CLUSTAL format seed alignment for MF_01358

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUOD1_RHIME      ------------------------------------------------------------
NUOD1_SINMW      ------------------------------------------------------------
NUOD1_RHIEC      ------------------------------------------------------------
NUOD1_RHIE6      ------------------------------------------------------------
NUOD_RHIL3       ------------------------------------------------------------
NUOD_AGRFC       ------------------------------------------------------------
NUOD_BRUAB       ------------------------------------------------------------
NUOD_BRUA2       ------------------------------------------------------------
NUOD_BRUA1       ------------------------------------------------------------
NUOD_BRUC2       ------------------------------------------------------------
NUOD_BRUSI       ------------------------------------------------------------
NUOD_BRUO2       ------------------------------------------------------------
NUOD_BRUSU       ------------------------------------------------------------
NUOD_BRUME       ------------------------------------------------------------
NUOD_OCHA4       ------------------------------------------------------------
NUOD_CHESB       ------------------------------------------------------------
NUOD_RHILO       ------------------------------------------------------------
NUOD_AZOC5       ------------------------------------------------------------
NUOD_XANP2       ------------------------------------------------------------
NUOD_BRASB       ------------------------------------------------------------
NUOD_BRASO       ------------------------------------------------------------
NUOD_BRADU       ------------------------------------------------------------
NUOD2_NITHX      ------------------------------------------------------------
NUOD_NITWN       ------------------------------------------------------------
NUOD_RHOP5       ------------------------------------------------------------
NUOD_RHOPB       ------------------------------------------------------------
NUOD_RHOPS       --------------------------------------------------------MAEA
NUOD_RHOP2       ------------------------------------------------------------
NUOD_RHOPA       ------------------------------------------------------------
NUOD_RHOPT       ------------------------------------------------------------
NUOD_METEP       ------------------------------------------------------------
NUOD_METPB       ------------------------------------------------------------
NUOD_METRJ       ------------------------------------------------------------
NUOD_METS4       ------------------------------------------------------------
NUOD1_BEII9      ------------------------------------------------------------
NUOD2_BEII9      ------------------------------------------------------------
NUOD1_NITHX      ------------------------------------------------------------
NUOD_PARL1       ------------------------------------------------------------
NUOD_BARBK       ------------------------------------------------------------
NUOD_BARHE       ------------------------------------------------------------
NUOD_BART1       ------------------------------------------------------------
NUOD_BARQU       ------------------------------------------------------------
NUOD_CAUVC       ------------------------------------------------------------
NUOD_CAUSK       ------------------------------------------------------MTGSNS
NUOD_PHEZH       ------------------------------------------------------MTGQTA
NUOD_MARMM       ------------------------------------------------------------
NUOD_RUEPO       ---------------------------------------------------------MMD
NUOD_RUEST       ----------------------------------------------------------MD
NUOD_ROSDO       ---------------------------------------------------------MMD
NUOD_DINSH       ---------------------------------------------------------MMD
NUOD_RHOS4       ----------------------------------------------------------MA
NUOD_RHOS1       ------------------------------------------------------------
NUOD_RHOS5       ------------------------------------------------------------
NUOD_JANSC       ---------------------------------------------------------MMD
NUOD_PARDP       ----------------------------------------------------------MD
NUOD_HYPNA       ------------------------------------------------------------
NUOD_PELUB       ------------------------------------------------------------
NUOD_RICBR       ------------------------------------------------------------
NUOD_RICB8       ------------------------------------------------------------
NUOD_RICCN       ------------------------------------------------------------
