CLUSTAL format seed alignment for MF_01357

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUOC_MYCBO       ----------MSPPNQDAQ--EGRPDSP-----TAEVVD--VRRGMFGVSGTGDTSGYGR
NUOC_MYCUA       ----------MSSPDQNPSDAAGQTGSS-----NEEVVD--VRRGMFGVKGSGDTSGYGR
NUOC_MYCPA       ----------MSSPDQDPREAIAQGD--------DEVID--VRRGMFGAAGTGDTSGYGR
NUOC_MYCSS       ------------MTEANGTTGGGAG--------DPEVID--VRRGMFGAKGSGDTSGYGR
NUOC_MYCVP       ------------------MTGDDEP--------DPEVIG--VRRGMFGAKGSGDTSGYGR
NUOC_MYCGI       -----------------MTEPTGDQ--------TPEIIG--VRRGMFGAKGSGDTSGYGR
NUOC_MYCS2       --------MSTSNGSANGTNGVGLPRGD-----EPEIIA--VRRGMFGNRDTGDTSGYGR
NUOC_NOCFA       MSPDTPRGGDLHPPEPDAAATAGPEGTPPDTEPAAEVIG--VRHGMFGIRGTGDTSGYGR
NUOC_RHOJR       MSDE----GRPHDQAPAQASKASR---------VTEQIG--VRKGLFGVRGSGDTSGYGR
NUOC_MYCA9       -----------------MTGGEQKP---------NEIIG--VRRGLFGVRGSGDTSGYGG
NUOC_STRCO       MSDANNTAGDANEVNPEKDLSAENLPGQRGQ--GGEEIR--VQRGMFGANNGGDTSGYGG
NUOC_ACIC1       -MTE-----------PVLRGLPSSP-----------------------------------
NUOC_NOCSJ       -MSDDSSDVKPGPKGPEQPAVEQSPENVPAPTGEVHQVG--ARHGMFGVRGTGDTSGYGG
NUOC_SALAI       MNAPQDRTDDGGVPVPVTPAGATGGAPAE----LPPSSP--AGRGMFGDQGTGDVSGYGG
NUOC_SACEN       -----MTENQTTPDPGEPGSSADRPGGLVPTGDSAEFVAGRSRKGMFGVRGTGDTSGYGG
NUOC_CHLPD       ------------------------------------------------------------
NUOC_CHLT3       ---------------------MSEEEKPKPKLSPALAAKMAAMKKKQEGGEEAAASQEGG
NDHJ_PROMS       ------------------------------------------------MEKDSQAT----
NDHJ_PROM2       ------------------------------------------------MEKEGLAK----
NDHJ_PROM5       ------------------------------------------------MDQNNLSK----
NDHJ_PROMP       ------------------------------------------------MENNSSPE----
NDHJ_SYNS3       ------------------------------------------------MSPNSSEK----
NDHJ_SYNPW       ------------------------------------------------MSPTP-DK----
NDHJ_SYNSC       ------------------------------------------------MSETPSKQ----
NDHJ_SYNPX       ------------------------------------------------MSETSKIP----
NDHJ_SYNS9       ------------------------------------------------MSDSAPTNPTPT
NDHJ_PROMM       ------------------------------------------------MSETPSTP----
NDHJ_PROMT       ---------------------------------------------------MTNDS----
NDHJ_PROM4       ------------------------------------------------MNEETQTS----
NDHJ_SYNR3       ------------------------------------------------MSETPTSP----
NDHJ_PAUCH       ------------------------------------------------MIEPSIIPV---
NDHJ_NOSS1       ----------------------------------------------------MADEEL--
NDHJ_TRIV2       ----------------------------------------------------MADEEL--
NDHJ_NOSP7       ----------------------------------------------------MAEEES--
NDHJ_CROS5       -------------------------------------------------MVDENTQDN--
NDHJ_MICAN       ------------------------------------------------------------
NDHJ_SYNP2       -----------------------------------------------------MAEEN--
NDHJ_SYNY3       -------------------------------------------------MAEEVNSPN--
NDHJ_SYNP6       --------------------------------------------------------MP--
NDHJ_SYNJB       -------------------------------------------------MAEENAQEKQA
NDHJ_SYNJA       -------------------------------------------------MTEDKAQQK--
NDHJ_TRIEI       ------------------------------------------------------------
NDHJ_ACAM1       ----------------------------------------------MADSSSESTQDE--
NDHJ_THEEB       ------------------------------------------------------------
NDHJ_GLOVI       ----------------------------------------------------MEEQTT--
NDHJ_LACSA       ------------------------------------------------------------
NDHJ_TRACE       ------------------------------------------------------------
NDHJ_DAUCA       ------------------------------------------------------------
NDHJ_FAGEA       ------------------------------------------------------------
NDHJ_PANGI       ------------------------------------------------------------
NDHJ_CITSI       ------------------------------------------------------------
NDHJ_DRANE       ------------------------------------------------------------
NDHJ_IPOPU       ------------------------------------------------------------
NDHJ_OENPA       ------------------------------------------------------------
NDHJ_CUCSA       ------------------------------------------------------------
NDHJ_POPTR       ------------------------------------------------------------
NDHJ_CICAR       ------------------------------------------------------------
NDHJ_MANES       ------------------------------------------------------------
NDHJ_SOYBN       ------------------------------------------------------------
NDHJ_PHAVU       ------------------------------------------------------------
NDHJ_LOTJA       ------------------------------------------------------------
NDHJ_LUPLU       ------------------------------------------------------------
NDHJ_PELHO       ------------------------------------------------------------
NDHJ_MORIN       ------------------------------------------------------------
NDHJ_BUXMI       ------------------------------------------------------------
NDHJ_ACOCL       ------------------------------------------------------------
NDHJ_CALFG       ------------------------------------------------------------
NDHJ_NYMAL       ------------------------------------------------------------
NDHJ_CERDE       ------------------------------------------------------------
NDHJ_LIRTU       ------------------------------------------------------------
NDHJ_AMBTC       ------------------------------------------------------------
NDHJ_DIOEL       ------------------------------------------------------------
NDHJ_LEMMI       ------------------------------------------------------------
NDHJ_ORYSJ       ------------------------------------------------------------
NDHJ_PIPCE       ------------------------------------------------------------
NDHJ_CRYJA       ------------------------------------------------------------
NDHJ_CYCTA       -----------------------------------------------------------M
NDHJ_ANGEV       ------------------------------------------------------------
NDHJ_PSINU       ------------------------------------------------------------
NDHJ_ANTAG       ------------------------------------------------------------
NDHJ_MARPO       ------------------------------------------------------------
NDHJ_PHYPA       ------------------------------------------------------------
NDHJ_STAPU       ------------------------------------------------------------
NDHJ_ZYGCR       ------------------------------------------------------------
NDHJ_CHAGL       ------------------------------------------------------------
NDHJ_ADICA       ------------------------------------------------------------
NDHJ_MESVI       -------------------------------------MAQLE------------------
NDHJ_CHLAT       -------------------------------------MKNNEKVSDSFLTSSGKELSEAT
NUOC_ROSDO       ------------------------------------------------------------
NUOC_RUEPO       ------------------------------------------------------------
NUOC_RUEST       ------------------------------------------------------------
NUOC_DINSH       ----------------------------------------------------------MR
NUOC_RHOS1       ------------------------------------------------------------
NUOC_RHOCA       ------------------------------------------------------------
NQO5_PARDE       ------------------------------------------------------------
NUOC_MARMM       ------------------------------------------------------------
NUOC_PARL1       ------------------------------------------------------------
NUOC_RHORT       ------------------------------------------------------------
NUOC_MAGSA       ------------------------------------------------------------
NUOC_HYPNA       ------------------------------------------------------------
NUOC1_RHIME      ------------------------------------------------------------
NUOC_SINMW       ------------------------------------------------------------
NUOC_RHIL3       ------------------------------------------------------------
NUOC_AGRFC       ------------------------------------------------------------
NUOC_AZOC5       ------------------------------------------------------------
NUOC_XANP2       ------------------------------------------------------------
NUOC_BRUSI       ------------------------------------------------------------
NUOC_OCHA4       ------------------------------------------------------------
NUOC_RHILO       ------------------------------------------------------------
NUOC_CHESB       ------------------------------------------------------------
NUOC_METEP       ------------------------------------------------MEAITTNGITLR
NUOC_METPB       ------------------------------------------------MEAITTNGITLR
NUOC_METRJ       ----------------------------------------------------MTNGISIL
NUOC_METS4       ----------------------------------------------------MTNGITIL
NUOC_BARHE       ------------------------------------------------------------
NUOC_BARQU       ------------------------------------------------------------
NUOC_BART1       ------------------------------------------------------------
NUOC_BARBK       ------------------------------------------------------------
NUOC_RHOPT       ------------------------------------------------------------
NUOC_RHOPB       ------------------------------------------------------------
NUOC_CAUVC       ------------------------------------------------------------
NUOC_CAUSK       ---------------------------------------------------------MTD
NUOC_PHEZH       ------------------------------------------------------------
NUOC_ERYLH       -----------------------------------------------------------M
NUOC_NOVAD       -----------------------------------------------------------M
NUOC_WOLTR       ------------------------------------------------------------
NUOC_NEOSM       ------------------------------------------------------------
NUOC_RICBR       ------------------------------------------------------------
NUOC_RICFE       ------------------------------------------------------------
NUOC_RICPR       ------------------------------------------------------------
NUOC_RICTY       ------------------------------------------------------------
NUOC2_RHIME      ------------------------------------------------------------
NUOC2_RHIE6      ------------------------------------------------------------
NUOC_ROSCS       ------------------------------------------------------------
NUOC_ROSS1       ------------------------------------------------------------
NUOC_HERA2       ------------------------------------------------------------
NUOC_NEIM0       ------------------------------------------------------------
NUOC_NEIG2       ------------------------------------------------------------
NUOC_AZOSB       ------------------------------------------------------------
NUOC_AROAE       ------------------------------------------------------------
NUOC_DECAR       ------------------------------------------------------------
NUOC_BURA4       ------------------------------------------------------------
NUOC_BURVG       ------------------------------------------------------------
NUOC_BURL3       ------------------------------------------------------------
NUOC_BURM1       ------------------------------------------------------------
NUOC_BURTA       ------------------------------------------------------------
NUOC_PARXL       ------------------------------------------------------------
NUOC_PARP8       ------------------------------------------------------------
NUOC_RALPJ       ------------------------------------------------------------
NUOC_RALSO       ------------------------------------------------------------
NUOC_CUPTR       ------------------------------------------------------------
NUOC_CUPNH       ------------------------------------------------------------
NUOC_CUPPJ       ------------------------------------------------------------
NUOC_CUPMC       ------------------------------------------------------------
NUOC_POLNS       ------------------------------------------------------------
NUOC_POLAQ       ------------------------------------------------------------
NUOC_HERAR       ------------------------------------------------------------
NUOC_JANMA       ------------------------------------------------------------
NUOC_THIDA       ------------------------------------------------------------
NUOC_CHRVO       ------------------------------------------------------------
NUOC_ACIAC       ------------------------------------------------------------
NUOC_ACISJ       ------------------------------------------------------------
NUOC_DELAS       ------------------------------------------------------------
NUOC_VEREI       ------------------------------------------------------------
NUOC_RHOFT       ------------------------------------------------------------
NUOC_POLNA       ------------------------------------------------------------
NUOC_POLSJ       ------------------------------------------------------------
NUOC_LEPCP       ------------------------------------------------------------
NUOC_METPP       ------------------------------------------------------------
NUOC_NITEU       ------------------------------------------------------------
NUOC_NITEC       ------------------------------------------------------------
NUOC_NITMU       ------------------------------------------------------------
NUOC_BORPA       ----------------------------------------------------------MS
NUOC_BORA1       ------------------------------------------------------------
NUOC_BORPD       ------------------------------------------------------------
NUOC_ALKEH       ------------------------------------------------------------
NUOC_HALHL       ------------------------------------------------------------
NUOC_METFK       ------------------------------------------------------------
NUOC_ACIF5       ------------------------------------------------------------
NUOC_HYDCU       ------------------------------------------------------------
NUOC_LEGPA       ------------------------------------------------------------
NUOC_NITOC       ------------------------------------------------------------
NUOC_COXBR       ------------------------------------------------------------
NUOC_XANOP       ------------------------------------------------------------
NUOC_XANCB       ------------------------------------------------------------
NUOC_STRM5       ------------------------------------------------------------
NUOC_XYLFA       ------------------------------------------------------------
NUOC_RUTMC       ------------------------------------------------------------
NUOC_VESOH       ------------------------------------------------------------
NUOC_FRATW       ------------------------------------------------------------
NUOC_FRAP2       ------------------------------------------------------------
NUOC_GEOMG       ------------------------------------------------------------
NUOC_GEOSL       ------------------------------------------------------------
NUOC_GEOUR       ------------------------------------------------------------
NUOC_GEOBB       ------------------------------------------------------------
NUOC_GEOLS       ------------------------------------------------------------
NUOC_MOOTA       ------------------------------------------------------------
NUOC_DEIGD       ------------------------------------------------------------
NUOC_DEIRA       ----------------------------------------------------------MT
NQO5_THET8       ------------------------------------------------------------
                                                                             

