCPPRPEALIQGLMLLQESIT---------
NUOB_PSEMY       ANSGGM---YDIYSVVQGVDKFLPVDVYIPGCPPRPEAFLQGLMLLQESIG---------
NUOB_CHRSD       ANSGGM---YDIYSVVQGVDKFLPVDVYVPGCPPRPEAFLQGLQLLQDSIQ---------
NUOB_AERS4       ANSGGM---YDIYSVVQGVDKFLPVDVYIPGCPPRPEAFLQALMLLQDSIG---------
NUOB_SODGM       ANSGGM---YDIYSVVQGVDKFLPVDVYIPGCPPRPEAYIQALLLLKESIG---------
NUOB_BAUCH       ANSGGM---YDIYSVVQGVDKFLPVDVYIPGCPPRPEAYIQALLLLKEAIG---------
NUOB_BLOFL       ANSGGM---YDIYSVVQGVDKFLPVDIYIPGCPPRPEAYIQALLLLKKSIN---------
NUOB_BLOPB       ANSGGM---YDIYSVVQGVDKFLPVDLYIPGCPPRPEAYIQGLLLLKKSIN---------
NUOB_BUCAI       ANSGGM---YDIYSVVQGVDKFLPVDIYIPGCPPRPEAYMQALILLQKLIN---------
NUOB_BUCAP       ANSGGM---YDIYSVVQGVDKFLPVDIYIPGCPPRPEAYIHALTLLQKTIN---------
NUOB_BUCCC       ANSGGM---YDIYSVVQGVDKFLPVDIYIPGCPPRPEAYIHAITLLQKAIS---------
NUOB_BUCBP       ANSGGM---YDIYSVVQGVDKFLPVDVYIPGCPPRPEAYIHGLMLLQKSIS---------
NUOB2_ACICJ      ANSGGM---YDIYAVVQGADSFLPVDVYVPGCPPRPDALLEGLMLLQNSIG---------
NUOB1_GLUDA      ANSGGM---YDIYSVVQGVDSFLPVDVYVPGCPPRPDALLEGLMLLQDSVG---------
NUOB_METCA       ANSGGM---YDIYSVVQGVDKFLPVDVYVPGCPPRPEALLEGLMMLQESVG---------
NUOB1_NITMU      ANSGGM---YDIYSVVQGVDRFLPVDVYVPGCPPRPDAFMQGLNLLQDAIG---------
NUOB1_NITOC      ANSGGM---YDIYSVVQGVDKFLPVDVYVPGCPPRPDAFLEGLLLLQEAIG---------
NUOB_SHEWM       ANSGGM---YDVYSVVQGADRFLPIDLYVPGCPPRPEALMYGLTLLQEAIKDGA------
NUOB2_RHOPB      ANSGGM---YDIYSVVQGVDSFLPVDVYIPGCPPRPEAVLDALIMLQQQVG---------
NUOB1_RHOS5      ANSGGM---YDIYSVVQGVDSFLPVDVYVPGCPPRPEALMEALVLLQSKIA---------
NUOB_METI4       ASSGGM---YRSYSVLQGIDQLIPVDVYVSGCPPRPEALLDALIKLQEKID---------
NUOB_AKKM8       ASTGGM---FRSYSVLQGVDKILPVDVYISGCPPRPEAILEALLTLRKKLD---------
NUOB1_OPITP      ASSGGM---YRSYAHMQGVDRILPVDVYISGCPPRPEGILDALMKLQAKIR---------
NUOB1_CHLT3      SSSGGM---FRSYPVVQGIDQFLPVDVYVPGCPPRPDAVIHAVMEIQEKIK---------
NUOB_SALRD       ASTGGM---HRCYGVVQGVDNFLPVDVYISGCPPRPESVLHALMDIQEKIR---------
NUOB1_ANADE      ASSGGF---YDNYATVQGIDRIIPVDVYVPGCPPRPEQVLDGIMLLQKKIQ---------
NUOB2_ANADF      ASSGGF---YDNYATVQGIDRIVPVDVYIPGCPPRPEQVLDGIMLLQQKIQ---------
NUOB_MYXXD       ASSGGF---YDNYAVLQGIDRIIPVDVYIPGCPPRPEQVLDGLMLLQDKIG---------
NUOB1_SORC5      ASCGGF---YDNYTTVAGIDKVIPCDVYVPGCPPRPEAVLDGLMLLQDKIAR--------
NUOB_PELPD       ATSGGV---YRNYTVLQGVDRIIPVDIYIPGCPPRPEMVIDAIMKLQDKIA---------
NUOB_ARCB4       ACSGGF---YDNYTTVQGIDEIIPVDEYVAGCPPRPEAVLDAIMRIQEKAK---------
NUOB_CAMFF       ACSGGF---YDNYTTLQGIDQIIPVDVYISGCPPRPEAIIDAILAIQDKIS---------
NUOB_BDEBA       ASSGGF---YRAYHVLQGVDKVIPVDVYIPGCPPTPEAVMDGIMALQRMIA---------
NUOB_FLAPJ       ASSGGI---FDTYSVLQGIDKVIPVDVYVPGCPPRPEQIVDGVMRLQELVK---------
NUOB2_CYTH3      ASSGGI---FDTYSVLQGIDRIIPVDVYVPGCPPRPEQIIQGLMRVQDLAS---------
NUOB_LEPBP       ASSGGM---FHTYGVLQGVDRILPVDVYVPGCPPRPEAILDALVKLQKKVQ---------
NUOB_LEPIN       ASSGGM---FHTYGVLQGVDRILPVDVYVPGCPPRPEAILDALLKLQTKLK---------
NUOB1_KORVE      ATSGGV---FNNYALVQGVNQYIPVDIYVPGCPPRPEQLIYAITLLQEKI----------
NUOB2_SOLUE      ATSTGV---FNNYALIP-VNQVIPIDVFVPGCPPRPEQLIYALMMLQEKI----------
NUOB_MYCA9       ASSGGM---FNNYAIVQGVDHVVPVDIYLPGCPPRPEMLLHAILKLHEKI---------A
NUOB_NOCFA       ASSGGM---FNNYAVVQGVDHVVPVDIYLPGCPPRPEMLLNAILALHDKI---------Q
NUOB1_STRGG      ASSGGM---FNNYAIVQGVDHIVPVDIYLPGCPPRPEMLLDAILKLHQKI---------Q
NUOB_ACIC1       ASSGGM---FNNYAIVQGVDHVVPVDMYLPGCPPRPEMLMHAILELHEKI---------K
NUOB_NOCSJ       ASSGGM---FNNYAVVQGVDHVVPVDMYLPGCPPRPQMLIDAILKLHDKV---------Q
NUOB_THEFY       ASSGGM---FNNYAIVQGVDHIVPVDIYLPGCPPRPEMLLDAILKLHDKV---------Q
NUOB2_SALTO      ASSGGM---FNNYAIVQGVDHVVPVDMYLPGCPPRPEMLIDAILKLREKI---------M
NUOB_FRASN       ASSGGM---FNNYAIVQGVDHIVPVDMYLPGCPPRPEMLMDAIVKLHEKILAGSVSGKVE
NUOB_SACEN       ASSGGM---FNNYAVVQGVDHVVPVDMYLPGCPPRPEMLLDAILKLHAKIMDEPINAKRA
NUOB_CUTAK       ASSGGI---FNNYAVVQGCDHIVPVDVYLPGCPPSPDMLIDAVFKIREQI---------Q
NUOB1_SYMTH      ASSGGI---FDNYAIMQGVDNLLPVDIYVPGCPPTPEAVIYAVQKLRDRI----------
NUOB1_CHLAD      AACGGI---FNNYAIVQGVDEVVPVDVYVAGCPPRPEALIDGIMMLHQKVM---------
NUOB2_ROSS1      AACGGV---FNNYAIVQGVDEIVPVDVYVAGCPPRPEALIDGIIHLHEKVK---------
NUOB1_HERA2      ASCGGV---YNNYAIVQGVDEIVPVDVYVAGCPPRPEALIDGILQLHEKIK---------
NUOB_PARUW       ASCGGV---YNNYAIIQGVDKLVPVDVYLAGCPPRPEALIDALIMLQNKIK---------
NUOB_DEIRA       ASSGGM---FNNYAVVQNVDSVVPVDIFVPGCPPRPEALIYAVMQLQKKV----------
NQO6_THET8       ASSGGM---FNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKV----------
NUOB2_KORVE      ASVGGP---FNTYATLQGVDKIVPVDVYVVGCPPRPENLFYGLLKLQDKID---------
NUOB1_SOLUE      SSVGGP---FNTYAVLQGVDKIVPVDVYVTGCPPRPENLFYALLKLQDKID---------
NUOB_THERP       ANVGGP---FDTYAVVQGVDQVIPVDIYVPGCPPVPEALYYGVLELQNRII---------
NUOB2_RHIME      AISGGV---YNTYAVVQGSETFVPVDVHVPGCPPRPEALMHGFLLLQEKIK---------
                     *              .  .* : .: **.* .     .   :              

NDHK1_CYAP4      Q---------------------------------LQQTHRFHSVKHGMKS-----VAPIL
NDHK_THEEB       N---------------------------------LAQTHRLFTAKHKMKP-----VPPIL
NDHK1_ACAM1      N---------------------------------LMQTHRYYSTTHQMKV-----VPPIH
NDHK_CROS5       V---------------------------------MEQTHRYYSTPHNMKA-----VSPIL
NDHK_MICAN       V---------------------------------LQQTNRYYSTTHKMQA-----TEPIL
NDHK_SYNP2       K---------------------------------TEQTHRYYSTAHSMKV-----VEPIL
NDHK1_SYNY3      I---------------------------------TQQTHRYYSTSHQMKV-----VAPIL
NDHK_GLOC7       ----------------------------------PEQNHRYYSTTHTMKA-----TSPIL
NDHK_NOSP7       K---------------------------------IKQTHRYYSTTHNLKP-----VEEIL