NUOD_RICM5       ------------------------------------------------------------
NUOD_RICRO       ------------------------------------------------------------
NUOD_RICRS       ------------------------------------------------------------
NUOD_RICFE       ------------------------------------------------------------
NUOD_RICAH       ------------------------------------------------------------
NUOD_RICCK       ------------------------------------------------------------
NUOD_RICPR       ------------------------------------------------------------
NUOD_RICTY       ------------------------------------------------------------
NUOD_ORITB       ------------------------------------------------------------
NUOD_ORITI       ------------------------------------------------------------
NUOD_ANAMM       ------------------------------------------------------------
NUOD_ANAPZ       ------------------------------------------------------------
NUOD_EHRCJ       ------------------------------------------------------------
NUOD_EHRCR       ------------------------------------------------------------
NUOD_EHRRG       ------------------------------------------------------------
NUOD_EHRRW       ------------------------------------------------------------
NUOD_WOLPP       ------------------------------------------------------------
NUOD_WOLPM       ------------------------------------------------------------
NUOD_WOLTR       ------------------------------------------------------------
NUOD_NEOSM       ------------------------------------------------------------
NUOD_MAGSA       ------------------------------------------------------------
NUOD_RHORT       ------------------------------------------------------------
NUOD_GLUDA       ------------------------------------------------------------
NUOD_GRABC       ------------------------------------------------------------
NUOD_ACICJ       ------------------------------------------------------------
NUOD_ERYLH       ------------------------------------------------------------
NUOD_NOVAD       ------------------------------------------------------------
NUOD_SPHAL       ------------------------------------------------------------
NUOD_SPHWW       ------------------------------------------------------------
NUOD_ACIAC       ------------------------------------------------------------
NUOD_ACISJ       ------------------------------------------------------------
NUOD_DELAS       ------------------------------------------------------------
NUOD_LEPCP       ------------------------------------------------------------
NUOD_METPP       ------------------------------------------------------------
NUOD_CHRVO       ------------------------------------------------------------
NUOD_RHOFT       ------------------------------------------------------------
NUOD_AZOSB       ------------------------------------------------------------
NUOD_AROAE       ------------------------------------------------------------
NUOD_METFK       ------------------------------------------------------------
NUOD_BORA1       ------------------------------------------------------------
NUOD_BORPE       ------------------------------------------------------------
NUOD_HYDCU       ------------------------------------------------------------
NUOD_ACIF5       ------------------------------------------------------------
NUOD_NEIG1       ------------------------------------------------------------
NUOD_NEIG2       ------------------------------------------------------------
NUOD_NEIMA       ------------------------------------------------------------
NUOD_NEIMB       ------------------------------------------------------------
NUOD_NEIM0       ------------------------------------------------------------
NUOD_NEIMF       ------------------------------------------------------------
NUOD_XANOR       ------------------------------------------------------------
NUOD_XANOM       ------------------------------------------------------------
NUOD_XANOP       ------------------------------------------------------------
NUOD1_STRM5      -----------------------------------------------------------M
NUOD_MAGMM       ------------------------------------------------------------
NUOD2_RHIME      ------------------------------------------------------------
NUOD2_SINMW      ------------------------------------------------------------
NUOD2_RHIEC      ------------------------------------------------------------
NUOD2_RHIE6      ------------------------------------------------------------
NDHH_CAPBU       ------------------------------------------------------------
NDHH_NASOF       ------------------------------------------------------------
NDHH_BARVE       ------------------------------------------------------------
NDHH_ARATH       ------------------------------------------------------------