NUOC_MYCBO       LVRQVVLPGSSPRPYGGYF-----------------------------DDIVDRLAEALR
NUOC_MYCUA       LVREIVLPGSSPRPYGFYF-----------------------------DEIADRLAEALN
NUOC_MYCPA       LVRTVTLPGSSPRPYGSYF-----------------------------DDVVDTLTESLQ
NUOC_MYCSS       LIRSVALPGGSPRPYGGHF-----------------------------DEVVDALAAALG
NUOC_MYCVP       LIRSVALPGSSPRPYGGYF-----------------------------DDVVDALESALG
NUOC_MYCGI       LVRPVALPGGSPRPYGGYF-----------------------------DEVVDRLAEAVG
NUOC_MYCS2       LVRPVALPGSTPRPYGGYF-----------------------------DAVMDRLAEVLG
NUOC_NOCFA       LVRPVTLPGGTAPPYGGWF-----------------------------DEVVDRLRTALE
NUOC_RHOJR       LVRPVLLPGSTPRPFGGYF-----------------------------DDVADGLGAALA
NUOC_MYCA9       LVQPISLPVSSNRPYGGYF-----------------------------DQVVDRLESVLA
NUOC_STRCO       LVRSVRLPGPASRPYGGWF-----------------------------DEVADELEGALE
NUOC_ACIC1       ------------RPFGGYF-----------------------------DQVADTLAVAY-
NUOC_NOCSJ       LNQAIVLPGDAQRPYGGWF-----------------------------DEVADGLAAATR
NUOC_SALAI       LVRPQRSIEAASRPYGGYF-----------------------------DEVADALEEAYP
NUOC_SACEN       LRLPAYVPAPAERPYGGWF-----------------------------DEVADGLFLALR
NUOC_CHLPD       ------MTQQVKQALAA------------------------------YDVVREKFGDAVS
NUOC_CHLT3       EKPKAKLSPMMAARMAAKKSGDASPAPDKPKAEPVDENRDPEPHEMAYRVIKEKFGDAVS
NDHJ_PROMS       -------SSDTSIEKEGVI-----------------------------SQSLSKDGIPNQ
NDHJ_PROM2       -------SSDTSIKKEGFI-----------------------------SQSLSKDGIPNQ
NDHJ_PROM5       -------SSEEIVEQRGIV-----------------------------SNRLYKDGITNN
NDHJ_PROMP       -------SSEEIVKQNGIV-----------------------------SNQLSQDGITNE
NDHJ_SYNS3       --QSSADVPVAASPQPGPV-----------------------------SQWLNQQGFDHD
NDHJ_SYNPW       --QANADAPVAVAPAPGPV-----------------------------SQWLSQQGFEHE
NDHJ_SYNSC       -TAASDETGAVVAPEPGPV-----------------------------SQWLNKQGFDHN
NDHJ_SYNPX       -PASTEDTSAVVAPAAGPV-----------------------------SQWLQQQGFEHQ
NDHJ_SYNS9       NPAPEESASAVATLEPGPV-----------------------------SQWLNTQGFDHD
NDHJ_PROMM       --------PVPAGPEPGPV-----------------------------SRWLNQQGFEHQ
NDHJ_PROMT       ---EIVVEEK----ISGPI-----------------------------SDWLSNNGFENI
NDHJ_PROM4       ---ELTNTDQGPQIEPGPI-----------------------------SKWLNQKGLIHK
NDHJ_SYNR3       ------NQDLPEAPQAGPL-----------------------------SQWLTSQGFDHQ
NDHJ_PAUCH       --LVENTEEKTFKFQPGQV-----------------------------SQWLTGQGLQHQ
NDHJ_NOSS1       --QPVPAA-EAAIVPSGPT-----------------------------SQWLTENGFAHE
NDHJ_TRIV2       --KPVPAA-AEAIVPSGPT-----------------------------SQWLTENGFAHE
NDHJ_NOSP7       --KPVPAEKEESLVQAGKV-----------------------------SQWLTENGFDHE
NDHJ_CROS5       --APEQEE-EAAIVQAGPV-----------------------------SSWLTENGFDHD
NDHJ_MICAN       ----MTEE-TTAIVQAGPT-----------------------------SIWLSENGFEHQ
NDHJ_SYNP2       --QNPTPE-EAAIVEAGAV-----------------------------SQLLTENGFSHE
NDHJ_SYNY3       --EAVNLQEETAIAPVGPV-----------------------------STWLTTNGFEHQ
NDHJ_SYNP6       --EELTPTPETAVVEAGPV-----------------------------SRWLSENGFENT
NDHJ_SYNJB       PPSAGEQSEPLVTLERGPV-----------------------------SQFLADNGFEHQ
NDHJ_SYNJA       PSSTAEPTEPLATLERGPV-----------------------------SQFLADNGFDHQ
NDHJ_TRIEI       -----MAESEAPIIEAGKV-----------------------------SKWLTDNGFDHE
NDHJ_ACAM1       --QSVAEEQAAPIIEAGPV-----------------------------AKHLTQAGFTVE
NDHJ_THEEB       ----MSDTPEAPIVEAGPV-----------------------------GRLLQSQNLSVE
NDHJ_GLOVI       --QSAADGQTAIELVTGPI-----------------------------SDALKARGLPHE
NDHJ_LACSA       --------------MQGHL-----------------------------SAWLVKHGLIHR
NDHJ_TRACE       --------------MQGYL-----------------------------SAWLVKHGLIHR
NDHJ_DAUCA       --------------MQGRL-----------------------------SAWLVKHGLIHR
NDHJ_FAGEA       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_PANGI       --------------MQGRL-----------------------------SAWLVKHGLIHR
NDHJ_CITSI       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_DRANE       --------------MQGTL-----------------------------SVWLAKRGLIHR
NDHJ_IPOPU       --------------MQSFL-----------------------------SVWLVKHGIIHR
NDHJ_OENPA       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_CUCSA       --------------MQGNL-----------------------------SSWLVKHGLVHR
NDHJ_POPTR       --------------MRGPL-----------------------------SAWLVKHGLVHR
NDHJ_CICAR       --------------MQGNL-----------------------------SAWLVKHGIVHR
NDHJ_MANES       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_SOYBN       --------------MQGRL-----------------------------SSWLVKHGLIHR
NDHJ_PHAVU       --------------MQGRL-----------------------------SSWLVKHGLIHR
NDHJ_LOTJA       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_LUPLU       --------------MQGRL-----------------------------SAWLVKHGLIHR
NDHJ_PELHO       --------------MQGPL-----------------------------SAWLVKRRLVHR
NDHJ_MORIN       --------------MQGRL-----------------------------SVWLIKHGLVHR
NDHJ_BUXMI       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_ACOCL       --------------MQGRL-----------------------------SAWLVKHELVHR
NDHJ_CALFG       --------------MQGRL-----------------------------SAWLVKHGLVHR
NDHJ_NYMAL       --------------MQGRS-----------------------------SAWLVKHELVHR
NDHJ_CERDE       --------------MQGRS-----------------------------SAWLVKHELVHR
NDHJ_LIRTU       --------------MQGRS-----------------------------SAWLVKHELVHR
NDHJ_AMBTC       --------------MQGRL-----------------------------SAWLVKHELVHR
NDHJ_DIOEL       --------------MQSRL-----------------------------SDWLVKHELVHR
NDHJ_LEMMI       --------------MQSHL-----------------------------SAWLVKHELVHR
NDHJ_ORYSJ       -------------MQQGWL-----------------------------SNWLVKHEVVHR
NDHJ_PIPCE       --------------MQGRL-----------------------------SAWLVKHELVHR
NDHJ_CRYJA       --------------MQGRL-----------------------------SAWLAKHKLAHR
NDHJ_CYCTA       LNTYTDTPTRKTNEVQGRL-----------------------------SAWLAKHKLAHR
NDHJ_ANGEV       --------------MQGRL-----------------------------SAWLAKHQLAHR
NDHJ_PSINU       --------------MQGRV-----------------------------SVWLSQHKLAHR
NDHJ_ANTAG       ---MLETFTNDTNEIQGRL-----------------------------SAWLIKHRLAHR
NDHJ_MARPO       ---MLNILKNNNNKIQGRL-----------------------------SIWLIKHNLKHR
NDHJ_PHYPA       ---MLNTYTNSSTKIQGRL-----------------------------SVWLANHKLPHR
NDHJ_STAPU       ---MTDNFLSNSSQKQGRL-----------------------------SAWLTIHRLSHR
NDHJ_ZYGCR       ---MTNLAFQSSSQIQGRL-----------------------------SAWLVTHKLPHR
NDHJ_CHAGL       ---MLDL-FNKTSQVQGRI-----------------------------SAWLASNNLPHR
NDHJ_ADICA       --MNTVDKEKFNLKTRGRL-----------------------------SAWLTKHNFSHR
NDHJ_MESVI       ---NNSTLLVRENELKGLV-----------------------------SNWLIEMKLMHR
NDHJ_CHLAT       PSASSYTTVVRDKNIKGVV-----------------------------SNWLAEMKLRHK
NUOC_ROSDO       -------MSEPLQELGNYI-----------------------------ATKRADCVLAWD
NUOC_RUEPO       -------MSDALRELGTHL-----------------------------ELKRADCILSWD
NUOC_RUEST       -------MIEALQDLGHQI-----------------------------EAKRPECVLSWD
NUOC_DINSH       GRAGETTMTAALQELAAHI-----------------------------EMKRPDCVISTE
NUOC_RHOS1       -------MPEALQELAAHV-----------------------------RMRQPDAILGHR
NUOC_RHOCA       -------MSEKLQDLAAHV-----------------------------AQQRPGDVISAE
NQO5_PARDE       --MSEALSDEALLELAEHI-----------------------------AVRRENDVISTQ
NUOC_MARMM       -------MSEALKVLGEHI-----------------------------ANAQDAAVTGWS
NUOC_PARL1       -------MDESLAELGEHI-----------------------------LGTLEESVLGFH
NUOC_RHORT       MTSVFEERVESLKELGARI-----------------------------EAALPTDVVRVE
NUOC_MAGSA       -------MTQALKDLGEYI-----------------------------AQALPQDVLGTE
NUOC_HYPNA       ------MDTQALSDLAAHI-----------------------------EGRMPDAVRSWQ
NUOC1_RHIME      -------MSEALNELASYL-----------------------------REARGALIADAE
NUOC_SINMW       -------MSEALNELASYI-----------------------------REARGALVAGSE
NUOC_RHIL3       -------MSEALTELASYL-----------------------------GEARGNLIAASQ
NUOC_AGRFC       -------MSEALNDLAAYV-----------------------------KEARGSLVVSAD
NUOC_AZOC5       -------MDETLKDLAAHV-----------------------------TGALPGAVVAHK
NUOC_XANP2       -------MDETLNDLAAHV-----------------------------SAALSGAVLGSL
NUOC_BRUSI       ------MSEEALGELSGYI-----------------------------RERLGDAIEEAN
NUOC_OCHA4       ------MSEEALGELSGYI-----------------------------KERLGDAIEEAK
NUOC_RHILO       -------MAASLSELSTYL-----------------------------GERLIGRVNDAD
NUOC_CHESB       -------MNEALRDLAGYI-----------------------------KEKLDGRVQDWM
NUOC_METEP       RTVAAVQGEDALRAMGERI-----------------------------AGALGPAVTEWA
NUOC_METPB       RTVAAAQGDDALRAMGERI-----------------------------TGALGPAVTDWS
NUOC_METRJ       PHTQPVYGDAAVAAMAERV-----------------------------VGALGPAVVSHA
NUOC_METS4       PHTETEHGTGALQALSDRL-----------------------------AETLGGAVVERA
NUOC_BARHE       -------MSESLEELAAYL-----------------------------KSKLGDKLEETV
NUOC_BARQU       -------MNESLVELSAYL-----------------------------KNKLGDKLEETI
NUOC_BART1       ------MMDESLVELATYL-----------------------------KNKLGNKLEETV
NUOC_BARBK       ------MATETLVELAAYL-----------------------------KEKLGDKLEESA
NUOC_RHOPT       ------MDDNGLDTLGQTI-----------------------------VGALPGIATGHS
NUOC_RHOPB       ------MTD--LAELGETI-----------------------------KAALPAAVSNAS
NUOC_CAUVC       -------MSEALELLGQDI-----------------------------VARAPGVL-GHS
NUOC_CAUSK       VVSTEAPALSPLEALGQAI-----------------------------VANSAGAITAWS
NUOC_PHEZH       --MSWPATHDELEALGREL-----------------------------VAGGLGPFGGYE
NUOC_ERYLH       AVVHSAPKYASNDGVRGTL-----------------------------VKALGDYVAASH
NUOC_NOVAD       TVLHSAPRWSSNEGVLDTL-----------------------------VAALGDMVAASR
NUOC_WOLTR       -----------MDKTAKYI-----------------------------QKKTKCEFIQQG
NUOC_NEOSM       -------MTIDTTEVDALI-----------------------------NAP---------
NUOC_RICBR       ---------MTLEKIIEKL-----------------------------AAKSSILISPIT
NUOC_RICFE       ---------MTLDKLIEKL-----------------------------AAKSSILITPII
NUOC_RICPR       ---------MTLDKLIEKL-----------------------------AAKFRIVITKVA
NUOC_RICTY       ---------MTLDELIDKL-----------------------------AAKSRILITKVT
NUOC2_RHIME      -------MTGERPVHLTAI-----------------------------IGSFGGAVENLG
NUOC2_RHIE6      -------MSVEPSLNRAPI-----------------------------MERFGDTIEDLG
NUOC_ROSCS       -------MALDNPTVLARL-----------------------------QAALPDALLGSS
NUOC_ROSS1       -------MALDNATVLERL-----------------------------RAALPDAILGSA
NUOC_HERA2       --------MIDRATLEQRV-----------------------------SAQFPTVRIGDE
NUOC_NEIM0       --------MASIQNLYETV-----------------------------VGVLGDQASKVI
NUOC_NEIG2       --------MASIQNLYETV-----------------------------VGVLGDQAGKVI
NUOC_AZOSB       -------MSAKLERLSQTL-----------------------------RDVLGDVVESLV
NUOC_AROAE       -------MSSKLERLSSSL-----------------------------QNILGAKVRSVV
NUOC_DECAR       -------MSAKLETLSQNL-----------------------------QEHFGDKLKSLK
NUOC_BURA4       -------MASKIEILKANL-----------------------------EAALGARVVSLT
NUOC_BURVG       -------MASKIETLKANL-----------------------------EAALGARVVSLT
NUOC_BURL3       -------MASKIETLKANL-----------------------------EAALGARVVSLT
NUOC_BURM1       -------MASKIETLKANL-----------------------------EAALGARVVSLT
NUOC_BURTA       -------MASKIETLKANL-----------------------------EAALGARAVSLV
NUOC_PARXL       -------MASKLETLKANL-----------------------------EAAFGGLLQSTT
NUOC_PARP8       -------MASKLETLKANL-----------------------------EAAFGGRLTSIT
NUOC_RALPJ       -------MTDKLATLKAAL-----------------------------EKALGNRVQSLT
NUOC_RALSO       -------MTDKLATLQSAL-----------------------------EKALGNRIQSLT
NUOC_CUPTR       --------MAKLDTLKAAL-----------------------------EKALGKRVQNLV
NUOC_CUPNH       --------MAKLDILKAAL-----------------------------EKALGKRVQNLI
NUOC_CUPPJ       --------MAKLETLKAAL-----------------------------EKVLGKRVQKLI
NUOC_CUPMC       --------MANLDTLKAAL-----------------------------EKVLGKRVQNLI
NUOC_POLNS       -------MSERLIQLAANL-----------------------------KKVLGKRIQSVE
NUOC_POLAQ       -------MSDRLVHLAANL-----------------------------EKVLGKRVQSIE
NUOC_HERAR       -------MTIKLELLESAL-----------------------------RNALGDQLQSLT
NUOC_JANMA       -------MTIKLELLEAAL-----------------------------RNALGDQLQSLT
NUOC_THIDA       -------MSITLESLSACL-----------------------------KNALGDALVQTI
NUOC_CHRVO       ------MASKKMEALGSVV-----------------------------AEALGDKLVRST
NUOC_ACIAC       ----MTAIAIRPEALRDAV-----------------------------AAALGDKVRDIV
NUOC_ACISJ       ----MTAIAIHPESLRDVV-----------------------------ASALGDRVRQIS
NUOC_DELAS       ---MMTAIAIHPEVLRDVV-----------------------------AAALGDKARSVT
NUOC_VEREI       ---MMTAVAIRPERLRDHI-----------------------------AAALGARLRQIT
NUOC_RHOFT       ----MTSYAVNPQSIKVHV-----------------------------EAALGDLLISSV
NUOC_POLNA       --MEFSHPPVSVSQLGETI-----------------------------ALVLGGKAKSVK
NUOC_POLSJ       ---MLSSFPVSATQLGDTI-----------------------------AAVLGDKVKSLK
NUOC_LEPCP       -------MTQKLDTLQAAI-----------------------------ERVIGDRIVHLV
NUOC_METPP       -------MDHKIDLLQPAL-----------------------------EAALAGKIQALV
NUOC_NITEU       ------MTNSRLEKLAADL-----------------------------QRILGDRQIDIS
NUOC_NITEC       ------MTDSRVDKLATNL-----------------------------QQVLSDQQVDMS
NUOC_NITMU       ------MSSTRLETLALCL-----------------------------QNVLADKLANVD
NUOC_BORPA       RFTYAYMMMTRLETLKNNL-----------------------------QAAFGQD-LALT
NUOC_BORA1       -------MMTRLETLKNNL-----------------------------QATLGQD-IALT
NUOC_BORPD       ------MTMTRLETLKHNL-----------------------------QAALGAD-IALT
NUOC_ALKEH       -------MAKKLEQLQTAV-----------------------------QERLGERLRDCV
NUOC_HALHL       -------MAEP-ESLLEQL-----------------------------RGHFGGRLTDCW
NUOC_METFK       --------MTRLEQLKQHL-----------------------------QDVFGNSITR--
NUOC_ACIF5       -------MTDALENLRQHL-----------------------------SDELGATLRTAH
NUOC_HYDCU       -------MKQSVLDLQATI-----------------------------QETLGDAIVVSD
NUOC_LEGPA       --------MTKNEYLIEKL-----------------------------QANLANHITELT
NUOC_NITOC       -------MANSVAELRRRI-----------------------------EGRFDGEIGFCR
NUOC_COXBR       --------MAEKQTLIDAI-----------------------------NDRFNSQIEAVV
NUOC_XANOP       -------MAEQASSFTDRL-----------------------------AARFAGAQIAVA
NUOC_XANCB       -------MAEQASSFTDRL-----------------------------AARFAGAQISVV
NUOC_STRM5       -------MAEQAS-FIDRL-----------------------------SARFAGAKVIVV
NUOC_XYLFA       -------MAEQTLSFVDCL-----------------------------TSRFPTVRVSVA
NUOC_RUTMC       -----------MQDLKASL-----------------------------IKVFGERHLVEA
NUOC_VESOH       -----------MQDLKTSL-----------------------------VEVFGKTNLVES
NUOC_FRATW       -------MSTKLQDHFDKI-----------------------------TKILSGFGVEGC
NUOC_FRAP2       -------MSARLQDHFNNV-----------------------------EKILNGFSVECY
NUOC_GEOMG       --------MAETNRAVIKL-----------------------------REKFSASVLDVK
NUOC_GEOSL       --------MAENNRAVIKL-----------------------------KEKFAASILDVR
NUOC_GEOUR       -----MADMAENNRAVIKL-----------------------------REKFASSILEVK
NUOC_GEOBB       --------MAENNRAVVKL-----------------------------KERFANALLDCT
NUOC_GEOLS       --------MADTNRAVEKL-----------------------------QGKFEASILEVK
NUOC_MOOTA       -----------MDNFIQEL-----------------------------QRLFPDLEVREG
NUOC_DEIGD       -------MTELPERSAATT-----------------------------GGAKTARDVSSL
NUOC_DEIRA       APDAGLPETNLRDTAARST-----------------------------RRLAESRDVAPL
NQO5_THET8       ---------------MRLE-----------------------------RVLEEARAKGYP
                                                                             

NUOC_MYCBO       HER-VEFEDAVEKVVVYRDELTLHVRRD-LLPRVAQRLRDEPELRFELCLGVSGVHYPHE
NUOC_MYCUA       RDG-VEFEDAIEKVVVYRNELTLHVRRE-ALLRVAQSLRDEPELRFELCLGVNGVHYPHE