NDHK_TRIEI       Q---------------------------------LQQTHRYYCVKHNMKV-----VEPIL
NDHK_SYNP6       K---------------------------------LLQTNRYYSTTHQMKP-----TAPLL
NDHK1_GLOVI      Q---------------------------------IRQTHRYHTTAHTLKA-----VPESL
NDHK2_GLOVI      T---------------------------------IAQTHRYYTAAHRMKA-----VADPL
NDHK_SYNJA       R---------------------------------LQQTHRYYTVKHNLKP-----VPEII
NDHK2_SYNY3      E---------------------------------DLQTHRFHAVRHRMKP-----VSPIL
NDHK2_ACAM1      T---------------------------------TQQTHRYYSIPHKMKV-----VPPAV
NDHK2_CYAP4      N---------------------------------LQQTHRFYSIAHQMRP-----APPLH
NDHK_PROMA       K---------------------------------ITQTHRYFTITHKMKR-----INPLV
NDHK_PROM4       K---------------------------------MLQKHRYFSVPHKMKR-----VQSQV
NDHK_PROMT       K---------------------------------ITQTHRYLTIPHKMKR-----VESKV
NDHK_PROMM       K---------------------------------IAQTHRYFTVPHHMKR-----VEPIV
NDHK_SYNS9       K---------------------------------HQQTHRYFTMTHQMKA-----VEPQV
NDHK_SYNPW       Q---------------------------------LQQTHRYCTVAHAMTA-----VEPIV
NDHK_SYNR3       K---------------------------------LEQTHRYSTVEHRMTA-----VDPIV
NDHK_PAUCH       K---------------------------------LLPTHRYFTVAHKMKQ-----VKPII
NDHK_PROMP       K---------------------------------SEQTHRYLTVDHEMNL-----VFSEN
NDHK_ANGEV       ----------------------------------NKRENRFFTSNHQFKF-----VPSIH
NDHK_PSINU       ----------------------------------SIRGNRFFTLKHQFDF-----VPSIH
NDHK_PHYPA       ----------------------------------FQQGNRYLTLNHKFHF-----VSNIN
NDHK_MARPO       ----------------------------------LKKGTRFFTLNHQFNF-----FSNLD
NDHK_HUPLU       ----------------------------------LKPGNRFFTSIHQFRF-----VSNNL
NDHK_ANTAG       ----------------------------------LRQTRRYFTLNHQLEI-----VPIIH
NDHK_DIOEL       ----------------------------------SQRENRSFTTNHKFDI-----RRSTH
NDHK_LEMMI       ----------------------------------SKQENRCFTINHKFHV-----QRSIH
NDHK_MAIZE       CQ--------------------------------SQKKNRSFTTRHKLYV-----RRSTH
NDHK_LOTJA       SLS-------------------------------SQRENRCFTTNHKFYV-----ERSTH
NDHK_FAGEA       ----------------------------------SQRKNRYFTIKHKFRV-----GRRIH
NDHK_PELHO       ----------------------------------SQRVNRYFTTNHKFLI-----GRSIH
NDHK_PIPCE       ----------------------------------SQRENRYFTTNHKFHVPKSHVGRSTH
NDHK_CYCTA       ----------------------------------LQQGKRYFTQNHKFRV-----GSSLY
NDHK_CRYJA       ----------------------------------FQQGKRYFTRKHRFHF-----GSSIL
NDHK_STAPU       ----------------------------------YQQSQRCFTMSHRLKP-----VLPIH
NDHK_CHAGL       ----------------------------------IQSFHRYFTISHRLKP-----TYSVE
NDHK_ZYGCR       ----------------------------------QNQQHRCFSVTHRLQP-----VPAVH
NDHK_MESVI       ----------------------------------LAQTHRYHSIKHELTL-----SSPVY
NDHK_CHLAT       ----------------------------------FRQIHRYYSISHEFKS-----SSTVH
NDHK_NEPOL       ----------------------------------IEQIHRYFTLSHRLQP-----VSPIL
NDHK_CHAVU       S---------------------------------FEHKHRYFSTNHKLNY-----PTTCY
NDHK_ADICA       ----------------------------------RPIRTKYFSISHQLNL-----VPGTC
NUOB2_THEYD      -------------------------------------EGRWGRLK---------------
NUOB1_THEYD      -------------------------------------HKKTGCLSGVCLIDKSQRRCSYE
NUOB_GEOLS       -------------------------------------SNSFGSVFGLGERVSTV------
NUOB_DESDA       -------------------------------------QMRWSPWR---------------
NUOB_CAMC1       -------------------------------------AFRAQKPR---KLEI--------
NUOB_NITSB       -------------------------------------IFQKQKPK---RLV---------
NUOB_SULNB       -------------------------------------ANMNNNTKQNLRLV---------
NUOB_SULDN       -------------------------------------ASRAQVAK---RLM---------
NUOB_WOLSU       -------------------------------------ASRKLPPK---RLV---------
NUOB_CAMHC       -------------------------------------ANRNQLPK---RLV---------
NUOB_HELPJ       -------------------------------------AIKQDAPK---RLV---------
NUOB_DECAR       ------------------------------------------------------------
NUOB_VESOH       ------------------------------------------------------------
NUOB_FRAP2       ------------------------------------------------------------
NUOB_XYLFA       ------------------------------------------------------------
NUOB_HALHL       ------------------------------------------------------------
NUOB_BORPD       ------------------------------------------------------------
NUOB_METPP       ------------------------------------------------------------
NUOB_ACIF2       ------------------------------------------------------------
NUOB_NEIG1       ------------------------------------------------------------
NUOB_GRABC       ------------------------------------------------------------
NUOB1_ACICJ      ------------------------------------------------------------
NUOB2_GLUDA      ------------------------------------------------------------
NUOB_RHOCS       ------------------------------------------------------------
NUOB_RHORT       ------------------------------------------------------------
NUOB_MAGSA       ------------------------------------------------------------
NUOB_RHOFT       ------------------------------------------------------------
NUOB_COXBR       A-----------------------------------------------------------
NUOB_AGRVS       ------------------------------------------------------------
NUOB_OCHA4       ------------------------------------------------------------