NDHH_DRANE       ------------------------------------------------------------
NDHH_ARAHI       ------------------------------------------------------------
NDHH_OLIPU       ------------------------------------------------------------
NDHH_LEPVR       ------------------------------------------------------------
NDHH_CRUWA       ------------------------------------------------------------
NDHH_LOBMA       ------------------------------------------------------------
NDHH_AETCO       ------------------------------------------------------------
NDHH_AETGR       ------------------------------------------------------------
NDHH_SOYBN       ------------------------------------------------------------
NDHH_PHAVU       ------------------------------------------------------------
NDHH_LOTJA       ------------------------------------------------------------
NDHH_CICAR       ------------------------------------------------------------
NDHH_CUCSA       ------------------------------------------------------------
NDHH_MORIN       ------------------------------------------------------------
NDHH_OENEH       ------------------------------------------------------------
NDHH_OENBI       ------------------------------------------------------------
NDHH_OENGL       ------------------------------------------------------------
NDHH_OENAR       ------------------------------------------------------------
NDHH_OENPA       ------------------------------------------------------------
NDHH_EUCGG       ------------------------------------------------------------
NDHH_GOSBA       ------------------------------------------------------------
NDHH_GOSHI       ------------------------------------------------------------
NDHH_CITSI       ------------------------------------------------------------
NDHH_CARPA       ------------------------------------------------------------
NDHH_IPOPU       ------------------------------------------------------------
NDHH_PELHO       ------------------------------------------------------------
NDHH_POPAL       ------------------------------------------------------------
NDHH_POPTR       ------------------------------------------------------------
NDHH_MANES       ------------------------------------------------------------
NDHH_SOLLC       ------------------------------------------------------------
NDHH_SOLBU       ------------------------------------------------------------
NDHH_SOLTU       ------------------------------------------------------------
NDHH_TOBAC       ------------------------------------------------------------
NDHH_NICSY       ------------------------------------------------------------
NDHH_ATRBE       ------------------------------------------------------------
NDHH_NICTO       ------------------------------------------------------------
NDHH_COFAR       ------------------------------------------------------------
NDHH_JASNU       ------------------------------------------------------------
NDHH_SPIOL       ------------------------------------------------------------
NDHH_VITVI       ------------------------------------------------------------
NDHH_DAUCA       ------------------------------------------------------------
NDHH_PANGI       ------------------------------------------------------------
NDHH_FAGEA       ------------------------------------------------------------
NDHH_GUIAB       ------------------------------------------------------------
NDHH_HELAN       ------------------------------------------------------------
NDHH_LACSA       ------------------------------------------------------------
NDHH_PLAOC       ------------------------------------------------------------
NDHH_NANDO       ------------------------------------------------------------
NDHH_RANMC       ------------------------------------------------------------
NDHH_BUXMI       ------------------------------------------------------------
NDHH_AMBTC       ------------------------------------------------------------
NDHH_DIOEL       ------------------------------------------------------------
NDHH_ILLOL       ------------------------------------------------------------
NDHH_CHLSC       ------------------------------------------------------------
NDHH_CALFG       ------------------------------------------------------------
NDHH_DRIGR       ------------------------------------------------------------
NDHH_CERDE       ------------------------------------------------------------
NDHH_LIRTU       ------------------------------------------------------------
NDHH_NUPAD       ------------------------------------------------------------
NDHH_NYMAL       ------------------------------------------------------------
NDHH_PIPCE       ------------------------------------------------------------
NDHH_ACOAM       ------------------------------------------------------------