NUOC_MYCPA       SNG-IEFHQAIEKVVVYRDELTLHVDRA-ALPHVAQHLRDDPRLRFEMCLGVSGVHYPHE
NUOC_MYCSS       QD---LYDASVERIVVYRDELTLEIARA-RLPVVAKTLRDDAALRFELCLGVSGVHYPGD
NUOC_MYCVP       HD---VFAESVERVVVYRDELTLEVHRD-RLVDVAQTLRDDPDLRFELCLGVSGVHYPDD
NUOC_MYCGI       DD---AFTESIERVVIHRDELTLEVHRD-RLVEVAQALRDDPALRFELCLGVSGVHYPDD
NUOC_MYCS2       EE---RYAMSIERVVVYRDQLTIEVSRV-QLPAVASVLRDDPDLRFELCLGVSGVHYPED
NUOC_NOCFA       NSG-TPFGSALEKIVVFRGELTLHVRRE-HLVTVARLLRDDPALRFELCLGVNGVHYPDD
NUOC_RHOJR       ESG-VGFEVAIESVVVFRGEVTFGVRRE-FLPLVARVLRDEPDLRFEMCLGVNGVHFPQD
NUOC_MYCA9       EQENVTYADAVEGVVVYRDQLTIHVKAE-HLVQVAQSLRDDPQLRFELSLGVSGVHYPDD
NUOC_STRCO       EQG-LLPDNAIEKTVVDRGELTFHIERE-HLVRVARTLRDDPALRFELCTGVSGVHYPHD
NUOC_ACIC1       ----PRLPDAIERTDVDRGELTFHVRRE-YLRELALVLRDDERLRFELLNSLSGVHYPTD
NUOC_NOCSJ       E---AGLEIAAPRVVIHRGEITFHLRRE-DLLPVAQVLRDDERLRFEFCAGVSGVHYPDE
NUOC_SALAI       -----AFGEAIEKVVVDRGELTLHIRPE-RIAEVCQVLRDDLALRFELCSSVSGVDYLGA
NUOC_SACEN       ERG--VPAESVLQVTVDRGEITFYVDRD-HLLEICRSLRDDPALRFEMCASVSGVDYGPE
NUOC_CHLPD       AFD-----------SNETMPFFEVLDTD-QWPDIALFMRDHPKLKFNYMACLSGVDYPQ-
NUOC_CHLT3       DLD-----------NNPLMPFFTVENVD-AWQAIAFFMREDERLRFDYMACLSGVDYG--
NDHJ_PROMS       SLS-----------DDHIGIENISVQPS-KLYEAVSALRNY---GFNYLQCQGGYDEGP-
NDHJ_PROM2       SLP-----------DDHIGIENISVEPN-KLYEAVSNLRNY---GFNYLQCQGGYDEGP-
NDHJ_PROM5       SLG-----------NDHIGVELLSVKPE-KLYEAISSLKKY---GFNYLQCQGGYDEGP-
NDHJ_PROMP       SLG-----------NDHIGVEILSVKPE-KLYEAISTLRGY---GFNYLQCQGGYDEGP-
NDHJ_SYNS3       ALE-----------PDHLGVEQIGVEAL-FLQVITAALKSN---GFDYLQCQGGYDEGP-
NDHJ_SYNPW       LLE-----------PDHVGVEQIAVEAL-FLPVIAAALKSH---GFDYLQCQGGYDEGP-
NDHJ_SYNSC       ILE-----------PDHLGVEQIGVDAA-VLPMIAAALKSN---GFDYLQCQGGYDEGP-
NDHJ_SYNPX       ALE-----------PDHVGIEQIGVDAA-VLPIIAAALKSN---GFDYLQCHGGYDEGP-
NDHJ_SYNS9       VLD-----------PDHVGVEQIGVESA-VLPIIVAAIKSH---GFDYLQCQGGYDEGP-
NDHJ_PROMM       LLD-----------PDHLGVEVIGVESM-FLQVIVAALKAD---GFDYLQCQGGYDEGP-
NDHJ_PROMT       PLK-----------EDHLGIEVIKISPN-NLLTIVEALKND---GFNYLQCQGGYDEGP-
NDHJ_PROM4       LLE-----------PDEIGIENLGVDPQ-QLFKIVSELKMN---GFNYLQCQGGYDEGP-
NDHJ_SYNR3       ILG-----------NDHLGIERLGVEPL-ALPLVATALKSK---GFDYLQVQGGFDQGP-
NDHJ_PAUCH       ILE-----------PDLLGVELIGVEPS-ELQKIAEALKSN---GFDYLQCQGGYDEGP-
NDHJ_NOSS1       SLA-----------ADKNGVEIIKVEAD-FLLPIATALYAY---GFNYLQFQGGVDLGP-
NDHJ_TRIV2       SLA-----------ADKNGVEIIKVEPD-FLLPIATALYAY---GFNYLQFQGGIDLGP-
NDHJ_NOSP7       FLA-----------PDKNGVEIIKVSAD-FLLPTATALYAY---GFNYLQCQGGIDLGP-
NDHJ_CROS5       LLE-----------PDHLGVELIKVSPD-FLVPLCTALYAY---GFNYLQCQGAYDLGP-
NDHJ_MICAN       ALE-----------ADHSGVELIKVEAD-FLIPLATALYAY---GFNYLQCQGAYDLGP-
NDHJ_SYNP2       SLE-----------RDHSGIEIIKVDAD-LLIPLCTALYAF---GFNYLQCQGAYDLGP-
NDHJ_SYNY3       SLT-----------ADHLGVEMVQVEAD-LLLPLCTALYAY---GFNYLQCQGAYDEGP-
NDHJ_SYNP6       ALE-----------RDHLGVEIVQVDRE-VLLPIAAALFAY---GFNYLQCQGGYDLGP-
NDHJ_SYNJB       YLG-----------RDAAGVELLEVERD-FLLPLCTALYAY---GFNYLECQCGYDLGA-
NDHJ_SYNJA       YLG-----------RDAAGVELLEVERD-FLLPVCTALYAY---GFNYLECQCGYDLGA-
NDHJ_TRIEI       FLA-----------PDHQGIEIIKGNRD-FLIPLATALYAY---GFNYLQCQCAYDAGP-
NDHJ_ACAM1       ALG-----------ADHLGVEMIKVTAD-QLVDVATTLVND---GYNYLMCQGGYDSGP-
NDHJ_THEEB       SLG-----------RDASGVEMIKVDRD-RLLAVCQTLYAD---GFNYLRCQAAYDSGP-
NDHJ_GLOVI       LTG-----------LDNRKIEIIKVEPE-HLIAVARALYDD---GFNYLACQCGFDEGP-
NDHJ_LACSA       SLG-----------FDYQGIETLQIKPG-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_TRACE       SLG-----------FDYQGIETFQIKSE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_DAUCA       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYIY---GYNYLRSQCAYDVAP-
NDHJ_FAGEA       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVEP-
NDHJ_PANGI       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_CITSI       SLG-----------FDYQGIETLQIKPE-DWHSVAVILYIY---GYNYLRSQCAYDVAP-
NDHJ_DRANE       SLG-----------FDYQGIETLQIKPE-DWHAIAVILYVY---GYNYLRLQCAYDVAP-
NDHJ_IPOPU       SLG-----------FDYQGIETLQIKPE-DWHSVAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_OENPA       SLG-----------FDYQGIETLQIKPE-EWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_CUCSA       SLG-----------FDYQGIETLQIKPE-EWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_POPTR       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_CICAR       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_MANES       FLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_SOYBN       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_PHAVU       SLG-----------FDYLGVETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_LOTJA       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVSP-
NDHJ_LUPLU       SLG-----------FDYQGIETLQIKPE-AWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_PELHO       SLG-----------FDYQGIETLEIKSE-DWHSVAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_MORIN       SLG-----------FDYQGIETLQIKPE-DWHSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_BUXMI       SLG-----------FDYQGIETLQIKPE-DWHSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_ACOCL       SLG-----------FDYQGIEILQIKPE-DWDSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_CALFG       SLG-----------FDYQGIETLQIKPE-DWYSIAVISYVY---GYNYLRFQCAYDVAP-
NDHJ_NYMAL       SLG-----------FDYQGVETLQIKPE-DWYSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_CERDE       SLG-----------FDYQGIETLQIKPE-DWYSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_LIRTU       SLG-----------FDYQGIETLQIKPE-DWYSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_AMBTC       SLG-----------FDYQGIETLQIKSE-DWYSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_DIOEL       SLG-----------FDYQGIETLQIKTE-DWDSIAVISYIY---GYNYLRSQCAYDVAP-
NDHJ_LEMMI       SLG-----------FDYQGIETLQIKPE-DWDSIAVISYVY---GYNYLRSQCAYDVAP-
NDHJ_ORYSJ       SLG-----------FDHRGIETLQIKAE-DWDSIAVILYVY---GYNYLRSQCAYDVAP-
NDHJ_PIPCE       SLG-----------FDYRGIETLQIKSE-DWYSIAVILYAY---GYNYLRSQCAYDAAP-
NDHJ_CRYJA       PLG-----------FDYQGTETLQIKAE-DWVSIAVALYVY---GFNYLRSQCAYDVAP-
NDHJ_CYCTA       PLG-----------SDYQGIETLQIKSE-DRASVAVALYVY---GFNYLRSQCAYDVAP-
NDHJ_ANGEV       PLG-----------FDYQGIEILQIRPQ-DWPSIAVALYVY---GFNYLRSQCAYDVTP-
NDHJ_PSINU       PSG-----------FDYQGIEIIQIKSE-DWPSIAVALYIY---GFNYLRSQCAYDVMP-
NDHJ_ANTAG       PLG-----------FDYQGVETLQVRSE-DWLSIAVALYAY---GFNYLRSQCVYDVAP-
NDHJ_MARPO       PLG-----------FDYQGIETLQIRSE-DWPSLAVALYVY---GFNYLRSQCAYDVEP-
NDHJ_PHYPA       PLG-----------FDYQGVEILQIRSE-DWLSIAVALYVY---GFNYLRSQCAYDVAP-
NDHJ_STAPU       PLG-----------FDYQGVEIVEVRPE-DWPSVAVSLYVY---GFNYLRLQCGYDVFP-
NDHJ_ZYGCR       PLG-----------FDYQGVETIEVRPE-DWPSVAVALYVY---GFNYLRCQCAYDVAP-
NDHJ_CHAGL       PLG-----------FDYQGVETLQIKPE-DWPSIAVALYVN---GFNYLRCQCGYDVYP-
NDHJ_ADICA       PLG-----------YDYRGVEILEVKSE-EWLSTAVALYAY---GFNYLRSQCAYDATP-
NDHJ_MESVI       PLG-----------FDYQGVETLEVKAQ-NLTSVAIALYAY---GFNYLRSQCAYDVSP-
NDHJ_CHLAT       PLG-----------FDYQGVEILEVKPE-DLTSVAIALYAY---GFNYLRNQCAYDVSP-
NUOC_ROSDO       VTN---------------KELNLDVTPS-NIVGLVEFLKTDATCRFSTLIDITAVDYTGR
NUOC_RUEPO       VTF---------------GELNVDVAPS-NLVDFVDFLRSDSSCRFSTLVDITAVDYPER
NUOC_RUEST       IAH---------------GELNIDVKPA-NIAGLVEFLRVDSACRFSTLVDITAVDYPER
NUOC_DINSH       IAH---------------DELTVVATPN-SIVGLVAFLKTDATCKFSTLIDITAVDYPER
NUOC_RHOS1       VEF---------------GELTLDVVPN-RIVGLVEFLRSDASCRFSSLVDITAIDHPER
NUOC_RHOCA       VVQ---------------GELTVTVKPE-GIADFVRFLRDDAGCRFTTLVDLTAVDWPER
NQO5_PARDE       AV----------------GELTVNATLS-GVIGLIEFLRNDPNCRFSTLIDITAVDNPAR
NUOC_MARMM       IAN---------------GELTVEIHRD-RIETVLTWLRDDPACRFTTLIDICGVDYPQR
NUOC_PARL1       VAF---------------GELNVLAQAQ-SIARVLKFLRDDPACRFGTLLDITAVDYPQR
NUOC_RHORT       MAK---------------DELQVIAQRP-SIAKVLTFLRDDSACRFSQLVDIAGVDYPSR
NUOC_MAGSA       VNRC--------------GELSLTVKAA-SIVKVMTYLKDDAGCLFKQLVDVCGVDWPGR
NUOC_HYPNA       IHV---------------GELTLLAERD-HIVPLLRFLRDDQQCNFETFIDVCGVDYPER
NUOC1_RHIME      VKY---------------GELTVTAKAE-NLIALLTFLRDDVQCGFVSFIDVCGVDYPQR
NUOC_SINMW       VRY---------------GELTLTTKAE-SLIALLTFLRDDVQCGFVSFIDVCGVDYPQR
NUOC_RHIL3       MKY---------------GELTLTTTGE-NLVALLTFLRDDAKCGFVNLIDICGVDWPQR
NUOC_AGRFC       IAY---------------GELTLNTTPE-NVIALLTFLRDDVQCGFVNIIDICGVDWPQR
NUOC_AZOC5       IAY---------------GELTLETTPD-HILKLATFLRDDPSCLFTCIVDVCGADYPAR
NUOC_XANP2       VAH---------------GELTLQIDPA-QIVKVATFLRDDPACLFHCIVDVCGVDYPAR
NUOC_BRUSI       LAY---------------GELTLCVPVA-SLIGVLTFLRDDVQCQFVNLTDISGVDYPQR
NUOC_OCHA4       LAY---------------GELTLSVPAA-SIISVLTFLRDDVQCQFVNLTDISGVDYPQR
NUOC_RHILO       IAY---------------GELTMHVEPR-NLIEVVTFLRDDQRCQFISIIDVCGADYPSR
NUOC_CHESB       VAY---------------DELTIFVEPG-DIVDVLTFLKSDVQCQFFAFVDISGVDYPAR
NUOC_METEP       ITR---------------GELTLVVQGS-DIVYALTYLRDEPACAFRCFIDICGVDYPQR
NUOC_METPB       IAH---------------GELTLIVQGS-DIVYALTYLRDDPNCAFRCFIDICGVDYPQR
NUOC_METRJ       IAF---------------GELTLVVQAS-DIVYALTYLRDDPACAFRNFIDICGVDYPQR
NUOC_METS4       IAF---------------DELTLVVEPS-EIVRVLTHLRDDPACGFRSFIDICGADYPGR
NUOC_BARHE       LAF---------------GELTIVSRLD-AITDVLIFVRDDSRCQFINITDISGVDYPCR
NUOC_BARQU       LAF---------------GELTIVSRLD-AITGVLMFVRDDSRCQFINLTDISGVDYPSR
NUOC_BART1       FAF---------------GELTIVARLD-AITDVLMFVRDDSHCQFINLTDISGVDYPSR
NUOC_BARBK       LAF---------------GELTIVSRLD-AIIDVLMFIRDDSRCQFINIIDISGVDYPAR
NUOC_RHOPT       VGF---------------GQLTLTVDAG-KIVEVMRLLRDDPRFRFISFIDMTAVDYPGR
NUOC_RHOPB       IAF---------------GELTLTVDAA-KIVEVVRFLRDDPRCRFISPIDVTAVDYPGR
NUOC_CAUVC       VAF---------------GELTIVARAA-SVIDTLTFLRDDAACRFHQLIDLTGVDYPER
NUOC_CAUSK       VAF---------------GELNLLGPAN-RIVQALTYLRDHPDYRFHQLVDLTGVDYPER
NUOC_PHEZH       VAF---------------GELSLTGPAH-RIVEGLTLLRDD--HGFQQLVDICGVDYPER
NUOC_ERYLH       EKY---------------GEIIITVERD-AIEDVLRTLRDD--HDYQQLMEIAGVDYPER
NUOC_NOVAD       EEH---------------GEILLTVVRD-RVEDALRLLRDD--HEYQQLMDIAGVDYPQR
NUOC_WOLTR       DGT-----------------IVIYSTLD-NIEDHLLFLRDDEKCRFELLVDIFGVDYPDR
NUOC_NEOSM       ------------------GRCVVNSSLE-SLVELISHL---SSCGFEQLTDIFGIDYLER
NUOC_RICBR       VKE----------------NLAYKVEPN-FLLPFLKALKESEELRFTVLTDLFGSDFPEK
NUOC_RICFE       VKD----------------YLAYQVEPN-FLLPFLKALKESEELRFTVLTDLFGTDFPER
NUOC_RICPR       VKD----------------HLAYKIEPH-FLLPFLKALKESEELRFTVLTDLFGVDFPKK
NUOC_RICTY       VKD----------------HLAYKIEPH-FLLPFLKALKESEELRFTVLTDLFGVDFPKR
NUOC2_RHIME      AAH---------------GIYAFAVPPE-QIVEFCRFLKEHPALEFDFLSDICGVDHYPE
NUOC2_RHIE6      TAH---------------GIDVFAVPPE-RIVEFCRFLKEHPAMQFNFLSDICGVDHYPE
NUOC_ROSCS       E-FR--------------GDLSVHVRPE-RIVDVARFLRDDPELRYHFLENLCGVDYLGR
NUOC_ROSS1       E-FR--------------GDLSVYVRPE-RIVDVARFLRDDPELRFNFLENLCGVDYLGR
NUOC_HERA2       ---S--------------GDLCLTVERQ-QLPALAGWLRDEPDLAFTFLNQLCGVDYLGR
NUOC_NEIM0       SA---------------LGEITVECLPE-HYISVMTALRDHEELHFELLVDLCGVDYSTY
NUOC_NEIG2       SA---------------LGEITVECLPE-HYISVMTALHDHEDLHFELLVDLCGVDYSTY
NUOC_AZOSB       VD---------------RGEVTIEVAAG-NFLDVARRLRDEAALGFEQLMDISGIDYSAF
NUOC_AROAE       VD---------------RGEVTLEVAAA-DYLAAAQMLRDHRDLRFEELIDLTGLDYSAY
NUOC_DECAR       LA---------------LGEITIEVAAA-DYFCVMTALRDEAAFGFEEMIDLCGVDYSTY
NUOC_BURA4       EA---------------IGELTLVVKAS-DYLEVAKTLRDDPKLRFEQLIDLCGVDYQTY
NUOC_BURVG       EA---------------IGELTLVVKAS-DYLEVAKTLRDDPKLRFEQLIDLCGIDYQTY
NUOC_BURL3       EA---------------IGELTLVVKAS-DYLEVAKMLRDDPKLRFEQLLDLCGVDYQTF
NUOC_BURM1       EA---------------IGELTLVVKAS-DYLDVATTLRDDPKLRFEQLIDLCGVDYQTY
NUOC_BURTA       EA---------------VGELTLVVKAS-DYLEVAKQLRDDRSLGFEQLIDLCGIDYQTY
NUOC_PARXL       EA---------------IGELTIVVKAG-DYLNVATRLRDDRSLGFEQCVDLCGVDYQTY
NUOC_PARP8       ES---------------IGELTIVVKAD-DFLEVATRLRDDAKLHFEQLIDLCGIDYQTY
NUOC_RALPJ       ES---------------VGELTLVVKAA-DYLDAMRTLRDDASLKFEQLMDLCGVDYADY
NUOC_RALSO       EA---------------VGEITLVVKAA-DYLETMRTLRDDATLKFEQLIDLCGVDYSAY
NUOC_CUPTR       EA---------------TGELTLIVKAD-DYLDVAQILRDDPSLRFEQLIDLCGVDYLEY
NUOC_CUPNH       EA---------------TGELTLIVKAD-DYLEVARILRDDPSLRFEQLIDLCGVDYSEY
NUOC_CUPPJ       EA---------------TGELTLIVKAD-DYLEVARTLRDDPSLRFEQLIDLCGVDYSDF
NUOC_CUPMC       EA---------------TGELTLIVKAA-DYLEVARLLRDDPSLRFEQLLDLCGVDYSDY
NUOC_POLNS       IA---------------LGEVTVVVYAD-TYFESAMLMRDDPSLAFEQLIDLCGVDYQDF
NUOC_POLAQ       IA---------------LGEVTVVVNAD-TYFESAMLMRDDPSLAFEQLIDLCGVDYQDF
NUOC_HERAR       LA---------------LGEITIVVNSR-DYASAMRVLRDHADLRFEELIDLCGVDYSTY
NUOC_JANMA       QA---------------LGEVTIVVKSH-DYASAMRVLRDHADLRFEEMIDLCGVDYSTY
NUOC_THIDA       ER---------------LGELTLVVKPQ-AYAPAMLALRDHPDCRFEQLIDLCGVDYSGY
NUOC_CHRVO       LA---------------LDELTIVCKAS-DLLSVAQTLRDHADLAFEQCIDVCGMDYSAY
NUOC_ACIAC       LA---------------LDELTVTVSAA-DYLAAMQLLRDAPGCRFEQLMDLCGIDYSTY
NUOC_ACISJ       VA---------------LDEVTVVVSAA-RYLEAMQILRDAPDCKFEQLIDLCGVDYSAY
NUOC_DELAS       VA---------------LGEVTVEVSAA-QYLEAMQVLHTAPDCRFEVLVDLCGVDYSTY
NUOC_VEREI       LA---------------LEEVTVVLAAA-DYFDAMRVLRDDPVCRFEQLIDLCAVDYSTY
NUOC_RHOFT       LR---------------LDELTVVVDGA-HYLQAAKILRDDPNCRFEQLMDLCGVDYSTY
NUOC_POLNA       IA---------------LGEITVTVAAA-DYLAAATLLRDAPGCKFEQLLDLCGLDYSEY
NUOC_POLSJ       IA---------------LGEVTVTVGAA-DYLASAVLLRDAAGCRFEQLIDLCGLDYSEY
NUOC_LEPCP       RD---------------RGELTLTVKAT-DYAAIGKTLRDHPDLGFEQLIDICGVDYSGY
NUOC_METPP       RD---------------RGELTLTVTAA-DYLAVCTTLRDHAELKLEQLIDLCGLDYSSY
NUOC_NITEU       CA---------------LGELTLLVHSR-DLPDIAEVLRDHQDLGFDTLIDLCGVDFSEY
NUOC_NITEC       HA---------------LGELTILIHSR-DLLGIAETLRNHTDLAFDTLVDLCGVDYSEY
NUOC_NITMU       QQ---------------LDQLIITVSPV-NLLPVMSVLRDHPELGFEMLIDLCGVDYSIY
NUOC_BORPA       ES---------------LGELTLEVAAE-QWFSACTKLRTDPALRFESCIDLCGVDYLTW
NUOC_BORA1       EA---------------LGELTLEVPAD-QWLTVCNKLRTDAGLRFESCIDLCGMDYQTW
NUOC_BORPD       EA---------------LGELTLEVPAD-QWLAVCNKLRTDAGLSFETCIDLCGVDYLTW
NUOC_ALKEH       LDA-------------DRGELAIEVAPA-DLHQAMTTLRDAEGLRFDMLMDLAGVDYAAW
NUOC_HALHL       LE---------------RGEVTADVRPA-DLLAVMTELRDGAEWRFEQLSDVAGVDYAAY
NUOC_METFK       LQE-------------CRNEVTIECQAP-CLLEVANLLRDHKLLKFEQLIDLCGVDYADY
NUOC_ACIF5       LD---------------RGELTVELSRE-GFPAACLLLRDDVACAFDLLVDVCGVDYSAY
NUOC_HYDCU       IK---------------LDELTVELAPE-QSLSALTKLKEK--LGFDQLIDVCGVDYLAF
NUOC_LEGPA       SA---------------YGEVTIECEVH-NLLPVMIELRDREEFSFDQLIDLCGVDYLHY
NUOC_NITOC       LE---------------RGELTIEVPRE-FYFAVCKALRDEENFGFEQLIDLCGVDYMEY
NUOC_COXBR       AG---------------VDMVTIELLPT-HLLEVCTTLRDDPPFNFELLLDVCGVDYLEY
NUOC_XANOP       LP---------------RGEVTLEVAAA-DWHATCLALRDE--LGFEQLSDLCGVDYLGY
NUOC_XANCB       QP---------------RGEVTLEVAAA-QWHATCLALRDE--LGFEQLSDLCGVDYLGY
NUOC_STRM5       EP---------------RGEVTLEVPAA-EWHATALALRDE--FGFEQAVDLCGVDYLGY
NUOC_XYLFA       QP---------------RGEITLDVPAV-EWCAVCRALRDE--FDFEQLSDLCGVDYLGY
NUOC_RUTMC       FG-----------------ELTLIVDSQ-DIIKTCLKLRDF--FYFDTLIDLCGVDYLTY
NUOC_VESOH       FD-----------------ELTLTVGSQ-NIIKTCLKLRDF--FSFDTLIDLCGVDYLTY
NUOC_FRATW       IS---------------YGEITFSIRDQRDIHLILKKLKKE--YLFEQLTDVTAVDYLTY
NUOC_FRAP2       VA---------------YGEINISIKDQRDIHLVLKKLKKE--YHFKQLTDITAVDYLTY
NUOC_GEOMG       EF---------------RGEVTVTVKRE-DIVEICNFLKSS--LAYNLCTDVTAVDYLGK
NUOC_GEOSL       EF---------------RGEVTVTVARE-KVVDICRFLKES--LQYNLCTDVTAVDYLGK
NUOC_GEOUR       EF---------------RGEVTVIVRKE-DIVALCKFLKEE--LRYNLLTDVTAVDYLGK
NUOC_GEOBB       EY---------------RGEVTVTVKKE-NILEVLKCLRDD--LRYNFLTDVTAVDYLGQ
NUOC_GEOLS       QD---------------RGDWIVTVKKE-DIVAVLAFLKQE--CKFDMLTDVTAVDYLGK
NUOC_MOOTA       VD------------------VPALVVPADQLLALMTELKEKR--GFNFLADLTAVDYPED
NUOC_DEIGD       IAEL------------GLTAEDSIEPTALVPPERLREVALALRDRGFMLMDTVGVDYGAF
NUOC_DEIRA       LAEL------------GLSAEEGLQPTAAVEAGELLHTAQQLRARGFMLLDVIGVDYSRY
NQO5_THET8       IEDN------------GLGNLWVVLPRERFKEEMAHYKAMGFN----FLADIVGLDYLTY
                                                                        .    