NUOB_RHILO       ------------------------------------------------------------
NUOB_BARBK       ------------------------------------------------------------
NUOB_METS4       ------------------------------------------------------------
NUOB_AZOC5       ------------------------------------------------------------
NUOB2_RHOPS      ------------------------------------------------------------
NUOB_OLICO       ------------------------------------------------------------
NUOB_METSB       ------------------------------------------------------------
NUOB2_RHIEC      ------------------------------------------------------------
NUOB_PARL1       ------------------------------------------------------------
NUOB_PELUB       ------------------------------------------------------------
NUOB_PHEZH       ------------------------------------------------------------
NUOB_CAUSK       ------------------------------------------------------------
NUOB_MARMM       ------------------------------------------------------------
NUOB_HYPNA       ------------------------------------------------------------
NUOB_SPHWW       ------------------------------------------------------------
NUOB_SPHAL       ------------------------------------------------------------
NUOB_ROSDO       ------------------------------------------------------------
NUOB_MAGMM       RKR-------------------------------V-------------------------
NUOB_LEGPC       ------------------------------------------------------------
NUOB_ANAMM       ------------------------------------------------------------
NUOB_ANAPZ       ------------------------------------------------------------
NUOB_WOLPM       ------------------------------------------------------------
NUOB_EHRRW       ------------------------------------------------------------
NUOB_NEOSM       ------------------------------------------------------------
NUOB2_BURMS      LFA-------------------------------RP------------------------
NUOB2_CHRVO      LLD-------------------------------RSPNRQPN------------------
NUOB2_AZOSB      VIA-------------------------------R-------------------------
NUOB_RICTY       R-----------------------------------------------------------
NUOB_ORITI       ------------------------------------------------------------
NUOB_DEHM1       ------------------------------------------------------------
NUOB1_SALAI      SRP-------------------------------D-------ALASPTGGAA-------P
NUOB1_SALTO      SRP-------------------------------D-------ALASPADALP-------P
NUOB2_STRCO      VSP-------------------------------R---PSTAALQSGLVRPPEPEPEPEP
NUOB2_STRGG      TGA-------------------------------TGGGPSTDALRSGLVAAP--------
NUOB2_ANADE      ------------------------------------------------------------
NUOB1_ANADF      ------------------------------------------------------------
NUOB2_SORC5      ------------------------------------------------------------
NUOB_PELLD       EAL-------------------------------KKLA----------------------
NUOB2_CHLT3      EAI-------------------------------ERLK----------------------
NUOB1_CYTH3      -AV-------------------------------ERFL----------------------
NUOB_AMOA5       ------------------------------------------------------------
NUOB_RUBXD       PRP-------------------------------ALVDEEGNIREYLPEREYRQISEGKA
NUOB_BACCN       TNK---------------------------------------------------------
NUOB_HYDS0       AFE-------------------------------EFKKDLSPE---LLNGVGV-------
NUOB_AQUAE       LFA-------------------------------DFNREIEKEGIFVPRELKV-------
NUOB_SULSY       ELI-------------------------------EIPIKVPQE----SKPISK-------
NUOB_BACTN       --------------------------------------KFFGGTNRKEKKPEFMK-----
NUOB_BACV8       --------------------------------------KFFGGVNRKENEPQNPEQA---
NUOB_AZOPC       --------------------------------------NFFKLPNLSHIEGNSLKKGERQ
NUOB_CARHZ       --------------------------------------RVVKR-----------------
NUOB_DESRM       --------------------------------------EVVKRGDER-------------
NUOB_CLOB8       --------------------------------------KEVGRSE---------------
NUOB_MOOTA       --------------------------------------KVALVK----------------
NUOB_HELMI       --------------------------------------AKVGLKHGK-------------
NUOB_DESHY       --------------------------------------DKVRLLKHGK------------
NUOB2_CHLAD      YGEGD---------------------KPQTTDFPVPTFGAKGLEIDG--KLIDPVGGLPL
NUOB1_ROSS1      YG------------------------KREAKEYPVPTFGKHGLEIDG--KLIDPVGGLPL
NUOB2_HERA2      YGD-D---------------------EGVVNEFPVPIFGAEGLEVPGIPGTADPVGGTPK
NUOB2_SYMTH      --------------------------------------GKRGLITKG-------------
NUOB_DESVM       --------------------------------------RWWPVPAEISGSMGGGA-----
NUOB2_OPITP      --------------------------------------RRFPVAQLKE------------
NUOB_ACIAD       ------------------------------------LERRPLSAVIGDD-----------
NUOB_PSYWF       ------------------------------------KERRPLGAYVND------------
NUOB_PSEMY       ------------------------------------QERRPLSWVVGD------------
NUOB_CHRSD       ------------------------------------EERRPLSWVVGD------------
NUOB_AERS4       ------------------------------------KERRPLSWVVGD------------
NUOB_SODGM       ------------------------------------KERRPLSWVVGD------------
NUOB_BAUCH       ------------------------------------KEQRPLSWIVGD------------
NUOB_BLOFL       ------------------------------------KERRPLSWVIDD------------