NDHH_ACOCL       ------------------------------------------------------------
NDHH_HORVU       ------------------------------------------------------------
NDHH_WHEAT       ------------------------------------------------------------
NDHH_BRADI       ------------------------------------------------------------
NDHH_ORYNI       ------------------------------------------------------------
NDHH_ORYSA       ------------------------------------------------------------
NDHH_ORYSI       ------------------------------------------------------------
NDHH_ORYSJ       ------------------------------------------------------------
NDHH_LOLPR       ------------------------------------------------------------
NDHH_AGRST       ------------------------------------------------------------
NDHH_SACHY       ------------------------------------------------------------
NDHH_SACOF       ------------------------------------------------------------
NDHH_SORBI       ------------------------------------------------------------
NDHH_MAIZE       ------------------------------------------------------------
NDHH_LEMMI       ------------------------------------------------------------
NDHH_CRYJA       ------------------------------------------------------------
NDHH_CYCTA       ------------------------------------------------------------
NDHH_ANTAG       ------------------------------------------------------------
NDHH_ANGEV       ------------------------------------------------------------
NDHH_MARPO       ------------------------------------------------------------
NDHH_PHYPA       ------------------------------------------------------------
NDHH_HUPLU       ------------------------------------------------------------
NDHH_ADICA       ------------------------------------------------------------
NDHH_PSINU       ------------------------------------------------------------
NDHH_CHAGL       ------------------------------------------------------------
NDHH_CHAVU       ------------------------------------------------------------
NDHH_STAPU       ------------------------------------------------------------
NDHH_ZYGCR       ------------------------------------------------------------
NDHH_MESVI       ------------------------------------------------------------
NDHH_CHLAT       ------------------------------------------------------------
NDHH_NEPOL       ------------------------------------------------------------
NDHH1_GLOVI      ------------------------------------------------------------
NDHH_NOSS1       ------------------------------------------------------------
NDHH_THEEB       ------------------------------------------------------------
NDHH_SYNY3       ------------------------------------------------------------
NUOD_AMOA5       ---------------------------------------------------------MGK
NUOD1_CYTH3      ------------------------------------------------------------
NUOD_CHLP8       ------------------------------------------------------MQELGK
NUOD_CHLTE       ------------------------------------------------------MQELGK
NUOD_CHLL2       -----------------------------------------------------------M
NUOD_CHLPD       ------------------------------------------------------MQELGI
NUOD_PELLD       -----------------------------------------------------------M
NUOD_CHLPM       ------------------------------------------------------MQELEM
NUOD_PELPB       ------------------------------------------------------MQELDI
NUOD_CHLCH       ------------------------------------------------------MQELEK
NUOD_CHLPB       ------------------------------------------------------MQELGK
NUOD_PROA2       ------------------------------------------------------MQELEQ
NUOD2_CHLT3      -------------------------------------------------------MADDV
NUOD2_ANADE      ------------------------------------------------------------
NUOD1_ANASK      ------------------------------------------------------------
NUOD1_ANADF      ------------------------------------------------------------
NUOD2_SORC5      ------------------------------------------------------------
NUOD_BACAN       ------------------------------------------------------------
NUOD_BACCR       ------------------------------------------------------------
NUOD_BACAH       ------------------------------------------------------------
NUOD_BACCZ       ------------------------------------------------------------
NUOD_BACHK       ------------------------------------------------------------
NUOD_BACC1       ------------------------------------------------------------
NUOD_BACMK       ------------------------------------------------------------
NUOD_BACCN       ------------------------------------------------------------
NUOD_GEOKA       ------------------------------------------------------------