NUOC_MYCBO       T-----------------------------------------------GRELHAVYPLQS
NUOC_MYCUA       T-----------------------------------------------GRELHAVYPLQS
NUOC_MYCPA       T-----------------------------------------------GRELHAVYPLQS
NUOC_MYCSS       A-----------------------------------------------GRELHAAYPLMS
NUOC_MYCVP       A-----------------------------------------------DRELHAVYPLMS
NUOC_MYCGI       T-----------------------------------------------GRELHAAYPLMS
NUOC_MYCS2       T-----------------------------------------------GRELHAVYPLMS
NUOC_NOCFA       A-----------------------------------------------GRELHAVYPLRS
NUOC_RHOJR       A-----------------------------------------------GRELHAVYPLLS
NUOC_MYCA9       S-----------------------------------------------ARELHAVYPLMS
NUOC_STRCO       K-----------------------------------------------GRELHAVYHLRS
NUOC_ACIC1       V-----------------------------------------------GRELHVVYELTS
NUOC_NOCSJ       T-----------------------------------------------GRELHAVYHLLS
NUOC_SALAI       D-----------------------------------------------ARRLHAVYQLTS
NUOC_SACEN       V-----------------------------------------------PQRLHSVYHLLS
NUOC_CHLPD       ------------------------------------------------EEKLGIVCNLES
NUOC_CHLT3       ------------------------------------------------DGRLGVVYNFDA
NDHJ_PROMS       ------------------------------------------------GKNLVSFYHFIT
NDHJ_PROM2       ------------------------------------------------GKNLVSFYHFIT
NDHJ_PROM5       ------------------------------------------------GKRLVSFYHLIS
NDHJ_PROMP       ------------------------------------------------GKCLVSFYHLIS
NDHJ_SYNS3       ------------------------------------------------GERLVCFYHFVA
NDHJ_SYNPW       ------------------------------------------------GERLVCFYHLLA
NDHJ_SYNSC       ------------------------------------------------GEQLVCFYHLLA
NDHJ_SYNPX       ------------------------------------------------GERLVCFYHLLA
NDHJ_SYNS9       ------------------------------------------------GERLVCFYHFIA
NDHJ_PROMM       ------------------------------------------------GQQLVCFYHLVA
NDHJ_PROMT       ------------------------------------------------GLNIVCFYNLIE
NDHJ_PROM4       ------------------------------------------------GLSLVCFYHLME
NDHJ_SYNR3       ------------------------------------------------GEPLVSFYHLVQ
NDHJ_PAUCH       ------------------------------------------------GGRLVSFYHLIK
NDHJ_NOSS1       ------------------------------------------------GQDLVSVYHLVK
NDHJ_TRIV2       ------------------------------------------------GQDLVSVYHLVK
NDHJ_NOSP7       ------------------------------------------------GQELVSMYHLIK
NDHJ_CROS5       ------------------------------------------------GKELVSFYHLIK
NDHJ_MICAN       ------------------------------------------------GKELVSFYHLVK
NDHJ_SYNP2       ------------------------------------------------GKELVSFYHLLK
NDHJ_SYNY3       ------------------------------------------------GKSLVSFYHLVK
NDHJ_SYNP6       ------------------------------------------------GQDLVSFYHLTK
NDHJ_SYNJB       ------------------------------------------------GQPLVSLYHLIK
NDHJ_SYNJA       ------------------------------------------------GQPLVSLYHLIK
NDHJ_TRIEI       ------------------------------------------------GEDLVSMYHLVK
NDHJ_ACAM1       ------------------------------------------------GQELVSMYHLLK
NDHJ_THEEB       ------------------------------------------------GQDLVSTYHLIK
NDHJ_GLOVI       ------------------------------------------------GDSLGSMYHLTK
NDHJ_LACSA       ------------------------------------------------GGLLASVYHLTR
NDHJ_TRACE       ------------------------------------------------GGLLASVYHLTR
NDHJ_DAUCA       ------------------------------------------------GGLLASVYHLTR
NDHJ_FAGEA       ------------------------------------------------GGLLASVYHLTR
NDHJ_PANGI       ------------------------------------------------GGLLASVYHLTR
NDHJ_CITSI       ------------------------------------------------GGLLASVYHLTR
NDHJ_DRANE       ------------------------------------------------GGLLASVYHLTR
NDHJ_IPOPU       ------------------------------------------------GGLLASVYHLTR
NDHJ_OENPA       ------------------------------------------------GGLLASVYHLTR
NDHJ_CUCSA       ------------------------------------------------GGLLASVYHLTR
NDHJ_POPTR       ------------------------------------------------GGLLASIYHLTR
NDHJ_CICAR       ------------------------------------------------GGLLASVYHLTR
NDHJ_MANES       ------------------------------------------------GGLLASVYHLTR
NDHJ_SOYBN       ------------------------------------------------GGLLASVYHLTR
NDHJ_PHAVU       ------------------------------------------------GGLLASVYHLTR
NDHJ_LOTJA       ------------------------------------------------GGLLASVYHLTR
NDHJ_LUPLU       ------------------------------------------------GGLLASVYHLTR
NDHJ_PELHO       ------------------------------------------------GGLLASVYHFTR
NDHJ_MORIN       ------------------------------------------------GGLLASVYHLTR
NDHJ_BUXMI       ------------------------------------------------GGLLASVYHLTR
NDHJ_ACOCL       ------------------------------------------------GGFLASVYHLTR
NDHJ_CALFG       ------------------------------------------------GGLLASVYYLTR
NDHJ_NYMAL       ------------------------------------------------GGLLASVYHLTR
NDHJ_CERDE       ------------------------------------------------GGLLASVYHLTR
NDHJ_LIRTU       ------------------------------------------------GGLLASVYHLTK
NDHJ_AMBTC       ------------------------------------------------GGLLASVYHLTR
NDHJ_DIOEL       ------------------------------------------------GGFLASVYHLTR
NDHJ_LEMMI       ------------------------------------------------GGFLASVYHLTR
NDHJ_ORYSJ       ------------------------------------------------GGSLASVYHLTR
NDHJ_PIPCE       ------------------------------------------------GGLLASVYHLTR
NDHJ_CRYJA       ------------------------------------------------GGSLASVYHLTK
NDHJ_CYCTA       ------------------------------------------------GGSLASVYHLTN
NDHJ_ANGEV       ------------------------------------------------GGGLASVYHLTK
NDHJ_PSINU       ------------------------------------------------GGFLASVYHLTK
NDHJ_ANTAG       ------------------------------------------------GGLLASVYHLTK
NDHJ_MARPO       ------------------------------------------------GGLLASVYHFTK
NDHJ_PHYPA       ------------------------------------------------GGLLASVYHFTK
NDHJ_STAPU       ------------------------------------------------GGPLASIYYLTK
NDHJ_ZYGCR       ------------------------------------------------GGALASVYHLTK
NDHJ_CHAGL       ------------------------------------------------GGPLASVYYLTK
NDHJ_ADICA       ------------------------------------------------GGSLVSVYHLTQ
NDHJ_MESVI       ------------------------------------------------GGDLASVYHLTK
NDHJ_CHLAT       ------------------------------------------------GGNLASVYHLTK
NUOC_ROSDO       ------------------------------------------------AKRYDVVYHLLS
NUOC_RUEPO       ------------------------------------------------AKRFDVVYHFLS
NUOC_RUEST       ------------------------------------------------TKRFDVVYHLLS
NUOC_DINSH       ------------------------------------------------AQRFDVVYHFLS
NUOC_RHOS1       ------------------------------------------------PARFDVVYHFLS
NUOC_RHOCA       ------------------------------------------------VERFEMVWHFLS
NQO5_PARDE       ------------------------------------------------PARFDVVYHLLS
NUOC_MARMM       ------------------------------------------------AERFEVVYHLLS
NUOC_PARL1       ------------------------------------------------PERFDVVYHLLS
NUOC_RHORT       ------------------------------------------------EERFEVVYNMLS
NUOC_MAGSA       ------------------------------------------------EQRFDVVYHLLS
NUOC_HYPNA       ------------------------------------------------SERFEVVYHLLS
NUOC1_RHIME      ------------------------------------------------PDRFDVVYHLLS
NUOC_SINMW       ------------------------------------------------PDRFDVVYHLLS
NUOC_RHIL3       ------------------------------------------------ELRFDVVYHLLS
NUOC_AGRFC       ------------------------------------------------EKRFDVVYHLLS
NUOC_AZOC5       ------------------------------------------------EQRFEVVYHLLS
NUOC_XANP2       ------------------------------------------------EKRFDVVYHLLS
NUOC_BRUSI       ------------------------------------------------EKRFDVVYQLLS
NUOC_OCHA4       ------------------------------------------------AKRFDVVYQLMS
NUOC_RHILO       ------------------------------------------------PKRFDVVYHLLS
NUOC_CHESB       ------------------------------------------------ERRFEVVYHLLS
NUOC_METEP       ------------------------------------------------ARRFDVVYHLLS
NUOC_METPB       ------------------------------------------------ARRFDVVYHLLS
NUOC_METRJ       ------------------------------------------------EKRFDVVYHLLS
NUOC_METS4       ------------------------------------------------EKRFDVVYHLLS
NUOC_BARHE       ------------------------------------------------DKRFDVSYQLLS
NUOC_BARQU       ------------------------------------------------DKRFDVSYQLLA
NUOC_BART1       ------------------------------------------------DKRFDVSYQLLS
NUOC_BARBK       ------------------------------------------------DKRFDVSYQLLS
NUOC_RHOPT       ------------------------------------------------AERFEIVYHLLS
NUOC_RHOPB       ------------------------------------------------ANRFDVVWHFLS
NUOC_CAUVC       ------------------------------------------------AARFDVVYHLLS
NUOC_CAUSK       ------------------------------------------------ERRFDVVYHLLS
NUOC_PHEZH       ------------------------------------------------ERRFDVVYHLLS
NUOC_ERYLH       ------------------------------------------------PERFEVVYMLLS
NUOC_NOVAD       ------------------------------------------------AERFDVCYCLLS
NUOC_WOLTR       ------------------------------------------------EKRFELIYNLLS
NUOC_NEOSM       ------------------------------------------------EKRIEVVYLLLD
NUOC_RICBR       ------------------------------------------------AKRFEVVYNLLS
NUOC_RICFE       ------------------------------------------------DKRFEVIYNLLS
NUOC_RICPR       ------------------------------------------------EKRFEVVYNLLS
NUOC_RICTY       ------------------------------------------------EKRFEIVYNLLS
NUOC2_RHIME      ------------------------------------------------TPRFETVYHLYS
NUOC2_RHIE6      ------------------------------------------------TPRFEAVYHLYS
NUOC_ROSCS       ------------------------------------------------EPRFEVVYHLLS
NUOC_ROSS1       ------------------------------------------------EPRFEVVYHLIS
NUOC_HERA2       ------------------------------------------------DPRFEVVVHLTS
NUOC_NEIM0       KNEV------------------------------------------WQGKRFAVVSQLLS
NUOC_NEIG2       KNEA------------------------------------------WQGKRFAVVSQLLS
NUOC_AZOSB       GNGA------------------------------------------WQGKRFASVAHLLS
NUOC_AROAE       GNGA------------------------------------------WTGKRFAVAVHLLS
NUOC_DECAR       GDGT------------------------------------------WQGARFAVVVHLLS
NUOC_BURA4       GDGA------------------------------------------YDGPRFAAVSQLLS
NUOC_BURVG       GDGA------------------------------------------YDGPRFAAVSQLLS
NUOC_BURL3       GDGA------------------------------------------YDGPRFAAVSHLLS
NUOC_BURM1       GDGA------------------------------------------YDGPRFAAVTHLLS
NUOC_BURTA       GDGA------------------------------------------YDGPRFAAVLHLLS
NUOC_PARXL       ADGA------------------------------------------YDGPRFAAVLHLLS
NUOC_PARP8       GEGA------------------------------------------YDGPRFAAVLHLLS
NUOC_RALPJ       GDGA------------------------------------------WNGPRFAAVSHLLS
NUOC_RALSO       GDGA------------------------------------------WNGPRFAAVSHLLS
NUOC_CUPTR       ADGA------------------------------------------WDGPRFAAVSQLLS
NUOC_CUPNH       GDGA------------------------------------------WDGLRFAAVSQLLS
NUOC_CUPPJ       GDGA------------------------------------------WDGLRFAAVSHLLS
NUOC_CUPMC       AEGA------------------------------------------WDGLRFAAVSQLLS
NUOC_POLNS       RDGA------------------------------------------WAGQRFGVVSHLLS
NUOC_POLAQ       RDGA------------------------------------------WNGQRFGVVSHLLS
NUOC_HERAR       GDGA------------------------------------------WDGQRFAVVSHLLS
NUOC_JANMA       GDGL------------------------------------------WEGPRFAVVSHLLS
NUOC_THIDA       GEGA------------------------------------------WEGPRFAVVAHLLS
NUOC_CHRVO       RDEP------------------------------------------WDGPRFAAVYHLLS
NUOC_ACIAC       GDVG------------------------------------------TEGPRYAVVSHLLS
NUOC_ACISJ       GATG------------------------------------------SEGPRYAVVSHLLS
NUOC_DELAS       AEVG------------------------------------------REGPRFAVVSHLLS
NUOC_VEREI       ADAV------------------------------------------QQGPRYCVVAHLLS
NUOC_RHOFT       KDQP------------------------------------------QTGLRYCVVSHLLS
NUOC_POLNA       KNGQ------------------------------------------YDGLRYCVSSHLLS
NUOC_POLSJ       KDGQ------------------------------------------YDGLRYCVASHLLS
NUOC_LEPCP       KDGG------------------------------------------YEGLRYAAVSHLLS
NUOC_METPP       KDGAGSP-------------------------------------Y-TEGPRYCVVLHLLS
NUOC_NITEU       STDTHAG-------------------------------------YKREDRRFAVVYHLLS
NUOC_NITEC       TTNTHAG-------------------------------------YKRGDKRFAVVYHLLS
NUOC_NITMU       GVEPTSE-------------------------------------QGREGKRFAVVYHLLS
NUOC_BORPA       GNGTQPE----------------------------EK------TGPVTHGRYAVVVHLLS
NUOC_BORA1       GDGSHAN----------------------------AH------DEPARPGRFAVVIHLLS
NUOC_BORPD       GNGTRQAGE--------------------------DK------VAGVQRSRYAVVAHLLS
NUOC_ALKEH       GEDEWFTDTAEGTGFSRGVQGNNFARLGITGIYGVQE------ITENTGRRFAAVYQLLS
NUOC_HALHL       GQDEWITESATGTGFSRGVTEPGFGRLGLTGIYGVQS------IEEQTGRRFAAVYQLLS
NUOC_METFK       GEGSW------------------------------------------SGLRYATVYHFLS
NUOC_ACIF5       GEGL------------------------------------------WEGPRFAVVYHLLS
NUOC_HYDCU       GDVTWETRKATNSGFSRGVFDFAEED---------GE------ADTNIPRRFAVVYHLLS
NUOC_LEGPA       GDYDWETESATEHGFSRGVERQ------------EAK------AYAVNKPRFAVVYHLLS
NUOC_NITOC       GLSDWETKKATVDGFSRAVERR------------QYK------KQAWTRSRFAVVVHLLS
NUOC_COXBR       GMSPWRTEETPNTGFSRGFEEVI-----------QEQ------IIPWNKPRFAVVYHLLS
NUOC_XANOP       GSGEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQES-SAGAQPQQLPKQRFAVVAQLIS
NUOC_XANCB       GSDEWDTADVSSQGFSRGVEGKALGRFAWGEFPSQES-SNGAQPQQLPTQRFAVVAQLIS
NUOC_STRM5       GSDEWDTADVSSQGFSRGVEGKAQGRFAWGEFPTEENGADGARPQHMPTQRFAVVAQLRS
NUOC_XYLFA       GNTEWDTTDVSAQGFSRGVAGKAVGRFAWGEFPSAGS-NDGTQPWDVPQERFAVLAHLIS
NUOC_RUTMC       GQSDWNGNASASGFSRGRNHQG---------------------SKDRHEQRFVVVYHLLS
NUOC_VESOH       GQSDWNGNASASGFSRGRSHQG---------------------LKDIHEERFAVVYHLLS
NUOC_FRATW       GQSDWQVGKVVSQTGFSRGRQQD-------------------FKTAAVDNRFEIIYQLLS
NUOC_FRAP2       GQSDWQVGKVVSQTGFSRGRQQG-------------------FKTADVNNRFEIIYQLLS
NUOC_GEOMG       Q-----------------------------------------------EPRFMVVYNLYS
NUOC_GEOSL       Q-----------------------------------------------EPRFMVVYNLYS
NUOC_GEOUR       ------------------------------------------------DPRFMVVYNIYS
NUOC_GEOBB       ------------------------------------------------DPRFMVVYHLMS
NUOC_GEOLS       A-----------------------------------------------ADRFMMVYQLTS
NUOC_MOOTA       -------------------------------------------------ERIEMVYHLLS
NUOC_DEIGD       PERI--------------------------------------------PARFCVLHNVYH
NUOC_DEIRA       TAPR--------------------------------------------PQPFAVLYSVAH
NQO5_THET8       PDPR--------------------------------------------PERFAVVYELVS
                                                                          .  