NUOB_BLOPB       ------------------------------------EERRPLSWVLGD------------
NUOB_BUCAI       ------------------------------------EERRPLSWVIGE------------
NUOB_BUCAP       ------------------------------------EERRPLSWVVGE------------
NUOB_BUCCC       ------------------------------------KERRPLSWIVGE------------
NUOB_BUCBP       ------------------------------------KERRPLSWIIGE------------
NUOB2_ACICJ      ------------------------------------SERRPLSWLVGP------------
NUOB1_GLUDA      ------------------------------------TQRRPLSWMVGP------------
NUOB_METCA       ------------------------------------KEARPLSWVIGP------------
NUOB1_NITMU      ------------------------------------KEKRPLSWVIGP------------
NUOB1_NITOC      ------------------------------------KEQRPLSWAIGP------------
NUOB_SHEWM       -----------------------------------PRQARPLNRTITP------------
NUOB2_RHOPB      ------------------------------------SEHRPLGVTVGN------------
NUOB1_RHOS5      ------------------------------------TEARPLQIRMGE------------
NUOB_METI4       -------------------------------------KEASLRRLKQ-------------
NUOB_AKKM8       -------------------------------------TQQPARTFFK-------------
NUOB1_OPITP      -------------------------------------TERAGQNLFK-------------
NUOB1_CHLT3      -------------------------------------RQKDSFQD---------------
NUOB_SALRD       -------------------------------------NEYSVVQDYEF------------
NUOB1_ANADE      ------------------------------------NQSHKLIDRK--------------
NUOB2_ANADF      ------------------------------------GQQHKLIDRK--------------
NUOB_MYXXD       ------------------------------------NQVHRIAEREE-------------
NUOB1_SORC5      -----------------------------------GDRTPAIVKPRE-------------
NUOB_PELPD       ------------------------------------GERHPIFPYEK-------------
NUOB_ARCB4       -------------------------------------TESIIKDRVK-------------
NUOB_CAMFF       -------------------------------------NES-IKDRHK-------------
NUOB_BDEBA       -------------------------------------TNQ-PRPWKD-------------
NUOB_FLAPJ       -------------------------------------SESVRRRSSP-------------
NUOB2_CYTH3      -------------------------------------TESLRRRESP-------------
NUOB_LEPBP       -------------------------------------SQGLEARRQE-------------
NUOB_LEPIN       -------------------------------------TQGLEARRQE-------------
NUOB1_KORVE      -----------------------------------------QAERGS-------------
NUOB2_SOLUE      -----------------------------------------KNQSGT-------------
NUOB_MYCA9       HMPLG----------------------------ANREEVIRETEAAA-------------
NUOB_NOCFA       HTPLG----------------------------VNRQEAVRAAEQAA-------------
NUOB1_STRGG      TSKLG----------------------------VNAEEAAREAEEAA-------------
NUOB_ACIC1       STKLG----------------------------VHAVREAHEREEAA-------------
NUOB_NOCSJ       HTKMG----------------------------AHRAAEIEELETAA-------------
NUOB_THEFY       NTKLG----------------------------VHREREIEELEQRR-------------
NUOB2_SALTO      HEPLG----------------------------PNGRKMAEARKARGDVPVVPYGSMPSS
NUOB_FRASN       HTKVGSAPYPKPIEVATAWSGLPAGAVDTRTLSVNDRKRFSLPEDAPVPAGRGAVEPVLD
NUOB_SACEN       ALRLESGARTELVPSSERYAP-----------KNRSQRKLAERQQAAQRRE---------
NUOB_CUTAK       HWPLM----------------------------GHMSEVEAAKEKKA-------------
NUOB1_SYMTH      -----------------------------------------RKEDPR-------------
NUOB1_CHLAD      --------------------------------------REKLSGKKE-------------
NUOB2_ROSS1      --------------------------------------RMRLDGELR-------------
NUOB1_HERA2      --------------------------------------RDKITDHADG------------
NUOB_PARUW       --------------------------------------YGDSSKKGK-------------
NUOB_DEIRA       --------------------------------------RGEAFDQLG-------------
NQO6_THET8       --------------------------------------RGQAYNERG-------------
NUOB2_KORVE      --------------------------------------HMT-LAKRP-------------
NUOB1_SOLUE      --------------------------------------TMTTLVKRP-------------
NUOB_THERP       --------------------------------------RYERLKER--------------
NUOB2_RHIME      --------------------------------------KSRALTGTP-------------
                                                                             

NDHK1_CYAP4      TGEYLAAPTRQAPPQQLAEALGLPLPALEAIEKEAVERN---------------------
NDHK_THEEB       TGQYLNAPSRQAPPPALAAAMGIAVPALGEAVSETTSVAE--------------------
NDHK1_ACAM1      TGVYLEAAARKSPAAALGAGVGEDMTPALVAEAEKEEA----------------------
NDHK_CROS5       TGKYLATPTRQAPPKELTEAIGMEVPPALA-SQKQKEEA---------------------
NDHK_MICAN       TGKYLQSATRQAPPKELLEATGMPVPPALL-TTKQKEEI---------------------
NDHK_SYNP2       TGKYLGMDTWNNPPKELTEAMGMPVPPALL-TAKQREEA---------------------
NDHK1_SYNY3      DGKYLQQGTRSAPPRELQEAMGMPVPPALT-TSQQKEQLNRG------------------
NDHK_GLOC7       TGQYLRAQTRQAPPLELSEAMGMPIPPALM-TTEQKEEVDRG------------------
NDHK_NOSP7       TGKYLQSDTRSAPPKELAEAIGMPIPPALLTEKAQKEEQTRG------------------
NDHK_TRIEI       TGQYLQTSDRKAVPKELAEAIGMPVSPAL--QAIPKEEVSLG------------------
NDHK_SYNP6       TGEYLRSAARQAGP--LPAAAGAAVAPQLPVTEKEGRDRA--------------------
NDHK1_GLOVI      SSKYLESPTRQAPPPGLAAAMEM--PLVLPEVVKQNEQV---------------------
NDHK2_GLOVI      TSEYIRLESRQAAPPALAAAIEMGIPLDLQRTPQLEEQIRDGEHRDARA-----------
NDHK_SYNJA       TGKYLESETRQAPPPELAAAIGLPVPPALQTADFKQAEQQLKALRGGM------------
NDHK2_SYNY3      TGQYLRHHEDLTPHHDPLLIK---------------------------------------
NDHK2_ACAM1      TGQYLQSHEVA-------------------------------------------------