NUOD_GEOTN       ------------------------------------------------------------
NUOD_DESPS       ------------------------------------------------------------
NUOD2_OPITP      --------------------------------------------MIASKESNSAATPATS
NUOD_SYNFM       ------------------------------------------------------------
NUOD2_SALAI      ------------------------------------------------------------
NUOD2_SALTO      -----------------------------------------------------------M
NUOD2_STRAW      ------------------------------------------------------------
NUOD1_STRCO      ------------------------------------------------------------
NUOD2_STRGG      ------------------------------------------------------MTPAAD
NUOD_RUBXD       --------------------------------------------------MLREERRAAE
NUOD_DESHY       ------------------------------------------------------------
NUOD_HELMI       ------------------------------------------------------------
NUOD_CARHZ       ------------------------------------------------------------
NUOD2_SYMTH      ------------------------------------------------------------
NUOD_CAMJE       ------------------------------------------------------------
NUOD2_ROSCS      ------------------------------------------------------------
NUOD1_ROSS1      ------------------------------------------------------------
NUOD2_HERA2      ------------------------------------------------------------
NQO4_THET8       -----------------------------------------------------------M
NUOD_THET2       -----------------------------------------------------------M
NUOD_DEIRA       -----------------------------------------------------------M
NUOD_DEIGD       -----------------------------------------------------------M
NUOD2_KORVE      ------------------------------------------------------------
NUOD1_SOLUE      ------------------------------------------------------------
NUOD1_ROSCS      --------------------------------------------------------MTVA
NUOD2_ROSS1      --------------------------------------------------------MTVA
NUOD2_CHLAA      ------------------------------------------------------------
NUOD1_HERA2      --------------------------------------------------------MVMH
NUOD_GEOMG       ------------------------------------------------------------
NUOD_GEOSL       ------------------------------------------------------------
NUOD_GEOBB       ------------------------------------------------------------
NUOD_GEOUR       ------------------------------------------------------------
NUOD_GEOLS       ------------------------------------------------------------
NUOD_MYCBP       --------MTAIADSAGGAG----------------------------------------
NUOD_MYCTA       --------MTAIADSAGGAG----------------------------------------
NUOD_MYCTU       --------MTAIADSAGGAG----------------------------------------
NUOD_MYCBO       --------MTAIADSAGGAG----------------------------------------
NUOD_MYCMM       -----------MTDT---------------------------------------------
NUOD_MYCUA       -----------MTDT---------------------------------------------
NUOD_MYCA1       -------MSTTTESTHDGAG----------------------------------------
NUOD_MYCPA       -------MSTTTESTHDGAG----------------------------------------
NUOD_MYCGI       --------MTTSAQRP--------------------------------------------
NUOD_MYCVP       --------MTTSQQPP--------------------------------------------
NUOD_MYCSJ       --------MTTPPGPPNAGGD--------------------------------------A
NUOD_MYCSK       --------MTTPPGPPNAGGD--------------------------------------A
NUOD_MYCSS       --------MTTPPGPPNAGGD--------------------------------------A
NUOD_MYCS2       --------MSTSTVPPDGG-----------------------------------------
NUOD_MYCA9       --------MTAQPEIH--------------------------------------------
NUOD_NOCFA       MKDTETRPGRHRAPEPAHPEQ--------------------------------------P
NUOD_RHOJR       ------------------------------------------------------------
NUOD1_STRAW      --------MSTSHASAASA----------------------------------------R
NUOD2_STRCO      --------MSTSHASP-------------------------------------------R
NUOD1_STRGG      --------MTTPHATP-------------------------------------------R
NUOD_NOCSJ       --------MADQDLYSGSSE----------------------------------------
NUOD_THEFY       --------MTTPTETY--------------------------------------------
NUOD_FRAAA       --------MTPSTSTPHTSTAPHTSTGQST---DGAAQPGDGS---------SAYEAGFT
NUOD_FRACC       --------MTTNTSTSSTTDDLTTGAPNGTGAPDGANGVGGPTGTVGGPGEHPAYEAGFT
NUOD_FRASN       --------MSTHTETPVDGSAETITGAQ-------------------------PYEAGFT
NUOD1_SALAI      --------MSASNYATE------------------------------------------R
NUOD1_SALTO      --------MSASNYATE------------------------------------------R
NUOD_ACIC1       --------MTTTDPFDV-------------------------------------------
NUOD_SACEN       --------MSTEPLADPAAGLGDPYAASS------------------------------R