NUOC_MYCBO       ITHNRR----------------LRLEVSAPDSD-PHIPSLFAIYPTNDWHERETYDFFGI
NUOC_MYCUA       ITHNRR----------------LRLEVSAPDSD-PHIPSLYAVYPTNDWHERETYDFFGI
NUOC_MYCPA       ITHNRR----------------VRLEVAVPDED-PHIPSLYRIYPTTDWHERETYDFFGI
NUOC_MYCSS       ITHNRR----------------IRLEVAAPDDD-PHIPSLFSVYPTTDWHERETYDFFGI
NUOC_MYCVP       ITHNRR----------------IRIEVAAPDSD-PHIPSLFRVYPTTDWHERETYDFFGL
NUOC_MYCGI       ITHNRR----------------IRLEVAVPDDD-PHIPSLFGVYPTVDWHERETYDFFGI
NUOC_MYCS2       ITHNRR----------------IQLEVAAPDAD-PHIPSLYAVYPTTDWHERETYDFFGI
NUOC_NOCFA       ITHNRL----------------LRVETCAPDTD-PHIPSLFEVYPTTDWHERETYDFFGI
NUOC_RHOJR       ITHNRR----------------IRLEVAAPDAD-PHIPSLYEVYPTNDWHERETYDFFGI
NUOC_MYCA9       ITWNRR----------------IMLEVAVPESD-PHIPSLNAVYPTTDWHERETYDFFGI
NUOC_STRCO       ITHNRL----------------IRLEVSAPDGD-PHIPSLVSVYPTNDWHERETYDFFGI
NUOC_ACIC1       MTYRRH----------------IRLEVAAPDAD-PHIPSVVDVWPTADFQERETWDMFGV
NUOC_NOCSJ       MTHNRR----------------IRLEVAVPDAD-PHIPSIVPVYPTNDWHERETYDMFGI
NUOC_SALAI       MTYRRQ----------------IRLEAAVSVED-PHLPSVTGVYPTADWQEREAYDMFGI
NUOC_SACEN       MTYRRR----------------IRLEVALDVDD-PHVPSVVEVYPTADYQERETYDMFGI
NUOC_CHLPD       VAALGH---------------RVAVKVRCSRDG-GSIPSVACVWHTANWHEREAYDMFGM
NUOC_CHLT3       LATHKH---------------KLTVKVFCSKED-PRIPSVAEIWLTADWHEREAYDMYGI
NDHJ_PROMS       VDDFQK------IEK----IKEVRLKVFLKRDSDLSIPSLYEIFKGSDWQERETFDMYGI
NDHJ_PROM2       VDDFQK------IEK----IKEVRLKVFLKRDSDLSIPSLYKIFKGSDWQERETYDMYGI
NDHJ_PROM5       LQDIEE------LEE----IKEIRVKVFLNRDSDLSVPSLYKIFKGSDWQERETYDMYGI
NDHJ_PROMP       LGDIQD------IKE----IKEIRVKVFLNRDSDLSVPSLYKIFKGSDWQERETYDMFGI
NDHJ_SYNS3       MAELID----GKRDN----LREVRLKVFLSREGEPSLPSIYGLFRGADWQERETFDMFGI
NDHJ_SYNPW       MAEVAE----GSADQ----VREVRLKVFLSREGQPSVPSLYGLFRGADWQERETFDMFGI
NDHJ_SYNSC       MAEQVEAMVADPSAK----LREVRIKVFLNREGTPSLPSIYGLFRGADWQERETFDMYGI
NDHJ_SYNPX       MAEQLEAMASDPAAQ----LREVRLKVFLSREGTPVLPSIYGLFRGADWQERETFDMYGI
NDHJ_SYNS9       MAEQVEAMTAGRPHE----LREVRLKVFLSREGTPSLPSIYGLFRGADWQERETFDMYGI
NDHJ_PROMM       MAEMVAKMGVGDSSSEAAKVREVRLKVFLSREDIPSLPSIYGLFRGADWQERETFDMFGI
NDHJ_PROMT       MNELKE-----DISP-----REVRLKVFLDRNGDLTVPSLYSLFRGADWQERETFDMYGV
NDHJ_PROM4       MKDFNE-----GDKP-----REVRLKVFLDRNGSLRVPSLYKLFRGCDWQERETYDMFGI
NDHJ_SYNR3       VGG-----------SDGASTAEVRLEVSLARDGDLTVPSLYPLFRGADWQERETFDLFGI
NDHJ_PAUCH       LGTIADHYLTPNTLPPNSILKEVRLKVFLLRDGNLSVPSLYSIFRGSDWQERETFDMFGI
NDHJ_NOSS1       VSDNAD------------KPEEIRVKVFLPREN-PVVPSVYWIWKTADWQERESYDMFGI
NDHJ_TRIV2       VSDNAD------------KPEEVRVKVFLPREN-PVVPSVYWIWKTADWQERESYDMFGI
NDHJ_NOSP7       VGDNSD------------RPEEVRVKVFLPREN-PVVPSVYWIWKTADWQERESYDMFGI
NDHJ_CROS5       VSDNCE------------QAEEVRIKVFLPRDN-PHIPSVYWIWKAADWQERESYDMYGI
NDHJ_MICAN       VTDNVD------------SPVEVRLKVFLPRDN-PRVASVYWIWKAADWQERESYDMFGI
NDHJ_SYNP2       VGDNVT------------DPEEVRVKVFLPREN-PVVPSVYWIWKGADWQERESYDMYGI
NDHJ_SYNY3       LTEDTR------------NPEEVRLKVFLPREN-PVVPSVYWIWKAADWQERECYDMFGI
NDHJ_SYNP6       VSDDAS------------QPQEVRVKVFLPRHD-PKVPPVFWIWKGADWQERETFDMYGI
NDHJ_SYNJB       LSDGAD------------RPQEVRLQVKLPRQD-PRLPSVYWIWKSADWQERETYDMYGI
NDHJ_SYNJA       LADGAD------------RPQEVRVQVKLPRQD-PRVPSVYWIWKSADWQERETYDMYGI
NDHJ_TRIEI       VSDDVE------------QPEEIRLKVFVPRDD-PRLPSVYWIWKSADFQERESYDMYGI
NDHJ_ACAM1       LSDDAD------------RPPEVRIKVFLSRED-PRVPSLYWVWKASDWQERESYDMYGI
NDHJ_THEEB       LSDNAD------------RPPEVRIKVFVPRDD-PRVPSVYWIWKTADWQERESYDMFGI
NDHJ_GLOVI       LSDSAD------------RPPEVRIKVFLPRDN-PRVPSVYWIWKTADWQERESFDMYGI
NDHJ_LACSA       IEYGAD------------QPEEVCIKVFAPRRD-PRIPSVFWVWKSVDFQERESYDMLGI
NDHJ_TRACE       IKYGVD------------QPEEVCIKVFATRRD-PRIPSVFCVWKSVDFQERESYDMLGI
NDHJ_DAUCA       IEYGVD------------QPEEVCIKVFSPRKN-PRIPSVFWVWKGVDFQERESFDMLGI
NDHJ_FAGEA       IESGVD------------QPEEVCIKVFVPRRN-PRIPSVFWVWKSVDFQERESYDMLGI
NDHJ_PANGI       IEYGVD------------QPEEVCIKVFAPRRN-PRIPSVFWVWKSVDFQERESYDMLGI
NDHJ_CITSI       IEYGVD------------QPEEVCIKVFAPRSN-PKIPSVFWVWKSANFQERESYDMLGI
NDHJ_DRANE       IEYGVN------------QAEEVCIKVFTQRSN-PRIPSVFWVWKSTDFQERESYDMLGI
NDHJ_IPOPU       IEYGVTRIE-----YGAYQPEEVCIKVFASRKN-SRIPSVFWIWKSADFQERESYDMLGI
NDHJ_OENPA       IEYG-VD-----------QAEEVCIKVFAPRNN-PRIPSVFWVWKSADFQERESYDMLGI
NDHJ_CUCSA       IEYG-ID-----------QPEEVCIKVFAARIN-PRIPSVFWVWKSADFPERESYDMLGI
NDHJ_POPTR       IEYGILD-----------QPEEVCIKVFAPRKN-PRIPSVFWVWKSADFQERESYDMLGI
NDHJ_CICAR       IEYS-LD-----------QPEEVCIKVFAPRKN-PRIPSIFWVWKSADFQERESYDMLGI
NDHJ_MANES       IEYG-ID-----------QPEEVCIKVFAPRKN-PRIPSVFWVWKSADFQERESYDMLGI
NDHJ_SOYBN       LEYG-ID-----------QPEEVCIKIFVARKN-PRIPSIFWVWKSADFQEKESYDMLGI
NDHJ_PHAVU       IEYG-IN-----------QPEEVCIKIFVSRKN-PRIPSIFWVWKSADFQEQESYDMLGI
NDHJ_LOTJA       IECG-IY-----------QPEEVCIKIFVPRNN-PRIPSIFWVWKSADFQERESYDMLGI
NDHJ_LUPLU       IECG-ID-----------QPEEVCIKVFVQGKI-LGIPSIFWVWKSADFQERESYDMLGI
NDHJ_PELHO       IEYG-ID-----------QPEEVCIKVFLARSN-PRIPSIFWVWKSADFQERESYDMLGI
NDHJ_MORIN       IEYGID------------QPEEVCIKVFAPRRN-PRIPSVFWIWKSADFQERESYDMLGI
NDHJ_BUXMI       IQYGVD------------QPEEICIKVFTPRKN-PRIPSVFWIWKSADFQERESYDMLGI
NDHJ_ACOCL       IQYGVD------------QPEEVCIKVFAPRRN-PKIPSVFWIWRSADFQERESYDMLGI
NDHJ_CALFG       IQYGVD------------QPEEVCIKVFAPRRN-PKIPSVFWIWKSADFQERESYDMLGI
NDHJ_NYMAL       IQYGVD------------QPEEVCIKVFVPRSN-PRIPSVFWIWKSADFQERESYDMLGI
NDHJ_CERDE       IQYGVD------------QPEEVCIKVFAPRGN-PRIPSVFWIWKSADFQERESYDMFGI
NDHJ_LIRTU       IEYGVD------------QPEEVCIKVFAPRRN-PRIPSVFWIWKSADFQERESYDMLGI
NDHJ_AMBTC       IQYGVD------------QPEEVCIKVFAQRRN-PRIPSVFWIWKSSDFQERESYDMLGI
NDHJ_DIOEL       IQYGID------------KVEEVCLKVFVSRNN-PRIPSVFWIWKSADFQERESYDMLGI
NDHJ_LEMMI       IQYGVD------------QPEEVCIKVFVPREN-PIVPSVFWVWRSADFQERESYDMFGI
NDHJ_ORYSJ       IQYGID------------NPEEVCIKVFAQKDN-PRIPSVFWIWRSSDFQERESFDMVGI
NDHJ_PIPCE       IQYGID------------QPEEVCIKVFVPRTN-TRIPSVFWIWKSADFQERESYDMLGI
NDHJ_CRYJA       INDNAD------------QPEEVCIKVFVPRED-PRIPSVLRIWKGANFQERESYDMLGI
NDHJ_CYCTA       IQDDAD------------QPEEICIKVFVPRKN-PRIPSIFWIWKSADFQERESYDMLGI
NDHJ_ANGEV       VQDDAD------------QPEEVCIKIFVSRED-PRIPSVFWIWKSSDFQERESYDMFGI
NDHJ_PSINU       LQDNAD------------QPEEVCIKILVSRES-PKIPSIFWVWKSADFQERESYDMSGI
NDHJ_ANTAG       VQSNAD------------QPEEVCIKIFVSRKN-PKIPSVFWVWKGADFQERESYDMLGI
NDHJ_MARPO       ITDNAD------------QPEEICIKIFILRKN-PKIPSIFWVWKSADFQERESYDMFGI
NDHJ_PHYPA       IEDNVD------------QPEEICIKIFVSRQK-PKIPSVFWIWKSADFQERESYDMLGI
NDHJ_STAPU       VQDGAD------------QPEEVCIKIFVSRDN-PKIPSAFWIWKSADFQERESYDMLGI
NDHJ_ZYGCR       VEDVAD------------QPEELCVKLFVSRNN-PSVPSSFWIWKSADFQERECYDMFGI
NDHJ_CHAGL       VDDNVD------------QPEEVCIKIFVPREN-PKIPSIFWVWKTADYQERETYDMLGI
NDHJ_ADICA       MQDQSD------------QPEEICVKVFVSRTN-PQIPSVYWVWKSAEFQERESYDMLGI
NDHJ_MESVI       VDDNAD------------QPQEVCIKVFVPRTK-PIIPSVFWIWKTADFQERESYDMFGI
NDHJ_CHLAT       LDADVD------------QPQEVCLKVFLPREN-PRVPSVFWIWKTADFQERESYDMFGI
NUOC_ROSDO       MY----------------QNHRVRLRVSIR--EDQMMPSVISVHPSANWFEREVFDMFGI
NUOC_RUEPO       MY----------------QNQRIRLRVSIR--EDDMVPSITDVHPSANWFEREVFDMFGI
NUOC_RUEST       MY----------------QNQRIRLRAAVR--EEDMVPSIVDVHPSANWFEREVFDMFGI
NUOC_DINSH       MY----------------QNHRIRIRVPVR--EDDIVPSIISEHPSANWFEREVFDMFGI
NUOC_RHOS1       MY----------------QNQRIRLKMQVR--EDETVASIHSVHPSANWFEREVFDMFGI
NUOC_RHOCA       MW----------------KNQRIRVKAGLA--EDAMCPSIVEVYPAANWYEREVFDMFGI
NQO5_PARDE       MY----------------QNQRIRVKVQVR--EDELVPSLIGVFPGANWYEREVFDLFGI
NUOC_MARMM       MH----------------QNHRIRVKLSTD--EEAPVPTVIPVYPVADWFEREAFDMYGI
NUOC_PARL1       MH----------------QNQRIRVTVRTN--EETAVPSVVAVYPSANWYERETFDMYGV
NUOC_RHORT       MH----------------HNQRIRVKISAS--EDTPVPSVTRVFSSANWFEREAWDMYGI
NUOC_MAGSA       MK----------------HNQRVRVKVATD--EETAVPSVTGVFSSAGWFEREVWDMYGV
NUOC_HYPNA       MR----------------MNHRIRVRIRTD--EETAVPSVVSLWPAANWFEREAFDMYGI
NUOC1_RHIME      PR----------------QNQRVRVKVATG--ENDPVPSATSVFPGADWFEREAYDMYGI
NUOC_SINMW       PR----------------QNQRIRVKVATG--ENEPVPSITSVYPGADWFEREAYDMYGI
NUOC_RHIL3       PK----------------KNLRIRVKVATD--EDTPVPSACPVYPGADWFERETWDMYGV
NUOC_AGRFC       PR----------------QNLRVRIKLQVA--EDEGVPSSTPVYMGAEWFEREAWDMYGI
NUOC_AZOC5       LK----------------QNARVRVKLSAG--EETLVPSVTGIWPGANWFEREAYDLYGI
NUOC_XANP2       LK----------------QNVRIRLKVETD--EDTPVPSICSVFPGANWFEREAYDMYGI
NUOC_BRUSI       PR----------------QNQRIRVKVQAD--EDTLVPSAVPVFFGAEWYEREAYDMYGI
NUOC_OCHA4       PR----------------QNQRIRVKVQAD--EDTLVPSAVPVFVGAEWFERETYDMYGV
NUOC_RHILO       PK----------------QNVRIRLKVQAD--EETMVPSITGVFPGADWFERETYDLYGV
NUOC_CHESB       PR----------------QNQRIRVKVSTD--EETPIPSVIEVFPAANWYEREIYDLYGV
NUOC_METEP       LR----------------HNMRVRVKVQTD--AATPVPSAIPVFPAANWYERETYDLYGI
NUOC_METPB       LR----------------HNMRVRVKVQTD--AATPVPSAIPVFPAANWFERETYDLYGI
NUOC_METRJ       LR----------------HNLRIRLKVQTD--EVTPVPSVIEVFPAANWYERETYDLYGI
NUOC_METS4       LR----------------HNRRIRVKVQTD--EATPVPSVITVFPAANWYERETYDLYGI
NUOC_BARHE       PR----------------HNLRLRVKVRTD--ENIPVASACSIYPGAEWYERETYDMYGI
NUOC_BARQU       PR----------------HNLRLRIKVRTD--ENTPVASACSIYPGAEWYEREAYDMYGI
NUOC_BART1       PR----------------ENLRLRVKVRTD--ENTPVASACTVYPGAEWYERETYDMYGI
NUOC_BARBK       PF----------------QNLRLRVKVRTD--EDVPVPSVCSVYPGAEWYERETYDMYGI
NUOC_RHOPT       PK----------------LNERVRVKAEVG--ETTLVPSIIEVFPGADWFEREAYDLYGI
NUOC_RHOPB       PS----------------LNTRIRLRAEAS--ETTQVPSLIDLFPGVDWFEREAYDLYGV
NUOC_CAUVC       LV----------------KNHRIRLKVSTD--EDTPVPSVTPVFPVADWFEREAFDMYGI
NUOC_CAUSK       LI----------------KNHRVRLKVQTD--EDTAVPSVTPVFPVADWFEREAFDMYGI
NUOC_PHEZH       FT----------------KNRRIRVKVQAD--EDTAVPSVTGVYPNADWYEREAFDMYGV
NUOC_ERYLH       LT----------------KNHRVMVKVSTD--EKTPVPTVTTLWPNAGWLEREVFDLYGV
NUOC_NOVAD       VT----------------KNHRVIVKVSTD--EATPVPTVTTLWPNAGWYEREVYDMFGV
NUOC_WOLTR       IV----------------HNIRVHIKLQLY--EDDMPPSVVRIFNTASWFEREVFDMYGI
NUOC_NEOSM       LK----------------RNRRCCVKVSVDP-ASEKVPTCCGVFSVANWFEREVYDMYGV
NUOC_RICBR       LK----------------LNKRLIIKTYVS--EHESIPSAMSIFNATCWYEREVYDMFGI
NUOC_RICFE       LK----------------LNKRLIIKVYIS--EKETIPSAMNIFNASCWYEREVYDMYGV
NUOC_RICPR       LK----------------LNKNLIIKTHIS--EKESIPSAMQILSAAYWYELEVYDMYGV
NUOC_RICTY       LK----------------LNKNLIIKTNIS--EKESIPSAMKILSAACWYELEVYDMYGV
NUOC2_RHIME      LK----------------NKWRVRIKCRLG--EPPHVPTVTGVWRTANWHEREAWDMYGI
NUOC2_RHIE6      LP----------------NRWRVRIKCRLG--DPPEVPSVTGVWRTANWHEREAWDMYGI
NUOC_ROSCS       FA----------------NRHRICLKVGVSE-RNPSVPSLTELWPGANYHERETFDMFGI
NUOC_ROSS1       FT----------------NRSRICLKVGVDE-HNPSVPSLTGLWPGANYHERETFDMFGI
NUOC_HERA2       FQ----------------NKMRVTLHIEVPE-ADPTIPTLARLFPTANFQERETYDMFGI
NUOC_NEIM0       VK----------------NNQRIRVRVWVSDDDFPVVESVVPVYNSADWYEREAFDLYGI
NUOC_NEIG2       VK----------------NNQRIRVRVWVSDDDFPVVESVADIYNSADWYEREAFDLYGI
NUOC_AZOSB       VK----------------NNWRLRLRVFADDDDFPVLGSLVEVWPSANWFEREAFDLYGI
NUOC_AROAE       LT----------------HNWRIRLRAFADDDAFPMFESLVGVWPGVNWYEREAFDLYGL
NUOC_DECAR       VA----------------NNWRLRVRVFAEDEGFPSVASITTVWASANWFEREAFDLYGI
NUOC_BURA4       VT----------------NNWRLRLRVFAPDDDLPIVASLVDIWTSANWYEREAFDLYGL
NUOC_BURVG       VT----------------NNWRLRLRVFAPDDDLPIVPSLVDTWSSSNWYEREAFDLYGL
NUOC_BURL3       VT----------------NNWRLRLRAFAPDDDLPIVASLVDIWTSANWYEREAFDLYGI
NUOC_BURM1       VT----------------NNWRLRLRVFAPDDDLPIVPSLVDIWNSANWYEREAFDLYGI
NUOC_BURTA       VA----------------NNWRLRVRVFAPDDDLPIVPSVVDIWNSANWYEREAFDLYGI
NUOC_PARXL       VQ----------------NNWRLRLRVFAPDDEVPILPSVVEIWNSVNWYEREAFDLYGI
NUOC_PARP8       IT----------------NNWRLRVRVFAPDDDVPLIPSVVEIWNSANWYEREAFDLYGI
NUOC_RALPJ       IT----------------HNWRVRVRVFAPDDDLPVVSSVTTIWNSADWFEREAFDLYGL
NUOC_RALSO       VT----------------HNWRVRVRVFAPDDDLPVVASVVDVWNAADWFEREAFDLYGL
NUOC_CUPTR       VT----------------HNWRLRLRAFASDDDFPVLPSLINVWNSVNWFEREAFDFYGI
NUOC_CUPNH       IT----------------HNWRLRVRVFAPDDDFPVLPSLIDVWNGVNWFEREAFDFYGI
NUOC_CUPPJ       VT----------------HNWRLRLRVFAPDDDFPVVPSLIDVWNSVNWFEREAFDFYGI
NUOC_CUPMC       VT----------------HNWRLRLRVFAPDDDFPVLPSVINVWNSVNWFEREAFDFYGI
NUOC_POLNS       LE----------------HNWRLRVRVFAPDDSYPLVASVSPVWNSANWFEREAFDLYGI
NUOC_POLAQ       LE----------------HNWRLRVRVFAPDDSYPLVASITPVWSSANWFEREAFDLYGI
NUOC_HERAR       IT----------------HNWRVRVRVFASDDEMPVVASMTEIWPAANWYEREAFDFFGI
NUOC_JANMA       IK----------------HNWRVRVRVFAADDEMPVVASMIDIWATANWYEREAFDFFGI
NUOC_THIDA       VS----------------KNARVRVRVFCPDDDLPAVASVVDIWPAASWFEREAFDLYGI
NUOC_CHRVO       VK----------------LNHRIRLRVFAEDDDFPVIPSVNGIWNAANWFEREAFDLYGI
NUOC_ACIAC       VS----------------LNQRVRVKVFCPDDDFPVVASVSGIWNSANWYEREAFDLYGI
NUOC_ACISJ       VS----------------LNQRLRVKVFCSDDDFPIVASVTDIWNSANWFEREAFDLFGI
NUOC_DELAS       IS----------------LNQRLRVRVFCTDDDFPVVASVTSVWAGANWFEREAFDLFGI
NUOC_VEREI       VS----------------LNQRLRVKVFCPDDDFPLLPSVCGLWNSANWYEREAFDLFGI
NUOC_RHOFT       VS----------------LNQRVRLKVFAPDDNLPVVQSLCDVWSSANWFEREAFDLFGI
NUOC_POLNA       VS----------------LNQRVRLKVFCPDDDFPVVDSVNGIWNSANWFEREAFDLYGI
NUOC_POLSJ       VS----------------LNQRVRLKVFCPDDDFPVVDSVNGVWNSANWFEREAFDLYGI
NUOC_LEPCP       VQ----------------HNWRLRLKVFAPDDDFPLVASLTPIWSGANWFEREAFDMYGI
NUOC_METPP       VS----------------KNWRLRLKVFCADDGLPVVPSVNEIWAAANWFEREAFDLYGI
NUOC_NITEU       VK----------------HNHRLRVRVFAEDNEFPMVDSVMPVWPSANWFEREAFDLFGI
NUOC_NITEC       VK----------------HNHRLRIRVFVDDNEFPMLDSVIHIWPSANWYEREAFDLFGI
NUOC_NITMU       IR----------------HNRRVRVKAFPEDDEFPVVVSVIDIWPSANWFEREAFDLYGI
NUOC_BORPA       IE----------------HNWRLRVRTWAPDDEFPMVSSLLECWPGVNWFEREAFDLYGI
NUOC_BORA1       IE----------------HNWRLRVRTYAVDEEFPIVASLIECWPGVNWYEREAFDLYGI
NUOC_BORPD       IA----------------HNWRLRVRTWAPDDDFPMVGSLIDCWPGVNWFEREAFDLFGI
NUOC_ALKEH       VE----------------LNQRLRVRCFCEDDRFPVLDSVVDVWSGANWFEREAFDLYGI
NUOC_HALHL       LT----------------HNHRLRVRCFAEDDDLPVLPSVTGIWPCANWAEREAFDLYGI
NUOC_METFK       VS----------------LNQRLRLRVFAPDDDFPVLPTVVDIWPVANWFERESFDLFGI
NUOC_ACIF5       LK----------------HRQRLRVRIFA-DDDLPIVPSVVEVWAAANWFEREAFDLYGI
NUOC_HYDCU       VE----------------NNRRVRVKVYPEDTQMPMVDSVVSVWNCADWFEREAFDLFGI
NUOC_LEGPA       TK----------------KNHRLRVKLFVEESHL-IVPSVHHLWKSANWFEREAYDLYGI
NUOC_NITOC       VR----------------HNWRLRVRTFVDEEIL-VAPSVIQLWASVNWFEREAFDLFGI
NUOC_COXBR       LR----------------HNHRIRLKTYVEGDPP-LVPSVIKIWSSADWYEREAFDLYGI
NUOC_XANOP       YQ----------------HNQRLRVRCYAPDEQVPLVASVTDIWPGVNWFEREAFDLFGI
NUOC_XANCB       YQ----------------HNQRLRVRCYAPDEQVPVVASLTDIWPGVNWFEREAFDLFGI
NUOC_STRM5       YQ----------------HNLMMHLRCFAPDEALPVVSSLTGIWPGLNWFEREAFDLYGV
NUOC_XYLFA       YR----------------HNRRLRVRCFASNDALPIVASLTDVWPGVNWFEREAFDLFGI
NUOC_RUTMC       VS----------------KNKRIRVKSFV-DEAEPIIKSVTDIWASADWYEREAFDLMGI
NUOC_VESOH       VS----------------KNKRIRVKSFV-DEVEPIIKSVTDIWASADWYEREAFDLMGI
NUOC_FRATW       MA----------------NNVRIRVKCKLKDAQIILVDSVSDLWPSANWTEREVYDMFGI
NUOC_FRAP2       MA----------------NNVRVRVKCKLKDAQIIMVDSVEDLWPSANWAEREVYDMFGI
NUOC_GEOMG       IP----------------NKDRLRVKAGVPEAGC-SIDTVSCVWSAANWLEREVYDLMGV
NUOC_GEOSL       IP----------------NKDRLRLKAGVPDADC-SIDTVSCVWNSANWLEREVYDLMGV
NUOC_GEOUR       IP----------------NKDRLRIKAPVTEGEC-TIDTVCGVWTTANWLEREAYDLMGI
NUOC_GEOBB       IP----------------NKDRIRVKAPLTEADC-SIDSATALWNSADWVEREAYDMFGI
NUOC_GEOLS       VP----------------FKDRLRIKAPVAEADC-VIGSATQVYGSANWLEREVFDLFGI
NUOC_MOOTA       VP----------------GMAEIRVKVNLDR-QHPEVPSLTALWPAANVQEREAFDLMGV
NUOC_DEIGD       IK----------------DRCRLFLRVWLE-EGQ-ALDSLYPVWRAANYLEREVYDLFGI
NUOC_DEIRA       PR----------------DHRRLFLRVWLS-EGE-AVDSLFPIWKAANYLEREVYDLLGI
NQO5_THET8       LPGWKDG-----------DGSRFFVRVYVP-EEDPRLPTVTDLWGSANFLEREVYDLFGI
                                         :             .           * * :*: *:

NUOC_MYCBO       IFDGHPALTRIEMPDDWQGHPQRKDYPLGGIPVEYKGAQIPPPDERRGYN----------
NUOC_MYCUA       IFDGHPSLTRIEMPDDWQGHPQRKDYPLGGIPVEYKGAQIPPPDERRGYN----------
NUOC_MYCPA       VFDGHPSLTRIEMPDDWHGHPQRKDYPLGGIPVEYKGAQIPPPDERRAYN----------
NUOC_MYCSS       IFDGHPSLTRIEMPDDWVGHPQRKDYPLGGIPVEYHGARIPPPDERRAYN----------
NUOC_MYCVP       IFDGHPALTRIEMPDDWVGHPQRKDYPLGGIPVEYHGAEIPPPDERRAYS----------
NUOC_MYCGI       IFDGHPSLTRIEMPDDWVGHPQRKDYPLGGIPVEYHGAEIPPPDQRRAYN----------
NUOC_MYCS2       IFDGHPSLTRIEMPDDWEGHPQRKDYPLGGIPVEYHGAQIPPPDQRRSYS----------
NUOC_NOCFA       LFDGHPSLTRITMPDDWRGHPQRKDYPLGGIPVEYKGARIPPPDERRAYS----------
NUOC_RHOJR       VFDGHPSLTRIEMPDDWPGHPQRKDYPLGGIPVEYKGAEIAPPDERRGYN----------
NUOC_MYCA9       IFDDHPALTRIQMPDDWDGHPQRKDYPLGGVPVEYHGATIAPPDQRRSYN----------
NUOC_STRCO       VFDDHPALTRIMMPDDWQGFPQRKDYPLGGIPVEYKGAQIPAPDQRRSYS----------
NUOC_ACIC1       IFDGHPALTRILMPDDWPGHPQRKDYPLGGIPVEYKGATVPPPDERRQYA----------
NUOC_NOCSJ       IFDGHPALTRILMPDDWPGHPQRKDYPLGGVPVEYKGGTVPPPDQRRSYN----------
NUOC_SALAI       VFDGHPGLTRILMPDDWEGHPQRKDYPLGGVPVEYKGAEIPPPDRRRSYQ----------
NUOC_SACEN       VYDGHPALTRILMPDDWDGHPQRKDYPLGGIPVEYKGAEIPPPDQRRAYS----------
NUOC_CHLPD       LFSGHPDLRRILCPEDWEGFPLRKDYKVQETYHGIKVPY---------------------
NUOC_CHLT3       VFEGHPDMRRILCPDDWDGYPLRKDYKVQEVYHGIKVPY---------------------
NDHJ_PROMS       NFIDHPNPKRLLMPEDWRGWPLRKDYIQPDFYELQDAY----------------------