NDHK2_CYAP4      TGKYLLSETRQQPPQALAEVMGMNIPAFQSPEQQELLLQSGQQRELISREVDEAYKSSSK
NDHK_PROMA       NGSYLNAKTQKAALKAGDDISLPTKSESIETTTKELN-----------------------
NDHK_PROM4       TGAYLNASTQKQALSPSQEIPLEDQNE----ATKEIAQ----------------------
NDHK_PROMT       NGQYLKAKTQLIALNPSLSEEFDQSLKEVQKISEELSSN---------------------
NDHK_PROMM       TGAYLSADTQKAALKPGAGLPMAAELNTPEIDVSPASQSSSTYES---------------
NDHK_SYNS9       TGAYLRAESQQAAL---AAAPAGQTLATDAAVLNPAPEMVQP------------------
NDHK_SYNPW       TGAYLRAETQVAALQPGAGLPMPALETADAVQPSEPS-----------------------
NDHK_SYNR3       DGRYLRAETQQKALAAAEAVSPLNLAPAEQPETIPAKS----------------------
NDHK_PAUCH       TGTYLRAKTQQNALQAGVALPVDFKAEALPTKVILSNSLSLDN-----------------
NDHK_PROMP       TGEYLNKKSE-KSIESSKLNPVEESSENIYETNSIDEVIK--------------------
NDHK_ANGEV       TGQYISDQSSIP---LLDLPL----ERTISEMRFDNKF-----------FMNEEELLPKG
NDHK_PSINU       TGQYTQQ--------LHDKSL----SK---------------------------------
NDHK_PHYPA       TGQYNKQLDTKISNSQFNSTL----DTFIPIKKNENLT-----------FLLKNEDNKEN
NDHK_MARPO       NPKLTSS--NQFFQSK----------KTSKVLLETSLT-----------FKEKENL----
NDHK_HUPLU       TGEYSKQSLRQFTKTELYSTLEVPFDETTDEYKGSAVS-----------FQESMDEGDPV
NDHK_ANTAG       TGKYDEHLFSKFSEISIEPKL-----NVSPQRIEKSKS-----------SISSQISF---
NDHK_DIOEL       TGNYDQGLFYQSS-----YTSEISSKRFFKSKNS-----VS--------SHELVN-----
NDHK_LEMMI       TGNYNKELLYQSP-----STSEITSEEFFRSKSS-----IS--------SHKLVN-----
NDHK_MAIZE       TGTYEQELLYQSP-----STLDISSETFFKSKSS-----VS--------SYKLVN-----
NDHK_LOTJA       TGNYDQVLFHQPP-----STSEISSDTFFRYQKVQ---YPP--------RNEIVN-----
NDHK_FAGEA       TGNYNQGLLSKSP-----SISEIPPEKFFKYRSSV---SS----------HEFVN-----
NDHK_PELHO       IGNSDKGFLYQPP-----ATSKLPAEKFFKYKSSA---PSP--------SHELVN-----
NDHK_PIPCE       IENYDQGLLSQSS-----STPEIASENFFKYKSLV---PN----------YDMN------
NDHK_CYCTA       TGNYDQKLLHKSPEPQSESTSEILSKTFESTSEIP---SDFVKYENSVSFQESRNEEYFV
NDHK_CRYJA       IENKEERFFHQSYESRFESTLEITPKTSEPISEIS---YPF---KNLKKIREVAGE----
NDHK_STAPU       TGTYDQQTLRRTPGIEMDTSLEYPLERILQNSIETSSPFQD--------SEEIGLLKDWK
NDHK_CHAGL       EQLKAKELISNRQ----------------ENLTISKKKIKE--------SEEIFLQF---
NDHK_ZYGCR       NGEYERNITRQVPSISLDSTLQSPFEQILQSSFESVSETTL--------IDSQRYDNQYL
NDHK_MESVI       TGKYLNSSARQTPPRSLSEATGVPVNLIFEMTKKNAIK----------------------
NDHK_CHLAT       TGKYLQSSERKSPPKELSEATGIPIQFILKNTQKTEIQP---------------------
NDHK_NEPOL       TGQYLQAETRQAPPRELATGLDTLVPRSLEANYIERF-----------------------
NDHK_CHAVU       NENSVNLLSQQLSNNDLFSFMKIPVDNCFTEE----------------------------
NDHK_ADICA       AGKYNWDRENCGTKLAPANFSENCQKFANEHDELKSAI----------------------
NUOB2_THEYD      ------------------------------------------------------------
NUOB1_THEYD      SCRDNKKD----------------------------------------------------
NUOB_GEOLS       ------------------------------------------------------------
NUOB_DESDA       ------------------------------------------------------------
NUOB_CAMC1       ------------------------------------------------------------
NUOB_NITSB       ------------------------------------------------------------
NUOB_SULNB       ------------------------------------------------------------
NUOB_SULDN       ------------------------------------------------------------
NUOB_WOLSU       ------------------------------------------------------------
NUOB_CAMHC       ------------------------------------------------------------
NUOB_HELPJ       ------------------------------------------------------------
NUOB_DECAR       ------------------------------------------------------------
NUOB_VESOH       ------------------------------------------------------------
NUOB_FRAP2       ------------------------------------------------------------
NUOB_XYLFA       ------------------------------------------------------------
NUOB_HALHL       ------------------------------------------------------------
NUOB_BORPD       ------------------------------------------------------------
NUOB_METPP       ------------------------------------------------------------
NUOB_ACIF2       ------------------------------------------------------------
NUOB_NEIG1       ------------------------------------------------------------
NUOB_GRABC       ------------------------------------------------------------
NUOB1_ACICJ      ------------------------------------------------------------
NUOB2_GLUDA      ------------------------------------------------------------
NUOB_RHOCS       ------------------------------------------------------------
NUOB_RHORT       ------------------------------------------------------------
NUOB_MAGSA       ------------------------------------------------------------
NUOB_RHOFT       ------------------------------------------------------------
NUOB_COXBR       ------------------------------------------------------------
NUOB_AGRVS       ------------------------------------------------------------
NUOB_OCHA4       ------------------------------------------------------------
NUOB_RHILO       ------------------------------------------------------------
NUOB_BARBK       ------------------------------------------------------------
NUOB_METS4       ------------------------------------------------------------
NUOB_AZOC5       ------------------------------------------------------------
NUOB2_RHOPS      ------------------------------------------------------------
NUOB_OLICO       ------------------------------------------------------------
NUOB_METSB       ------------------------------------------------------------