NUOD_CUTAK       ------------------------------------------------------------
NUOD1_SYMTH      ------------------------------------------------------------
NUOD_THEM4       ------------------------------------------------------------
NUOD_PARUW       ------------------------------------------------------------
NUOD_FLAJ1       -----------------------------------------------------------M
NUOD_FLAPJ       -----------------------------------------------------------M
NUOD2_CYTH3      ------------------------------------------------------------
NUOD_LEPBA       ------------------------------------------------------------
NUOD_LEPBP       ------------------------------------------------------------
NUOD_LEPBJ       ------------------------------------------------------------
NUOD_LEPBL       ------------------------------------------------------------
NUOD_LEPIN       ------------------------------------------------------------
NUOD_LEPIC       ------------------------------------------------------------
NUOD1_SORC5      ------------------------------------------------------------
NUOD_METI4       -------------------------------------------------------MAEGL
                                                                             

NUOD1_RHIME      ----------------MTEHNV-------------------------RNFNINFGPQHPA
NUOD1_SINMW      ----------------MTEHNV-------------------------RNFNINFGPQHPA
NUOD1_RHIEC      ----------------MTEHNV-------------------------RNFNINFGPQHPA
NUOD1_RHIE6      ----------------MTEHNV-------------------------RNFNINFGPQHPA
NUOD_RHIL3       ----------------MTEHNV-------------------------RNFNINFGPQHPA
NUOD_AGRFC       ----------------MTEHNV-------------------------RNFTINFGPEHPS
NUOD_BRUAB       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUA2       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUA1       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUC2       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUSI       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUO2       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUSU       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_BRUME       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_OCHA4       ----------------MAETQV-------------------------RNFNINFGPQHPA
NUOD_CHESB       ----------------MAETSI-------------------------RNFNINFGPQHPA
NUOD_RHILO       ----------------MAETSV-------------------------RNFNINFGPQHPA
NUOD_AZOC5       --------MAHTLDSQQPAVPV-------------------------RNFQINFGPQHPA
NUOD_XANP2       --------MVDIADEMKPADKV-------------------------RNFQINFGPQHPA
NUOD_BRASB       --------------MNEQSPAL-------------------------RNFTINFGPQHPA
NUOD_BRASO       --------------MNEQSPAL-------------------------RNFTINFGPQHPA
NUOD_BRADU       --------------MNEQPENL-------------------------RNFTINFGPQHPA
NUOD2_NITHX      ----------MTEALGTETPGM-------------------------RNFTINFGPQHPA
NUOD_NITWN       ----------MTEALGTVTPGM-------------------------RNFTINFGPQHPA
NUOD_RHOP5       ----------------MPEGAL-------------------------RNFTINFGPQHPA
NUOD_RHOPB       ----------------MPEGAL-------------------------RNFTINFGPQHPA
NUOD_RHOPS       PMAQAPTAQAPTAEAAAEAPGL-------------------------RNFTINFGPQHPA
NUOD_RHOP2       -----------MADAATEAAGL-------------------------RNFTINFGPQHPA
NUOD_RHOPA       ----------MADAAAPDAASV-------------------------RNFTINFGPQHPA
NUOD_RHOPT       ----------MADAAAPDAASV-------------------------RNFTINFGPQHPA
NUOD_METEP       ----------------MTEHNI-------------------------RNFSINFGPQHPA
NUOD_METPB       ----------------MSEHNI-------------------------RNFSINFGPQHPA
NUOD_METRJ       ----------------MTEHNI-------------------------RNFAINFGPQHPA
NUOD_METS4       ----------------MTEHSI-------------------------RNFSINFGPQHPA
NUOD1_BEII9      ----------------MNDNPV-------------------------RNFAINFGPQHPA
NUOD2_BEII9      ----------------MDEAGF-------------------------RNFTVNFGPQHPA
NUOD1_NITHX      ----------------MVEAAP-------------------------RNFTINFGPQHPA
NUOD_PARL1       ----------------MAEQEL-------------------------RNYHLNFGPQHPA
NUOD_BARBK       ----------------MAEVNV-------------------------RNFNINFGPQHPA
NUOD_BARHE       ----------------MAEVNV-------------------------RNFNINFGPQHPA
NUOD_BART1       ----------------MAEVNV-------------------------RNFNINFGPQHPA
NUOD_BARQU       ----------------MAEVNV-------------------------RNFNINFGPQHPA
NUOD_CAUVC       ------------MVPAIPETPV-------------------------RKFNINFGPQHPA
NUOD_CAUSK       PAAATDFFHDAPSLPAVPETPV-------------------------RKFNINFGPQHPA
NUOD_PHEZH       PAAPED-----ANVLGLPETKV-------------------------RKFNINFGPQHPA
NUOD_MARMM       ----------MADDMTQATEAP-------------------------RNFTINFGPQHPA
NUOD_RUEPO       GGKG-------FEDALTGEQKI-------------------------RNFNINFGPQHPA