NDHJ_PROM2       NFIDHPNPTRLLMPEDWRGWPLRKDYIQPDFYELQDAY----------------------
NDHJ_PROM5       NFQDHPNPKRILMPEDWRGWPLRKDYIQPDFYELQDAY----------------------
NDHJ_PROMP       NFADHPNPTRLLMPEDWRGWPLRKDYIQPDFYELQDAY----------------------
NDHJ_SYNS3       HFEGHPHPKRLLMPEDWTGWPLRKDYVQPDFYEMQDAY----------------------
NDHJ_SYNPW       QFEGHPHPKRLLMPEDWTGWPLRKDYVQPDFYEMQDAY----------------------
NDHJ_SYNSC       QFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY----------------------
NDHJ_SYNPX       QFDGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY----------------------
NDHJ_SYNS9       EFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAF----------------------
NDHJ_PROMM       NFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY----------------------
NDHJ_PROMT       NFQGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY----------------------
NDHJ_PROM4       NFDGHPHPKRLLMPEDWRGWPLRKDYIQPDFYEMQDAY----------------------
NDHJ_SYNR3       NYSGHPHPKRLLMPEDWVGYPLRKDYVQPDFYELQDAY----------------------
NDHJ_PAUCH       SYEGHPHPKRLLMPEDWKGYPLRKDYIQPDFYEMQVAY----------------------
NDHJ_NOSS1       IYEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY----------------------
NDHJ_TRIV2       IYEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY----------------------
NDHJ_NOSP7       IYEGHPNLKRLLMPEDWVGWPLRKDYISPDFYELQDAY----------------------
NDHJ_CROS5       IYDGHPDLKRILMPEDWVGWPLRKDYVSPDFYELQDAY----------------------
NDHJ_MICAN       IYEGHPHLKRILMPEDWVGWPLRKDYVSPEFYELQDAY----------------------
NDHJ_SYNP2       VYEGHPNLKRILMPEDWIGWPLRKDYVSPDFYELQDAY----------------------
NDHJ_SYNY3       VYEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY----------------------
NDHJ_SYNP6       QFEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY----------------------
NDHJ_SYNJB       VFEGHPNLKRILMPEDWIGWPLRKDYITPDFYELQDAY----------------------
NDHJ_SYNJA       IFEGHPNLKRILMPEDWIGWPLRKDYITPDFYELQDAY----------------------
NDHJ_TRIEI       IYEGHPNLKRILMPEDWVGWPLRKDYISPEFYELQDAY----------------------
NDHJ_ACAM1       VYEGHPNLTRILMPEDWVGWPLRKDYISPDFYELQDAY----------------------
NDHJ_THEEB       VYEGHPNLKRILMPEDWVGWPLRKDYITPDFYELQEAY----------------------
NDHJ_GLOVI       IYEGHPNLIRILMPEDWVGWPMRKDYVTPDFYELQDAY----------------------
NDHJ_LACSA       SYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_TRACE       SYDNHPRLKRILMPDSWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_DAUCA       SYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_FAGEA       FYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY----------------------
NDHJ_PANGI       FYATHPRLKRILMPESWVGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_CITSI       LYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY----------------------
NDHJ_DRANE       TYDSHPRLKRILMPESWMGWPLRKDYIAPNFYEIQDAY----------------------
NDHJ_IPOPU       SYDNHPRLKRILMPESWIGWPLRKDYVAPHFYEIQDAH----------------------
NDHJ_OENPA       RYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_CUCSA       YYDNHPRLKRILMPESWVGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_POPTR       SYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_CICAR       SYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_MANES       FYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_SOYBN       SYDNHPRLRRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_PHAVU       SYDSHPRLRRILMPENWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_LOTJA       SYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH----------------------
NDHJ_LUPLU       SYYNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_PELHO       SYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_MORIN       SYNNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_BUXMI       SYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_ACOCL       SYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_CALFG       SYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_NYMAL       SYDNHPRMKRILMPESWIGWPLRKDYIAPNFYELQDAY----------------------
NDHJ_CERDE       SYDNHPRLKRILMPESWIGWPLRKDYIAPDFYEIQDAY----------------------
NDHJ_LIRTU       SYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY----------------------
NDHJ_AMBTC       YYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_DIOEL       SYANHPHLKRILMPESWIGWPLRKDYITPNFYEIQDAR----------------------
NDHJ_LEMMI       SYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH----------------------
NDHJ_ORYSJ       SYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH----------------------
NDHJ_PIPCE       SYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH----------------------
NDHJ_CRYJA       FYESHPCLKRILMPESWIGWPLRKDYIAPDFYEIQDSH----------------------
NDHJ_CYCTA       LHESHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH----------------------
NDHJ_ANGEV       IYESHPRLKRILMPESWIGWPLRKDYIVPNFYELQDAY----------------------
NDHJ_PSINU       HYESHPRLKRILMPESWIGWPLRKDYVVPNFYELQDAY----------------------
NDHJ_ANTAG       SYESHPRLKRILMPDSWIGWPLRKDYIVPNFYELQDAY----------------------
NDHJ_MARPO       FYENHPCLKRILMPDSWLGWPLRKDYIVPNFYELQDAY----------------------
NDHJ_PHYPA       SYENHPRLKRILMPDTWIGWPLRKDYIVPDFYELQDAY----------------------
NDHJ_STAPU       IYESHPHLKRILMPESWLGWPLRKDYITPDFFELQDAY----------------------
NDHJ_ZYGCR       VYKNHPHLKRILMPESWLGWPLRKDYITPDFYELQDAY----------------------
NDHJ_CHAGL       VYESHPNLKRILMPESWLGWPLRKDYITPDFYELQDAY----------------------
NDHJ_ADICA       IYQGHPYLRRILMPESWIGWPLRKDYVVPNFYELQDAY----------------------
NDHJ_MESVI       YYEGHPHLKRILMPEHWIGWPLRKDYITPDFYELQDAY----------------------
NDHJ_CHLAT       YYEGHPHLKRILMPENWVGWPLRKDYITPDFFELQDAY----------------------
NUOC_ROSDO       LFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFDFM
NUOC_RUEPO       LFTGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFDFM
NUOC_RUEST       LFTGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVKLVQEYRQFDFM
NUOC_DINSH       LFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEEKKRVVYEPVNLVQEYRQFDFM
NUOC_RHOS1       LFTGHPDLRRILTDYGFRGHPMRKDFPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFDFL
NUOC_RHOCA       LFSGHPDLRRLLTDYGFRGHPLRKDFPTTGYIELRYDEVQKRVVYEPVKLAQEYRQFDFL
NQO5_PARDE       LFSGHSDLRRILTDYGFRGHPLRKDFPTTGYVEVRWSDIEKRVVYEPVNLVQEYRQFDFL
NUOC_MARMM       VFADHPDLRRLLTDYGFEGYPLRKDFPLTGYVEVRWDEEEKRVVYEPVELVQEYRDFDFM
NUOC_PARL1       LFSDHPDLRRILTDYGFNGYPLRKDFPLTGYVEVRYDDDEKRVVYEPVKLVQEFRNFDFM
NUOC_RHORT       FFSEHPDLRRLLSDYGFEGHAQRKDFPLTGYKEVRYDEELKRVVYEPVRLSQDFRTFDFL
NUOC_MAGSA       LFSDHPDLRRILTDYGFEGHPLRKDFPLTGYVEMRYDDETKRVVYEPVKLTQDFRSFDFL
NUOC_HYPNA       QFADHPDLRRILTDYGFEGWPLRKDFPLTGHYEVRYDDLEKRVIYEPVKLAQEYRNFDFL
NUOC1_RHIME      LFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFDFL
NUOC_SINMW       LFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFDFL
NUOC_RHIL3       LFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFDFM
NUOC_AGRFC       PFEGHKDLRRILTDYGFEGHPLRKDFPVTGFVEVRYDDVLKRVLYEPVELKQEFRNFDFL
NUOC_AZOC5       LFTGHPELRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDELKRVVYEPVRLAQEFRNFDFL
NUOC_XANP2       LFTGHPELRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDEQKRVVYEPVRLPQEFRNFDFL
NUOC_BRUSI       LFSGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFL
NUOC_OCHA4       LFSGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFL
NUOC_RHILO       LFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDDEAKRVIYEPVELKQEFRNFDFL
NUOC_CHESB       LFTEHPDLRRILTDYGFEGHPLRKDFPLTGFVEVHYDDEAKRVVYQPVNLRQEFRNFDFL
NUOC_METEP       LFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFL
NUOC_METPB       LFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFL
NUOC_METRJ       LFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDQARVVYEPVQLTQEFRNFDFL
NUOC_METS4       LFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEGRVVYEPVKLSQEFRQFDFL
NUOC_BARHE       LFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFDFL
NUOC_BARQU       LFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFDFL
NUOC_BART1       LFSGHPDLRRILTDYGFEGYPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFDFL
NUOC_BARBK       LFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFDFL
NUOC_RHOPT       VITGHPDMRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDDQKRVIYEPVRLNQEFRKFDFL
NUOC_RHOPB       IFTGHPDMRRILTDYGFDGHPLRKDFPLSGFVEVRYDDDEKRVVYEPVRLNQEFRKFDFL
NUOC_CAUVC       FFDGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKIT-EFRAFDFL
NUOC_CAUSK       FFDGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKIT-EFRAFDFL
NUOC_PHEZH       FFDGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKSV-EWRNWDFL
NUOC_ERYLH       LFDGNTDLRRILTDYGFEGHPFRKDFPLTGYTELRYSEEEQRVVYEPVELAQDLRTFDFL
NUOC_NOVAD       LFAGNPDLRRILTDYGFQGHPFRKDFPLTGYVELRYSEEDKRVVYEPVQLAQDLRQFDFM
NUOC_WOLTR       EFSNHPDLRRILTDYGFKGHPMLKDFPLTGYEEVRYDIEAKKVVYNPIDLPQDFRMFDSL
NUOC_NEOSM       VFEGHPDLRRILTDYEFEGFPMLKDFPLTGYKEVRYDLESKEVVYEKVDLSQDYRSFDSL
NUOC_RICBR       NFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQVKYDEQTKKVAYEPVNLDIEYREFDFS
NUOC_RICFE       NFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFS
NUOC_RICPR       NFNGNNDKRRILTDYDFEGHPLRKDFPLTGYTQVKYDKKLEKVTYEPVNLDIEYREFDFS
NUOC_RICTY       NFNGNNDKRRILTDYDFEGHPLRKDFPLTGYTQVKYDKKLKKIAYEPVNLDIEYREFDFS
NUOC2_RHIME      RFEGHPDLRRIYMWEGFEGFPQRKDFPLRGYKDKLNPFGAE----GPPPTQPDLATNDIP
NUOC2_RHIE6      RFAGHPDLRRIYMWEGFEGFPQRKDFPLRGYKDKLNPFGAE----GPPPTQPDLATRDIP
NUOC_ROSCS       VFTGHPCLDRILMPEDWEGHPLRKDVPL-GAEEVAFTFNQDR-IYAHKPFAKE-------
NUOC_ROSS1       IFTGHPCLERILMPEDWEGHPLRKDVPL-GAEEVAFTFNQDR-IYAHKPFAKE-------
NUOC_HERA2       IFTGHPGLERILMPEDWLGHPQRKDHPL-GYEEVAFTHNEDW-IYANKPFAKE-------
NUOC_NEIM0       MFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVT-IEPREITPRI
NUOC_NEIG2       MFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVT-IEPREITPRI
NUOC_AZOSB       LYAGHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDPEQGRVVYQPVT-IEPRENTPRI
NUOC_AROAE       MFAGHPDLRRILTDYGFVGHPFRKDFPVSGYVEMRYDPEQGRVVYQPVT-IEPRENTPRI
NUOC_DECAR       AFVGHDDLRRILTDYGFIGHPFRKDFPISGHVEMRYDPDQARVIYQPVT-IEPRENTPRI
NUOC_BURA4       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_BURVG       VFEGHPDLRRLLTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_BURL3       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_BURM1       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_BURTA       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_PARXL       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_PARP8       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT-IEPREITPRV
NUOC_RALPJ       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVVYQPVT-IEPREITPRV
NUOC_RALSO       VFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVIYQPVT-IEPREITPRV
NUOC_CUPTR       VFDGHPDLRRILTDYGFVGHPFRKDFPVSGFVEMRYDPDQKRVIYQPVT-IEPRELTPRV
NUOC_CUPNH       VFDGHPDLRRILTDYGFVGHPFRKDFPVSGFVEMRYDPEQKRVIYQPVT-IEPREITPRV
NUOC_CUPPJ       VFEGHPDLRRLLTDYGFVGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVT-IEPREITPRV
NUOC_CUPMC       VFEGHPDLRRILTDYGFVGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVT-IEPREVTPRV
NUOC_POLNS       LFDGHDDLRRILTDYGFIGHPFRKDFPISGNVEMRYDPELKRVIYQPVT-IEAREITPRI
NUOC_POLAQ       IFEGHEDLRRILTDYGFIGHPFRKDFPISGNVEMRYDPELKRVVYQPVT-IEAREITPRI
NUOC_HERAR       LFEGHNDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVT-IDPRENVPRV
NUOC_JANMA       LFEGHNDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVT-IDPRENVPRV
NUOC_THIDA       VFEGHPDLRRILTDYGFIGHPFRKDFPLSGNVEMRYDPTQQRVIYQPVS-IEPRDNVPRV
NUOC_CHRVO       VFEGHPDLRRLLTDYGFVGHPFRKDFPLSGYVEMRYDPTQQRVIYQPVT-IEPREITPRI
NUOC_ACIAC       VFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDTEARRVVYEPVT-IEPREITPRI
NUOC_ACISJ       VFDGHNDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDADQRRVIYEPVT-IEPREVTPRV
NUOC_DELAS       VFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDPEQQRVVYQPVT-IEPREITPRI
NUOC_VEREI       LFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVQMRYDAELRRVVYEPVS-IEPREITPRI
NUOC_RHOFT       VFEGHADLRRILTDYGFVGHPFRKDFPVSGHVEMRYDAELKRVVYQPVT-IEPREITPRI
NUOC_POLNA       VFEGHNDLRRILTDYGFIGHPFRKDFPTTGHVEMRYDAEQKRVIYQPVT-IEPREMIPRV
NUOC_POLSJ       IFEGHNDLRRILTDYGFIGHPFRKDFPTTGYVEMRYDAEQKRVIYQPVT-IEPREITPRV
NUOC_LEPCP       VFDGHTDLRRILTDYGFIGHPMRKDFPVTGHVEMRYDPEQKRVIYQPVS-IEPREITPRI
NUOC_METPP       VFEGHADLRRILTDYGFIGHPFRKDFPTTGHVEMRYDAEQRRVIYQPVT-IEPREITPRI
NUOC_NITEU       IFNNHPDLRRILTDYGFIGNPFRKDFPLSGHVEMRYDPDQKRVVYQPVT-IEPREITPYV
NUOC_NITEC       VFNNHPDLRRILTDYGFIGNPFRKDFPLSGHMEMQYDPEQKRVIYQPIT-IEPREITPYI
NUOC_NITMU       VFTGHPDLRRILTDYGFIGNPFRKDFPLSGNVEMRYDPDQQRVVYQPVT-IEPRQITPRV
NUOC_BORPA       VFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKRVIYQPVT-IDPREITPRV
NUOC_BORA1       VFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKRVIYQPVT-IDPREITPRI
NUOC_BORPD       VFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQRRVIYQPVT-IDPREITPRV
NUOC_ALKEH       IFDGHPDLRRILTDYGFVGHPFRKDFPLIGNVEVRYDEQKRRVIYQPVS-IEPRVLVPRV
NUOC_HALHL       VFEGHPDLRRILTDYGFVGHPFRKDFPLIGNVEPRYDPEKGRVVYGPVE-IEPRVLVPRV
NUOC_METFK       MYEGHPDLRRLLTDYGFVGHPFRKDFPMIGNVEMRYDPERQRVVYQPVT-IDPRNNVPRV
NUOC_ACIF5       LFDGHPDLRRILTDYGFVGHPFRKDFPLVGTVEMRYDADQGRVVYEPTR-TEERVVVPRI
NUOC_HYDCU       LFNGHPDLRRILTDYGFVGHPLRKDFPLTGHVEMRYDAEKGRVVYEPVT-IENRVNVPRV
NUOC_LEGPA       LFDGHPDLRRLLTDYGFIGHPFRKDFPLSGEVEMRYDAKLQKVIYAPVD-IVPRIVVPKV
NUOC_NITOC       LFEGHPDLRRILTDYGFIGHPFRKDFPLSGNVEMRYDPEQQRVIYEPVS-IEPRVLVPRV
NUOC_COXBR       VFEGHPDLRRLLTDYGFVGHPFRKDFPLIGEVELRYDAAQQRCVYEPVS-IQPRVLVPKV
NUOC_XANOP       VFDGHPDLRRILTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPVTSVEPRVGVPRV
NUOC_XANCB       VFDGHPDLRRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPVTSVEPRVGVPRV
NUOC_STRM5       IFEGHPDLRRILTDYGFVGHPFRKDFPLIGNVEVRYDEEKKRVIYEPVTSVEPRVGVPRV
NUOC_XYLFA       VFEGHPDLRRILTDYGFIGHPFRKDFPLTGNVEVRYDEEKKRVVYVPVTSVEPRVSVPRV
NUOC_RUTMC       LFENHTDLRRILTDYGFKGHPLRKDFPMIGEVEMRYDEDLGRVVYEKVS-IEPNINVPRV
NUOC_VESOH       LFENHTDLRRILTDYGFTGHPLRKDFPMIGEVEMRYDEDLCRVIYEKVS-IEPNVNVPRV
NUOC_FRATW       YFNNHPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVE-IDDRVNTPRV
NUOC_FRAP2       YFNNHPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGKVVYEPVE-IDDRVNAPRV
NUOC_GEOMG       VFNNHPDLRRILMTDDWVGHPLRKDYPLQGPGREPYKGRLS-------------------
NUOC_GEOSL       QFNNHPDLRRILMTDDWVGHPLRKDYPLQGPDREPYKGRLS-------------------
NUOC_GEOUR       IFKNHPDLRRIMMTDDWVGHPLRKDYPLQGPDREPYKGRLS-------------------
NUOC_GEOBB       DFKNHPNLVRILMTDDWVGHPLRKDYPLQGPDREPYKGRLS-------------------
NUOC_GEOLS       RFDKHPDLRRILMTPDWEGHPLRKDYPLQGPGREPYKGRLS-------------------
NUOC_MOOTA       KFPGHPDLKRILCPDDFVGHPLRKDFRLQTEGGE--------------------------
NUOC_DEIGD       EFVGHPDLRKILTPDDLEGHPLRKDFPLGESPTLFREGRFIDPPAFRAGLSGQNAGLTGW
NUOC_DEIRA       EFTGHPDLRKVLTPDDLEGHPLRKDFPLGETPTLFREGRFLDPAAFRAGLSGQQRGLTGY
NQO5_THET8       VFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFY
                     :    ::       * .  **                                   

NUOC_MYCBO       ------------------------------------------------------------
NUOC_MYCUA       ------------------------------------------------------------
NUOC_MYCPA       ------------------------------------------------------------
NUOC_MYCSS       ------------------------------------------------------------
NUOC_MYCVP       ------------------------------------------------------------
NUOC_MYCGI       ------------------------------------------------------------
NUOC_MYCS2       ------------------------------------------------------------
NUOC_NOCFA       ------------------------------------------------------------
NUOC_RHOJR       ------------------------------------------------------------
NUOC_MYCA9       ------------------------------------------------------------
NUOC_STRCO       ------------------------------------------------------------
NUOC_ACIC1       ------------------------------------------------------------
NUOC_NOCSJ       ------------------------------------------------------------
NUOC_SALAI       ------------------------------------------------------------
NUOC_SACEN       ------------------------------------------------------------
NUOC_CHLPD       ------------------------------------------------------------
NUOC_CHLT3       ------------------------------------------------------------
NDHJ_PROMS       ------------------------------------------------------------
NDHJ_PROM2       ------------------------------------------------------------
NDHJ_PROM5       ------------------------------------------------------------
NDHJ_PROMP       ------------------------------------------------------------
NDHJ_SYNS3       ------------------------------------------------------------
NDHJ_SYNPW       ------------------------------------------------------------
NDHJ_SYNSC       ------------------------------------------------------------
NDHJ_SYNPX       ------------------------------------------------------------
NDHJ_SYNS9       ------------------------------------------------------------
NDHJ_PROMM       ------------------------------------------------------------