NUOB2_RHIEC      ------------------------------------------------------------
NUOB_PARL1       ------------------------------------------------------------
NUOB_PELUB       ------------------------------------------------------------
NUOB_PHEZH       ------------------------------------------------------------
NUOB_CAUSK       ------------------------------------------------------------
NUOB_MARMM       ------------------------------------------------------------
NUOB_HYPNA       ------------------------------------------------------------
NUOB_SPHWW       ------------------------------------------------------------
NUOB_SPHAL       ------------------------------------------------------------
NUOB_ROSDO       ------------------------------------------------------------
NUOB_MAGMM       ------------------------------------------------------------
NUOB_LEGPC       ------------------------------------------------------------
NUOB_ANAMM       ------------------------------------------------------------
NUOB_ANAPZ       ------------------------------------------------------------
NUOB_WOLPM       ------------------------------------------------------------
NUOB_EHRRW       ------------------------------------------------------------
NUOB_NEOSM       ------------------------------------------------------------
NUOB2_BURMS      ------------------------------------------------------------
NUOB2_CHRVO      ------------------------------------------------------------
NUOB2_AZOSB      ------------------------------------------------------------
NUOB_RICTY       ------------------------------------------------------------
NUOB_ORITI       ------------------------------------------------------------
NUOB_DEHM1       ------------------------------------------------------------
NUOB1_SALAI      RSADSLTAPLVRPPTPS-------------------------------------------
NUOB1_SALTO      RAADSLTAPPVRPPDPS-------------------------------------------
NUOB2_STRCO      EPEPEPGQGPGQGPGSGEGTDTGSDAGRGR------------------------------
NUOB2_STRGG      -TAPGPTAPASTAPGPTAPAPTQDEERR--------------------------------
NUOB2_ANADE      --------PAAQAEGA--------------------------------------------
NUOB1_ANADF      --------PAKGSAA---------------------------------------------
NUOB2_SORC5      --------GATGG-----------------------------------------------
NUOB_PELLD       -------ETGVEPRPFIERERSSAGA----------------------------------
NUOB2_CHLT3      -------PKKVKAEDVIVETSASAKKLQEAAS----------------------------
NUOB1_CYTH3      -------ETHAKEKNIA-------------------------------------------
NUOB_AMOA5       ------------------------------------------------------------
NUOB_RUBXD       HRPKGIKRLPRTYVFQRKGLPPGSMTDVGWIPPEARERLKAGRGAGASGSGEREEGKEGA
NUOB_BACCN       ------------------------------------------------------------
NUOB_HYDS0       ------------------------------------------------------------
NUOB_AQUAE       ------------------------------------------------------------
NUOB_SULSY       ------------------------------------------------------------
NUOB_BACTN       ------------------------------------------------------------
NUOB_BACV8       ------------------------------------------------------------
NUOB_AZOPC       ------------------------------------------------------------
NUOB_CARHZ       ------------------------------------------------------------
NUOB_DESRM       ------------------------------------------------------------
NUOB_CLOB8       ------------------------------------------------------------
NUOB_MOOTA       ------------------------------------------------------------
NUOB_HELMI       ------------------------------------------------------------
NUOB_DESHY       ------------------------------------------------------------
NUOB2_CHLAD      LSPYTSPSHGEHRSGQIEHPEVVRQFPIMDPEVELEHALKARGVSPEIAADDLKRG--EV
NUOB1_ROSS1      VSPYTSPTHGEMRSGMIEHPELVRHFPIMDETVERESPYKATGIAIEIAHNDLKRPAVEV
NUOB2_HERA2      MPPFVSPALG----GKGERDASIKALEGNQPKP----MLRAGTVTIEEVAHGIAG-----
NUOB2_SYMTH      ------------------------------------------------------------
NUOB_DESVM       ------------------------------------------------------------
NUOB2_OPITP      ------------------------------------------------------------
NUOB_ACIAD       -------------------------LQPVYKPKMMPERDRKNAERIAVKNLRSMDEIK--
NUOB_PSYWF       --------------------------KGIYQPQMLPERDRKQADRIAVKNLRSPDSI---
NUOB_PSEMY       --------------------------QGIYRAEMPSQKEQRREQRIAVTNLRSPDEV---
NUOB_CHRSD       --------------------------QGVYRADMPSQREANRDRRIAVTELRSPDEV---
NUOB_AERS4       --------------------------QGIYRPDMPAEKDRKRGERIKVTNLRTPDEI---
NUOB_SODGM       --------------------------QGVYRANMESERQRKHGERIAVTHLRTSDEI---
NUOB_BAUCH       --------------------------QGIYRANMESERKRKHNERAKMTYLRSPEEI---
NUOB_BLOFL       --------------------------QGVYKMNMKSERELKRKDRISAVEFSDTD-----
NUOB_BLOPB       --------------------------QGIYRKNMESERQRKRNTRIAETVLSSPDDELNI
NUOB_BUCAI       --------------------------QGVYHKKMPSERVQKRSKRINIINLSTSEKI---
NUOB_BUCAP       --------------------------QGIYRKKMLSEKIQNRKKRISVVNLPTSEKI---
NUOB_BUCCC       --------------------------QGVYKYNMLSEKEEKNKKRISIINIDSEDSF---
NUOB_BUCBP       --------------------------QGIYKANFNSEK--KNLRKMRNLVKYSQDKN---
NUOB2_ACICJ      -------------------------NG-AEKIERPSFRDLKHQERQAAGSLPTPDSV---
NUOB1_GLUDA      -------------------------QG-VERVTPPSLRDAKRDQRRAAQTLRSPDTI---
NUOB_METCA       -------------------------QG-IQKAPAPSRRDLKQAERNRATELHDPFSLD--
NUOB1_NITMU      -------------------------QG-IERPAEESQRDLKRSGRMCATTLRSPDEVQK-
NUOB1_NITOC      -------------------------QG-VERAPKPSLRDQRRAERQKATVFRSPDEV---
NUOB_SHEWM       -------------------------EE-IQAFACRNMRDEKHEQRIKADKLTPPDEV---
NUOB2_RHOPB      -------------------------SA-GLGFDAPRRRDQRRDERMAQTLLDPPEKL---
NUOB1_RHOS5      -------------------------TGPARPFDPVPRRDALREGRMSVARLADPEST---
NUOB_METI4       -------------------------------SAA--------------------------
NUOB_AKKM8       -------------------------------KEEPREANAPVPVNTEMPLE---------
NUOB1_OPITP      -------------------------------ATV--------------------------
NUOB1_CHLT3      --------------------------------SFLAEDDAPQVRQPESPK----------
NUOB_SALRD       -------------------------GKARERAPIMPENTNRFPGQLEKPKTSTLTLEAPD
NUOB1_ANADE      ------------------------------PLPVIAGGP-GR------------------
NUOB2_ANADF      ------------------------------PLPVVGQEPISR------------------
NUOB_MYXXD       ------------------------------ANPTAARHNLLLSMNK--------------
NUOB1_SORC5      ------------------------------DPAQTTEHLVTLQRKERSLP----------
NUOB_PELPD       ------------------------------QNPVPV------------------------
NUOB_ARCB4       ------------------------------EYKGFLDA----------------------
NUOB_CAMFF       ------------------------------DYKGLLDA----------------------
NUOB_BDEBA       ------------------------------NWKSPYEQA---------------------
NUOB_FLAPJ       ------------------------------EYQELLASYNIK------------------
NUOB2_CYTH3      ------------------------------EYKALLAKYEIEE-----------------
NUOB_LEPBP       ------------------------------VMRKIEEINERNKPLVVA------------
NUOB_LEPIN       ------------------------------VMQKIQELNERNKPLVVR------------
NUOB1_KORVE      ------------------------------FRRALNLEPVTP------------------
NUOB2_SOLUE      ------------------------------VKSVLNL-----------------------
NUOB_MYCA9       ----------------------------LAATPTIEMKGLLR------------------
NUOB_NOCFA       ----------------------------LAATPTIRMEGLLR------------------
NUOB1_STRGG      ----------------------------LKALPLIEMKGLLR------------------
NUOB_ACIC1       ----------------------------KHALPTHSMKGLLR------------------
NUOB_NOCSJ       ----------------------------LRALPTSEMKGQLR------------------
NUOB_THEFY       ----------------------------LRALPLIQQTEEATR-----------------
NUOB2_SALTO      YRSDKARRAEWTKAVREGREEQLRIENWMKAQPHLQQYEGLKK-----------------
NUOB_FRASN       ERRPAAIAPPSVFGRGK--------RVPVDAKPTDESRAGGPGPSTETLTDD--------
NUOB_SACEN       -------------------------MGAEKPLGALEERAELNAGR---------------
NUOB_CUTAK       ----------------------------LDAKTTLEQKGLMR------------------
NUOB1_SYMTH      --------------------------------GGIIVRG---------------------
NUOB1_CHLAD      --------------------------------APIRIDQPLVQVK---------------
NUOB2_ROSS1      --------------------------------EPVRLS----------------------
NUOB1_HERA2      --------------------------------KPIRIEQAERGALKPLG-----------
NUOB_PARUW       --------------------------------RHL-------------------------
NUOB_DEIRA       -----------------------------QQLPMVDAWTRELR-----------------
NQO6_THET8       -----------------------------ERLPPVAAWKRTRG-----------------
NUOB2_KORVE      ---------------------------TDVRLDETMLDEFRKSVRIAQAGSTVVIQPAAP
NUOB1_SOLUE      ---------------------------TEVRLDETMLEEFKQQIRIAQIQNPA-------
NUOB_THERP       ---------------------------YGPEAAEAYREEERQAARSALGPRS--------
NUOB2_RHIME      ---------------------------LGRVIAS--------------------------
                                                                             

NDHK1_CYAP4      ------------------
NDHK_THEEB       ------------------
NDHK1_ACAM1      ------------------
NDHK_CROS5       ------------------
NDHK_MICAN       ------------------
NDHK_SYNP2       ------------------
NDHK1_SYNY3      ------------------
NDHK_GLOC7       ------------------
NDHK_NOSP7       ------------------
NDHK_TRIEI       ------------------
NDHK_SYNP6       ------------------
NDHK1_GLOVI      ------------------
NDHK2_GLOVI      ------------------
NDHK_SYNJA       ------------------
NDHK2_SYNY3      ------------------
NDHK2_ACAM1      ------------------
NDHK2_CYAP4      MY----------------
NDHK_PROMA       ------------------
NDHK_PROM4       ------------------
NDHK_PROMT       ------------------
NDHK_PROMM       ------------------
NDHK_SYNS9       ------------------
NDHK_SYNPW       ------------------
NDHK_SYNR3       ------------------
NDHK_PAUCH       ------------------
NDHK_PROMP       ------------------
NDHK_ANGEV       RK----------------
NDHK_PSINU       ------------------
NDHK_PHYPA       IENKSKD-----------
NDHK_MARPO       ------------------
NDHK_HUPLU       AIDKP-------------
NDHK_ANTAG       ------------------
NDHK_DIOEL       ------------------
NDHK_LEMMI       ------------------
NDHK_MAIZE       ------------------
NDHK_LOTJA       ------------------
NDHK_FAGEA       ------------------
NDHK_PELHO       ------------------
NDHK_PIPCE       ------------------
NDHK_CYCTA       KSNEQEINFQKFHWKC--
NDHK_CRYJA       ------------------
NDHK_STAPU       QSNQKQEQNVKMMKEEEA
NDHK_CHAGL       ------------------
NDHK_ZYGCR       QGAEIETGGLE-------
NDHK_MESVI       ------------------
NDHK_CHLAT       ------------------
NDHK_NEPOL       ------------------
NDHK_CHAVU       ------------------
NDHK_ADICA       ------------------
NUOB2_THEYD      ------------------