NDHJ_PROMT       ------------------------------------------------------------
NDHJ_PROM4       ------------------------------------------------------------
NDHJ_SYNR3       ------------------------------------------------------------
NDHJ_PAUCH       ------------------------------------------------------------
NDHJ_NOSS1       ------------------------------------------------------------
NDHJ_TRIV2       ------------------------------------------------------------
NDHJ_NOSP7       ------------------------------------------------------------
NDHJ_CROS5       ------------------------------------------------------------
NDHJ_MICAN       ------------------------------------------------------------
NDHJ_SYNP2       ------------------------------------------------------------
NDHJ_SYNY3       ------------------------------------------------------------
NDHJ_SYNP6       ------------------------------------------------------------
NDHJ_SYNJB       ------------------------------------------------------------
NDHJ_SYNJA       ------------------------------------------------------------
NDHJ_TRIEI       ------------------------------------------------------------
NDHJ_ACAM1       ------------------------------------------------------------
NDHJ_THEEB       ------------------------------------------------------------
NDHJ_GLOVI       ------------------------------------------------------------
NDHJ_LACSA       ------------------------------------------------------------
NDHJ_TRACE       ------------------------------------------------------------
NDHJ_DAUCA       ------------------------------------------------------------
NDHJ_FAGEA       ------------------------------------------------------------
NDHJ_PANGI       ------------------------------------------------------------
NDHJ_CITSI       ------------------------------------------------------------
NDHJ_DRANE       ------------------------------------------------------------
NDHJ_IPOPU       ------------------------------------------------------------
NDHJ_OENPA       ------------------------------------------------------------
NDHJ_CUCSA       ------------------------------------------------------------
NDHJ_POPTR       ------------------------------------------------------------
NDHJ_CICAR       ------------------------------------------------------------
NDHJ_MANES       ------------------------------------------------------------
NDHJ_SOYBN       ------------------------------------------------------------
NDHJ_PHAVU       ------------------------------------------------------------
NDHJ_LOTJA       ------------------------------------------------------------
NDHJ_LUPLU       ------------------------------------------------------------
NDHJ_PELHO       ------------------------------------------------------------
NDHJ_MORIN       ------------------------------------------------------------
NDHJ_BUXMI       ------------------------------------------------------------
NDHJ_ACOCL       ------------------------------------------------------------
NDHJ_CALFG       ------------------------------------------------------------
NDHJ_NYMAL       ------------------------------------------------------------
NDHJ_CERDE       ------------------------------------------------------------
NDHJ_LIRTU       ------------------------------------------------------------
NDHJ_AMBTC       ------------------------------------------------------------
NDHJ_DIOEL       ------------------------------------------------------------
NDHJ_LEMMI       ------------------------------------------------------------
NDHJ_ORYSJ       ------------------------------------------------------------
NDHJ_PIPCE       ------------------------------------------------------------
NDHJ_CRYJA       ------------------------------------------------------------
NDHJ_CYCTA       ------------------------------------------------------------
NDHJ_ANGEV       ------------------------------------------------------------
NDHJ_PSINU       ------------------------------------------------------------
NDHJ_ANTAG       ------------------------------------------------------------
NDHJ_MARPO       ------------------------------------------------------------
NDHJ_PHYPA       ------------------------------------------------------------
NDHJ_STAPU       ------------------------------------------------------------
NDHJ_ZYGCR       ------------------------------------------------------------
NDHJ_CHAGL       ------------------------------------------------------------
NDHJ_ADICA       ------------------------------------------------------------
NDHJ_MESVI       ------------------------------------------------------------
NDHJ_CHLAT       ------------------------------------------------------------
NUOC_ROSDO       SPWEGAEY------ILPGDEKKE-------------------------------------
NUOC_RUEPO       SPWEGADY------ILPGDEKKEG------------------------------------
NUOC_RUEST       SPWEGAEY------ILPGDEKEIAK-----------------------------------
NUOC_DINSH       SPWEGAEY------ILPGDEKTDDKAEAKG------------------------------
NUOC_RHOS1       SPWEGADY------ILPGDDKART------------------------------------
NUOC_RHOCA       SPWEGAQS------VLPGDEKRS-------------------------------------
NQO5_PARDE       SPWEGAKY------VLPGDEKAPEAKK---------------------------------
NUOC_MARMM       SPWEGAKY------ILPGDEKAEG------------------------------------
NUOC_PARL1       SPWEGAEY------LLPGDEKAEH------------------------------------
NUOC_RHORT       SPWEGMDRQIR--RVLPGDEKAEGNA----------------------------------
NUOC_MAGSA       SPWEGPGM-------LPGDEKAN-------------------------------------
NUOC_HYPNA       SPWEGMTT------VIPGDEKAKEG-----------------------------------
NUOC1_RHIME      SPWEGTEYV------LPGDEKARPR-----------------------------------
NUOC_SINMW       SPWEGTEYV------LPGDEKAKSR-----------------------------------
NUOC_RHIL3       SPWEGTEYV------LPGDEKAKQ------------------------------------
NUOC_AGRFC       SPWEGTEYV------LPGDEKAKQ------------------------------------
NUOC_AZOC5       SPWEGVEYI------LPGDEKASSQPGAPAAPKAS-------------------------
NUOC_XANP2       SPWEGVEYV------LPGDEKASGQP--PVPPKAG-------------------------
NUOC_BRUSI       SPWEGTDYV------LPGDEKAKTN-----------------------------------
NUOC_OCHA4       SPWEGTDYV------LPGDEKAKAN-----------------------------------
NUOC_RHILO       SPWEGTDYV------LPGDEKAKTN-----------------------------------
NUOC_CHESB       SPWEGTDYV------LPGDEKAKQ------------------------------------
NUOC_METEP       SPWEGTDYV------LPGDEKTSS------------------------------------
NUOC_METPB       SPWEGTDYV------LPGDEKKSS------------------------------------
NUOC_METRJ       SPWEGTDYV------LPGDEKTSA------------------------------------
NUOC_METS4       SPWEGTDYV------LPGDEKAKP------------------------------------
NUOC_BARHE       SPWEGAQYI------LPCDEKTKDKR----------------------------------
NUOC_BARQU       SPWEGAQYV------LPCNEKAEGEK----------------------------------
NUOC_BART1       SPWEGGQYV------LPCDGKEDEKK----------------------------------
NUOC_BARBK       SPWEGADYV------LPCDKKAKGNGDK--------------------------------
NUOC_RHOPT       SPWEGADYPV-----LPGDEKAGVKS----------------------------------
NUOC_RHOPB       SPWEGADYP------LPGDEKRSE------------------------------------
NUOC_CAUVC       SPWEGAKYA------LPGDEKAQ-------------------------------------
NUOC_CAUSK       SPWEGAKYA------LPGDEKAEKRAGDA-------------------------------
NUOC_PHEZH       SPWEGVERGFA--PILPGDEKGEEAKS---------------------------------
NUOC_ERYLH       SPWEGMTPP------LPGDEKADMPP-----------------IDDPMVTEGPEDTGAGA
NUOC_NOVAD       SPWEGADYV------LPGDEKAVPPPPAPAPVATAPETKGDAKADVPKTTEQPADTGAGE
NUOC_WOLTR       SPWEGETAK--------ANTKE--------------------------------------
NUOC_NEOSM       TPWKGVGRP-----SDPFDGRKE-------------------------------------
NUOC_RICBR       SPWHSPTYT------LPGDEKAK-------------------------------------
NUOC_RICFE       SHWHSPSYV------LPGDEKATDVIPAKAGIQK--------------------------
NUOC_RICPR       SHWHSPSYV------LPGDEKTEE------------------------------------
NUOC_RICTY       SHWHSPSYI------LPGDEKAEK------------------------------------
NUOC2_RHIME      QGGR--------------------------------------------------------
NUOC2_RHIE6      QGRPSTPES---------------------------------------------------
NUOC_ROSCS       ------------------------------------------------------------
NUOC_ROSS1       ------------------------------------------------------------
NUOC_HERA2       ------------------------------------------------------------
NUOC_NEIM0       VREEN-----------YGGQ----------------------------------------
NUOC_NEIG2       VREEN-----------YGGQ----------------------------------------
NUOC_AZOSB       VREEN-----------YGDVGHG-------------------------------------
NUOC_AROAE       VREEN-----------YGDVGNG-------------------------------------
NUOC_DECAR       VREDT-----------FGDTAHG-------------------------------------
NUOC_BURA4       IREDR-----------YGGLKH--------------------------------------
NUOC_BURVG       IREDR-----------YGGLKH--------------------------------------
NUOC_BURL3       IREDR-----------YGGLKH--------------------------------------
NUOC_BURM1       IREDR-----------YGGLKH--------------------------------------
NUOC_BURTA       IREDR-----------YGGLKH--------------------------------------
NUOC_PARXL       IREDR-----------YGGLKH--------------------------------------
NUOC_PARP8       IREDR-----------YGGLKH--------------------------------------
NUOC_RALPJ       IREDQ-----------YGGLKH--------------------------------------
NUOC_RALSO       IREDQ-----------YGGLKH--------------------------------------
NUOC_CUPTR       IREDK-----------YGGVEH--------------------------------------
NUOC_CUPNH       IREDN-----------YGGLH---------------------------------------
NUOC_CUPPJ       IREEN-----------YGGTQH--------------------------------------
NUOC_CUPMC       IREEN-----------YGGTQH--------------------------------------
NUOC_POLNS       VREEQ-----------YGGPV---------------------------------------
NUOC_POLAQ       VREEQ-----------YGDPV---------------------------------------
NUOC_HERAR       IREEQ-----------YGMK----------------------------------------
NUOC_JANMA       IREEQ-----------YGAK----------------------------------------
NUOC_THIDA       VRDES-----------YGDGRA--------------------------------------
NUOC_CHRVO       IREEN-----------YGG-----------------------------------------
NUOC_ACIAC       IREEK-----------YGGLH---------------------------------------
NUOC_ACISJ       IREDK-----------YGGLH---------------------------------------
NUOC_DELAS       IREDN-----------YGGLH---------------------------------------
NUOC_VEREI       IREDH-----------YADPH---------------------------------------
NUOC_RHOFT       IREDN-----------YGGLH---------------------------------------
NUOC_POLNA       IREDN-----------YGGLQ---------------------------------------
NUOC_POLSJ       IREDN-----------YGGLQ---------------------------------------
NUOC_LEPCP       IREDN-----------YGGLH---------------------------------------
NUOC_METPP       IREDN-----------YGGLH---------------------------------------
NUOC_NITEU       IREEQ-----------YGREEI--------------------------------------
NUOC_NITEC       IREEQ-----------YGKEET--------------------------------------
NUOC_NITMU       IREEH-----------YGDSE---------------------------------------
NUOC_BORPA       VREGS-----------YGMGR---------------------------------------
NUOC_BORA1       VRESS-----------YGMGR---------------------------------------
NUOC_BORPD       VREDS-----------YGLGR---------------------------------------
NUOC_ALKEH       VREDNRYADRKRRE--EGASDA--------------------------------------
NUOC_HALHL       IREDNRYAAPQKAEGTEGQADG--------------------------------------
NUOC_METFK       IRE-------------EGFHHG--------------------------------------
NUOC_ACIF5       IREAG--------EGRYNARNQ--------------------------------------
NUOC_HYDCU       IRNDVE---------PKG------------------------------------------
NUOC_LEGPA       IRNDNRYI------GNEGSKND--------------------------------------
NUOC_NITOC       IRDDHRYQIK--ASGDEGGHG---------------------------------------
NUOC_COXBR       IRVDSRYE------KGEKENG---------------------------------------
NUOC_XANOP       IRDDARYETAAGEVGRSETAK---------------------------------------
NUOC_XANCB       IRDDARYETAAGEVGKSETAK---------------------------------------
NUOC_STRM5       IRDDARLQTAEGER-AQEAVK---------------------------------------
NUOC_XYLFA       IRDDARFGAAAGESTHSETVK---------------------------------------
NUOC_RUTMC       IRK---------------------------------------------------------
NUOC_VESOH       IRK---------------------------------------------------------
NUOC_FRATW       IRN---------------------------------------------------------
NUOC_FRAP2       IRNQ--------------------------------------------------------
NUOC_GEOMG       ------------------------------------------------------------
NUOC_GEOSL       ------------------------------------------------------------
NUOC_GEOUR       ------------------------------------------------------------
NUOC_GEOBB       ------------------------------------------------------------
NUOC_GEOLS       ------------------------------------------------------------
NUOC_MOOTA       ------------------------------------------------------------
NUOC_DEIGD       RGEFRRGERGDRVPPVLPEGGPQ-------------------------------------
NUOC_DEIRA       RGEMRRGERRREDIVPPLLPEGGPK-----------------------------------
NQO5_THET8       KGGSRKGYRSLWADLKKAREVKG-------------------------------------
                                                                             

NUOC_MYCBO       ------------------------------------------------------------
NUOC_MYCUA       ------------------------------------------------------------
NUOC_MYCPA       ------------------------------------------------------------
NUOC_MYCSS       ------------------------------------------------------------
NUOC_MYCVP       ------------------------------------------------------------
NUOC_MYCGI       ------------------------------------------------------------
NUOC_MYCS2       ------------------------------------------------------------
NUOC_NOCFA       ------------------------------------------------------------
NUOC_RHOJR       ------------------------------------------------------------
NUOC_MYCA9       ------------------------------------------------------------
NUOC_STRCO       ------------------------------------------------------------
NUOC_ACIC1       ------------------------------------------------------------
NUOC_NOCSJ       ------------------------------------------------------------
NUOC_SALAI       ------------------------------------------------------------
NUOC_SACEN       ------------------------------------------------------------
NUOC_CHLPD       ------------------------------------------------------------
NUOC_CHLT3       ------------------------------------------------------------
NDHJ_PROMS       ------------------------------------------------------------
NDHJ_PROM2       ------------------------------------------------------------
NDHJ_PROM5       ------------------------------------------------------------
NDHJ_PROMP       ------------------------------------------------------------
NDHJ_SYNS3       ------------------------------------------------------------
NDHJ_SYNPW       ------------------------------------------------------------
NDHJ_SYNSC       ------------------------------------------------------------
NDHJ_SYNPX       ------------------------------------------------------------
NDHJ_SYNS9       ------------------------------------------------------------
NDHJ_PROMM       ------------------------------------------------------------
NDHJ_PROMT       ------------------------------------------------------------
NDHJ_PROM4       ------------------------------------------------------------
NDHJ_SYNR3       ------------------------------------------------------------
NDHJ_PAUCH       ------------------------------------------------------------
NDHJ_NOSS1       ------------------------------------------------------------
NDHJ_TRIV2       ------------------------------------------------------------
NDHJ_NOSP7       ------------------------------------------------------------
NDHJ_CROS5       ------------------------------------------------------------
NDHJ_MICAN       ------------------------------------------------------------
NDHJ_SYNP2       ------------------------------------------------------------
NDHJ_SYNY3       ------------------------------------------------------------
NDHJ_SYNP6       ------------------------------------------------------------
NDHJ_SYNJB       ------------------------------------------------------------
NDHJ_SYNJA       ------------------------------------------------------------
NDHJ_TRIEI       ------------------------------------------------------------
NDHJ_ACAM1       ------------------------------------------------------------
NDHJ_THEEB       ------------------------------------------------------------
NDHJ_GLOVI       ------------------------------------------------------------
NDHJ_LACSA       ------------------------------------------------------------