NUOB1_THEYD      ------------------
NUOB_GEOLS       ------------------
NUOB_DESDA       ------------------
NUOB_CAMC1       ------------------
NUOB_NITSB       ------------------
NUOB_SULNB       ------------------
NUOB_SULDN       ------------------
NUOB_WOLSU       ------------------
NUOB_CAMHC       ------------------
NUOB_HELPJ       ------------------
NUOB_DECAR       ------------------
NUOB_VESOH       ------------------
NUOB_FRAP2       ------------------
NUOB_XYLFA       ------------------
NUOB_HALHL       ------------------
NUOB_BORPD       ------------------
NUOB_METPP       ------------------
NUOB_ACIF2       ------------------
NUOB_NEIG1       ------------------
NUOB_GRABC       ------------------
NUOB1_ACICJ      ------------------
NUOB2_GLUDA      ------------------
NUOB_RHOCS       ------------------
NUOB_RHORT       ------------------
NUOB_MAGSA       ------------------
NUOB_RHOFT       ------------------
NUOB_COXBR       ------------------
NUOB_AGRVS       ------------------
NUOB_OCHA4       ------------------
NUOB_RHILO       ------------------
NUOB_BARBK       ------------------
NUOB_METS4       ------------------
NUOB_AZOC5       ------------------
NUOB2_RHOPS      ------------------
NUOB_OLICO       ------------------
NUOB_METSB       ------------------
NUOB2_RHIEC      ------------------
NUOB_PARL1       ------------------
NUOB_PELUB       ------------------
NUOB_PHEZH       ------------------
NUOB_CAUSK       ------------------
NUOB_MARMM       ------------------
NUOB_HYPNA       ------------------
NUOB_SPHWW       ------------------
NUOB_SPHAL       ------------------
NUOB_ROSDO       ------------------
NUOB_MAGMM       ------------------
NUOB_LEGPC       ------------------
NUOB_ANAMM       ------------------
NUOB_ANAPZ       ------------------
NUOB_WOLPM       ------------------
NUOB_EHRRW       ------------------
NUOB_NEOSM       ------------------
NUOB2_BURMS      ------------------
NUOB2_CHRVO      ------------------
NUOB2_AZOSB      ------------------
NUOB_RICTY       ------------------
NUOB_ORITI       ------------------
NUOB_DEHM1       ------------------
NUOB1_SALAI      ------------------
NUOB1_SALTO      ------------------
NUOB2_STRCO      ------------------
NUOB2_STRGG      ------------------
NUOB2_ANADE      ------------------
NUOB1_ANADF      ------------------
NUOB2_SORC5      ------------------
NUOB_PELLD       ------------------
NUOB2_CHLT3      ------------------
NUOB1_CYTH3      ------------------
NUOB_AMOA5       ------------------
NUOB_RUBXD       ------------------
NUOB_BACCN       ------------------
NUOB_HYDS0       ------------------
NUOB_AQUAE       ------------------
NUOB_SULSY       ------------------
NUOB_BACTN       ------------------
NUOB_BACV8       ------------------
NUOB_AZOPC       ------------------
NUOB_CARHZ       ------------------
NUOB_DESRM       ------------------
NUOB_CLOB8       ------------------
NUOB_MOOTA       ------------------
NUOB_HELMI       ------------------
NUOB_DESHY       ------------------
NUOB2_CHLAD      SNA---------------
NUOB1_ROSS1      DHAEDERR----------
NUOB2_HERA2      ------------------
NUOB2_SYMTH      ------------------
NUOB_DESVM       ------------------
NUOB2_OPITP      ------------------
NUOB_ACIAD       ------------------
NUOB_PSYWF       ------------------
NUOB_PSEMY       ------------------
NUOB_CHRSD       ------------------
NUOB_AERS4       ------------------
NUOB_SODGM       ------------------
NUOB_BAUCH       ------------------
NUOB_BLOFL       ------------------
NUOB_BLOPB       YSKQNGEA----------
NUOB_BUCAI       ------------------
NUOB_BUCAP       ------------------
NUOB_BUCCC       ------------------
NUOB_BUCBP       ------------------
NUOB2_ACICJ      ------------------
NUOB1_GLUDA      ------------------
NUOB_METCA       ------------------
NUOB1_NITMU      ------------------
NUOB1_NITOC      ------------------
NUOB_SHEWM       ------------------
NUOB2_RHOPB      ------------------
NUOB1_RHOS5      ------------------
NUOB_METI4       ------------------
NUOB_AKKM8       ------------------
NUOB1_OPITP      ------------------
NUOB1_CHLT3      --EKEKLTVSE-------
NUOB_SALRD       ADDAEEASTPEPVAA---
NUOB1_ANADE      ------------------
NUOB2_ANADF      ------------------
NUOB_MYXXD       ------------------
NUOB1_SORC5      ------------------
NUOB_PELPD       ------------------
NUOB_ARCB4       ------------------
NUOB_CAMFF       ------------------
NUOB_BDEBA       ------------------
NUOB_FLAPJ       ------------------
NUOB2_CYTH3      ------------------
NUOB_LEPBP       ------------------
NUOB_LEPIN       ------------------
NUOB1_KORVE      ------------------
NUOB2_SOLUE      ------------------
NUOB_MYCA9       ------------------
NUOB_NOCFA       ------------------
NUOB1_STRGG      ------------------
NUOB_ACIC1       ------------------
NUOB_NOCSJ       ------------------
NUOB_THEFY       ------------------
NUOB2_SALTO      ------------------
NUOB_FRASN       ------------------
NUOB_SACEN       ------------------
NUOB_CUTAK       ------------------
NUOB1_SYMTH      ------------------
NUOB1_CHLAD      ------------------
NUOB2_ROSS1      ------------------
NUOB1_HERA2      ------------------
NUOB_PARUW       ------------------
NUOB_DEIRA       ------------------
NQO6_THET8       ------------------
NUOB2_KORVE      PVVPGLQTK---------
NUOB1_SOLUE      ------------------
NUOB_THERP       ------------------
NUOB2_RHIME      ------------------