NDHJ_TRACE       ------------------------------------------------------------
NDHJ_DAUCA       ------------------------------------------------------------
NDHJ_FAGEA       ------------------------------------------------------------
NDHJ_PANGI       ------------------------------------------------------------
NDHJ_CITSI       ------------------------------------------------------------
NDHJ_DRANE       ------------------------------------------------------------
NDHJ_IPOPU       ------------------------------------------------------------
NDHJ_OENPA       ------------------------------------------------------------
NDHJ_CUCSA       ------------------------------------------------------------
NDHJ_POPTR       ------------------------------------------------------------
NDHJ_CICAR       ------------------------------------------------------------
NDHJ_MANES       ------------------------------------------------------------
NDHJ_SOYBN       ------------------------------------------------------------
NDHJ_PHAVU       ------------------------------------------------------------
NDHJ_LOTJA       ------------------------------------------------------------
NDHJ_LUPLU       ------------------------------------------------------------
NDHJ_PELHO       ------------------------------------------------------------
NDHJ_MORIN       ------------------------------------------------------------
NDHJ_BUXMI       ------------------------------------------------------------
NDHJ_ACOCL       ------------------------------------------------------------
NDHJ_CALFG       ------------------------------------------------------------
NDHJ_NYMAL       ------------------------------------------------------------
NDHJ_CERDE       ------------------------------------------------------------
NDHJ_LIRTU       ------------------------------------------------------------
NDHJ_AMBTC       ------------------------------------------------------------
NDHJ_DIOEL       ------------------------------------------------------------
NDHJ_LEMMI       ------------------------------------------------------------
NDHJ_ORYSJ       ------------------------------------------------------------
NDHJ_PIPCE       ------------------------------------------------------------
NDHJ_CRYJA       ------------------------------------------------------------
NDHJ_CYCTA       ------------------------------------------------------------
NDHJ_ANGEV       ------------------------------------------------------------
NDHJ_PSINU       ------------------------------------------------------------
NDHJ_ANTAG       ------------------------------------------------------------
NDHJ_MARPO       ------------------------------------------------------------
NDHJ_PHYPA       ------------------------------------------------------------
NDHJ_STAPU       ------------------------------------------------------------
NDHJ_ZYGCR       ------------------------------------------------------------
NDHJ_CHAGL       ------------------------------------------------------------
NDHJ_ADICA       ------------------------------------------------------------
NDHJ_MESVI       ------------------------------------------------------------
NDHJ_CHLAT       ------------------------------------------------------------
NUOC_ROSDO       ------------------------------------------------------------
NUOC_RUEPO       ------------------------------------------------------------
NUOC_RUEST       ------------------------------------------------------------
NUOC_DINSH       ------------------------------------------------------------
NUOC_RHOS1       ------------------------------------------------------------
NUOC_RHOCA       ------------------------------------------------------------
NQO5_PARDE       ------------------------------------------------------------
NUOC_MARMM       ------------------------------------------------------------
NUOC_PARL1       ------------------------------------------------------------
NUOC_RHORT       ------------------------------------------------------------
NUOC_MAGSA       ------------------------------------------------------------
NUOC_HYPNA       ------------------------------------------------------------
NUOC1_RHIME      ------------------------------------------------------------
NUOC_SINMW       ------------------------------------------------------------
NUOC_RHIL3       ------------------------------------------------------------
NUOC_AGRFC       ------------------------------------------------------------
NUOC_AZOC5       ------------------------------------------------------------
NUOC_XANP2       ------------------------------------------------------------
NUOC_BRUSI       ------------------------------------------------------------
NUOC_OCHA4       ------------------------------------------------------------
NUOC_RHILO       ------------------------------------------------------------
NUOC_CHESB       ------------------------------------------------------------
NUOC_METEP       ------------------------------------------------------------
NUOC_METPB       ------------------------------------------------------------
NUOC_METRJ       ------------------------------------------------------------
NUOC_METS4       ------------------------------------------------------------
NUOC_BARHE       ------------------------------------------------------------
NUOC_BARQU       ------------------------------------------------------------
NUOC_BART1       ------------------------------------------------------------
NUOC_BARBK       ------------------------------------------------------------
NUOC_RHOPT       ------------------------------------------------------------
NUOC_RHOPB       ------------------------------------------------------------
NUOC_CAUVC       ------------------------------------------------------------
NUOC_CAUSK       ------------------------------------------------------------
NUOC_PHEZH       ------------------------------------------------------------
NUOC_ERYLH       RANAKAAE---------GTPADPPAMDDEEEDDA--------------------------
NUOC_NOVAD       KANDAAAKPVAEAAAPAATKTDEPAAPEPTEDRPARKPRAKKVADTEGATEPAAKPKRTR
NUOC_WOLTR       ------------------------------------------------------------
NUOC_NEOSM       ------------------------------------------------------------
NUOC_RICBR       ------------------------------------------------------------
NUOC_RICFE       ------------------------------------------------------------
NUOC_RICPR       ------------------------------------------------------------
NUOC_RICTY       ------------------------------------------------------------
NUOC2_RHIME      ------------------------------------------------------------
NUOC2_RHIE6      ------------------------------------------------------------
NUOC_ROSCS       ------------------------------------------------------------
NUOC_ROSS1       ------------------------------------------------------------
NUOC_HERA2       ------------------------------------------------------------
NUOC_NEIM0       ------------------------------------------------------------
NUOC_NEIG2       ------------------------------------------------------------
NUOC_AZOSB       ------------------------------------------------------------
NUOC_AROAE       ------------------------------------------------------------
NUOC_DECAR       ------------------------------------------------------------
NUOC_BURA4       ------------------------------------------------------------
NUOC_BURVG       ------------------------------------------------------------
NUOC_BURL3       ------------------------------------------------------------
NUOC_BURM1       ------------------------------------------------------------
NUOC_BURTA       ------------------------------------------------------------
NUOC_PARXL       ------------------------------------------------------------
NUOC_PARP8       ------------------------------------------------------------
NUOC_RALPJ       ------------------------------------------------------------
NUOC_RALSO       ------------------------------------------------------------
NUOC_CUPTR       ------------------------------------------------------------
NUOC_CUPNH       ------------------------------------------------------------
NUOC_CUPPJ       ------------------------------------------------------------
NUOC_CUPMC       ------------------------------------------------------------
NUOC_POLNS       ------------------------------------------------------------
NUOC_POLAQ       ------------------------------------------------------------
NUOC_HERAR       ------------------------------------------------------------
NUOC_JANMA       ------------------------------------------------------------
NUOC_THIDA       ------------------------------------------------------------
NUOC_CHRVO       ------------------------------------------------------------
NUOC_ACIAC       ------------------------------------------------------------
NUOC_ACISJ       ------------------------------------------------------------
NUOC_DELAS       ------------------------------------------------------------
NUOC_VEREI       ------------------------------------------------------------
NUOC_RHOFT       ------------------------------------------------------------
NUOC_POLNA       ------------------------------------------------------------
NUOC_POLSJ       ------------------------------------------------------------
NUOC_LEPCP       ------------------------------------------------------------
NUOC_METPP       ------------------------------------------------------------
NUOC_NITEU       ------------------------------------------------------------
NUOC_NITEC       ------------------------------------------------------------
NUOC_NITMU       ------------------------------------------------------------
NUOC_BORPA       ------------------------------------------------------------
NUOC_BORA1       ------------------------------------------------------------
NUOC_BORPD       ------------------------------------------------------------
NUOC_ALKEH       ------------------------------------------------------------
NUOC_HALHL       ------------------------------------------------------------
NUOC_METFK       ------------------------------------------------------------
NUOC_ACIF5       ------------------------------------------------------------
NUOC_HYDCU       ------------------------------------------------------------
NUOC_LEGPA       ------------------------------------------------------------
NUOC_NITOC       ------------------------------------------------------------
NUOC_COXBR       ------------------------------------------------------------
NUOC_XANOP       ------------------------------------------------------------
NUOC_XANCB       ------------------------------------------------------------
NUOC_STRM5       ------------------------------------------------------------
NUOC_XYLFA       ------------------------------------------------------------
NUOC_RUTMC       ------------------------------------------------------------
NUOC_VESOH       ------------------------------------------------------------
NUOC_FRATW       ------------------------------------------------------------
NUOC_FRAP2       ------------------------------------------------------------
NUOC_GEOMG       ------------------------------------------------------------
NUOC_GEOSL       ------------------------------------------------------------
NUOC_GEOUR       ------------------------------------------------------------
NUOC_GEOBB       ------------------------------------------------------------
NUOC_GEOLS       ------------------------------------------------------------
NUOC_MOOTA       ------------------------------------------------------------
NUOC_DEIGD       ------------------------------------------------------------
NUOC_DEIRA       ------------------------------------------------------------
NQO5_THET8       ------------------------------------------------------------
                                                                             

NUOC_MYCBO       -------
NUOC_MYCUA       -------
NUOC_MYCPA       -------
NUOC_MYCSS       -------
NUOC_MYCVP       -------
NUOC_MYCGI       -------
NUOC_MYCS2       -------
NUOC_NOCFA       -------
NUOC_RHOJR       -------
NUOC_MYCA9       -------
NUOC_STRCO       -------
NUOC_ACIC1       -------
NUOC_NOCSJ       -------
NUOC_SALAI       -------
NUOC_SACEN       -------
NUOC_CHLPD       -------
NUOC_CHLT3       -------
NDHJ_PROMS       -------
NDHJ_PROM2       -------
NDHJ_PROM5       -------
NDHJ_PROMP       -------
NDHJ_SYNS3       -------
NDHJ_SYNPW       -------
NDHJ_SYNSC       -------
NDHJ_SYNPX       -------
NDHJ_SYNS9       -------
NDHJ_PROMM       -------
NDHJ_PROMT       -------
NDHJ_PROM4       -------
NDHJ_SYNR3       -------
NDHJ_PAUCH       -------
NDHJ_NOSS1       -------
NDHJ_TRIV2       -------
NDHJ_NOSP7       -------
NDHJ_CROS5       -------
NDHJ_MICAN       -------
NDHJ_SYNP2       -------
NDHJ_SYNY3       -------
NDHJ_SYNP6       -------
NDHJ_SYNJB       -------
NDHJ_SYNJA       -------
NDHJ_TRIEI       -------
NDHJ_ACAM1       -------
NDHJ_THEEB       -------
NDHJ_GLOVI       -------
NDHJ_LACSA       -------
NDHJ_TRACE       -------
NDHJ_DAUCA       -------
NDHJ_FAGEA       -------
NDHJ_PANGI       -------
NDHJ_CITSI       -------
NDHJ_DRANE       -------
NDHJ_IPOPU       -------
NDHJ_OENPA       -------
NDHJ_CUCSA       -------
NDHJ_POPTR       -------
NDHJ_CICAR       -------
NDHJ_MANES       -------
NDHJ_SOYBN       -------
NDHJ_PHAVU       -------
NDHJ_LOTJA       -------
NDHJ_LUPLU       -------
NDHJ_PELHO       -------
NDHJ_MORIN       -------
NDHJ_BUXMI       -------
NDHJ_ACOCL       -------
NDHJ_CALFG       -------
NDHJ_NYMAL       -------
NDHJ_CERDE       -------
NDHJ_LIRTU       -------
NDHJ_AMBTC       -------
NDHJ_DIOEL       -------
NDHJ_LEMMI       -------
NDHJ_ORYSJ       -------
NDHJ_PIPCE       -------
NDHJ_CRYJA       -------
NDHJ_CYCTA       -------
NDHJ_ANGEV       -------
NDHJ_PSINU       -------
NDHJ_ANTAG       -------
NDHJ_MARPO       -------
NDHJ_PHYPA       -------
NDHJ_STAPU       -------
NDHJ_ZYGCR       -------
NDHJ_CHAGL       -------
NDHJ_ADICA       -------
NDHJ_MESVI       -------
NDHJ_CHLAT       -------
NUOC_ROSDO       -------
NUOC_RUEPO       -------
NUOC_RUEST       -------
NUOC_DINSH       -------
NUOC_RHOS1       -------
NUOC_RHOCA       -------
NQO5_PARDE       -------
NUOC_MARMM       -------
NUOC_PARL1       -------
NUOC_RHORT       -------
NUOC_MAGSA       -------
NUOC_HYPNA       -------
NUOC1_RHIME      -------
NUOC_SINMW       -------
NUOC_RHIL3       -------
NUOC_AGRFC       -------
NUOC_AZOC5       -------
NUOC_XANP2       -------
NUOC_BRUSI       -------
NUOC_OCHA4       -------
NUOC_RHILO       -------
NUOC_CHESB       -------
NUOC_METEP       -------
NUOC_METPB       -------
NUOC_METRJ       -------
NUOC_METS4       -------
NUOC_BARHE       -------
NUOC_BARQU       -------
NUOC_BART1       -------
NUOC_BARBK       -------
NUOC_RHOPT       -------
NUOC_RHOPB       -------
NUOC_CAUVC       -------
NUOC_CAUSK       -------
NUOC_PHEZH       -------
NUOC_ERYLH       -------
NUOC_NOVAD       KKKEDGE
NUOC_WOLTR       -------
NUOC_NEOSM       -------
NUOC_RICBR       -------
NUOC_RICFE       -------
NUOC_RICPR       -------
NUOC_RICTY       -------
NUOC2_RHIME      -------
NUOC2_RHIE6      -------
NUOC_ROSCS       -------
NUOC_ROSS1       -------
NUOC_HERA2       -------
NUOC_NEIM0       -------
NUOC_NEIG2       -------
NUOC_AZOSB       -------
NUOC_AROAE       -------
NUOC_DECAR       -------
NUOC_BURA4       -------
NUOC_BURVG       -------
NUOC_BURL3       -------
NUOC_BURM1       -------
NUOC_BURTA       -------
NUOC_PARXL       -------
NUOC_PARP8       -------
NUOC_RALPJ       -------
NUOC_RALSO       -------
NUOC_CUPTR       -------
NUOC_CUPNH       -------
NUOC_CUPPJ       -------
NUOC_CUPMC       -------
NUOC_POLNS       -------
NUOC_POLAQ       -------
NUOC_HERAR       -------
NUOC_JANMA       -------
NUOC_THIDA       -------
NUOC_CHRVO       -------
NUOC_ACIAC       -------
NUOC_ACISJ       -------
NUOC_DELAS       -------
NUOC_VEREI       -------
NUOC_RHOFT       -------
NUOC_POLNA       -------
NUOC_POLSJ       -------
NUOC_LEPCP       -------
NUOC_METPP       -------
NUOC_NITEU       -------
NUOC_NITEC       -------
NUOC_NITMU       -------
NUOC_BORPA       -------
NUOC_BORA1       -------
NUOC_BORPD       -------
NUOC_ALKEH       -------
NUOC_HALHL       -------
NUOC_METFK       -------
NUOC_ACIF5       -------
NUOC_HYDCU       -------
NUOC_LEGPA       -------
NUOC_NITOC       -------
NUOC_COXBR       -------
NUOC_XANOP       -------
NUOC_XANCB       -------
NUOC_STRM5       -------
NUOC_XYLFA       -------
NUOC_RUTMC       -------
NUOC_VESOH       -------
NUOC_FRATW       -------
NUOC_FRAP2       -------
NUOC_GEOMG       -------
NUOC_GEOSL       -------
NUOC_GEOUR       -------
NUOC_GEOBB       -------
NUOC_GEOLS       -------
NUOC_MOOTA       -------
NUOC_DEIGD       -------
NUOC_DEIRA       -------
NQO5_THET8       -------