NUOD_RUEST       GSK--------FDDAQTGEQKI-------------------------RNFNINFGPQHPA
NUOD_ROSDO       GTKG-------FEDALTGEQKI-------------------------RNFNINFGPQHPA
NUOD_DINSH       GTN--------FDDALTGEQKI-------------------------RNFNINFGPQHPA
NUOD_RHOS4       MDTK-------FDDVLTGEQKL-------------------------RNFNINFGPQHPA
NUOD_RHOS1       MDTK-------FDDVLTGEQKL-------------------------RNFNINFGPQHPA
NUOD_RHOS5       MDTK-------FDDVLTGEQKL-------------------------RNFNINFGPQHPA
NUOD_JANSC       GDIRVNTYDDGSTDFQTGEQKI-------------------------RNFNLNFGPQHPA
NUOD_PARDP       GDIRKNSYDDGSMDALTGEQSI-------------------------RNFNINFGPQHPA
NUOD_HYPNA       -------------------MDD-------------------------RKFTLNFGPQHPA
NUOD_PELUB       -----------------MTKKI-------------------------KTLNLNFGPQHPA
NUOD_RICBR       ----------------MTNNT--------------------------KSITLNLGPQHPA
NUOD_RICB8       ----------------MTNNT--------------------------KSITLNLGPQHPA
NUOD_RICCN       ----------------MTNNT--------------------------KTITLNIGPQHPA
NUOD_RICM5       ----------------MTNNT--------------------------KTITLNLGPQHPA
NUOD_RICRO       ----------------MTNNT--------------------------KTITLNLGPQHPA
NUOD_RICRS       ----------------MTNNT--------------------------KTITLNLGPQHPA
NUOD_RICFE       ----------------MTNNT--------------------------KTITLNLGPQHPA
NUOD_RICAH       ----------------MTNNT--------------------------KTITLNLGPQHPA
NUOD_RICCK       ----------------MTNNI--------------------------KTITLNLGPQHPA
NUOD_RICPR       ----------------MTN----------------------------KTITLNLGPQHPA
NUOD_RICTY       ----------------MTN----------------------------KTITLNLGPQHPA
NUOD_ORITB       -----------MALKKRSKHS--------------------------KKFKLNLGPQHPA
NUOD_ORITI       -----------MALKKRSKHS--------------------------KKFKLNLGPQHPA
NUOD_ANAMM       -------------MLPMSDTRSSRI----------------------KPMTLNFGPQHPA
NUOD_ANAPZ       ----------------MSDSSDGYA----------------------KPMTINFGPQHPA
NUOD_EHRCJ       ----------------MSDQV--KI----------------------TPMTLNFGPQHPA
NUOD_EHRCR       ----------------MSDRV--KI----------------------TPMTLNFGPQHPA
NUOD_EHRRG       ----------------MSDHV--KI----------------------TPMTLNFGPQHPA
NUOD_EHRRW       ----------------MSDHV--KI----------------------TPMTLNFGPQHPA
NUOD_WOLPP       ----------------MPDLK---------------------------TMMLNFGPQHPA
NUOD_WOLPM       ----------------MPDLK---------------------------TMMLNFGPQHPA
NUOD_WOLTR       ----------------MSDLK---------------------------TMMLNFGPQHPA
NUOD_NEOSM       ----------------MTVIK-----------------------------ELNFGPQHPA
NUOD_MAGSA       ----------------MAESQ---I----------------------QSYTINFGPQHPA
NUOD_RHORT       ----------------MAQTE---I----------------------KSYTLNFGPQHPA
NUOD_GLUDA       ----------------MSDIVLHEDIPESLLPGGEAAAAATHTVEI-DSHALNFGPQHPS
NUOD_GRABC       ----------------MSETVQKQG----------------RVVEI-DSHAINFGPQHPA
NUOD_ACICJ       ----------------MSGGMQNGT-----------QETERRVIDINDRHTVNVGPQHPA
NUOD_ERYLH       ------------MSVHIEESPTTDG-------------------DVITNYTINFGPQHPA
NUOD_NOVAD       ------------MSLSLEQSPTTGD-------------------EVITNYTINFGPQHPA
NUOD_SPHAL       ----------MFEGYPVDTANTAGD-------------------QAVTNYTINFGPQHPA
NUOD_SPHWW       ---------MASTYDTLTPEAQKGE-------------------VEIQNYTINFGPQHPA
NUOD_ACIAC       ------------------MAEI-------------------------KNYSLNFGPQHPA
NUOD_ACISJ       ------------------MAEI-------------------------KNYSLNFGPQHPA
NUOD_DELAS       ------------------MAEI-------------------------KNYSLNFGPQHPA
NUOD_LEPCP       ------------------MAEI-------------------------KNYTLNFGPQHPA
NUOD_METPP       ------------------MAEI-------------------------KNYTLNFGPQHPA
NUOD_CHRVO       ------------------MAEI-------------------------RNYTLNFGPQHPA
NUOD_RHOFT       ------------------MAEI-------------------------KNYTLNFGPQHPA
NUOD_AZOSB       ------------------MAEI-------------------------RNYTINFGPQHPS
NUOD_AROAE       ------------------MAEI-------------------------RNYTINFGPQHPS
NUOD_METFK       ------------------MAEI-------------------------RNYTMNFGPQHPA
NUOD_BORA1       ------------------MAEI-------------------------KNYTLNFGPQHPA
NUOD_BORPE       ------------------MAEI-------------------------KNYTLNFGPQHPA
NUOD_HYDCU       ------------------MSEI-------------------------RNYTLNFGPQHPS
NUOD_ACIF5       ------------------MPEI-------------------------NNFTMNFGPQHPS
NUOD_NEIG1       -----------------MANKL-------------------------RNYTINFGPQHPA
NUOD_NEIG2       -----------------MANKL-------------------------RNYTINFGPQHPA
NUOD_NEIMA       -----------------MANKL-------------------------RNYTINFGPQHPA
NUOD_NEIMB       -----------------MANKL-------------------------RNYTINFGPQHPA
NUOD_NEIM0       -----------------MANKL-------------------------RNYTINFGPQHPA
NUOD_NEIMF       -----------------MANKL-------------------------RNYTINFGPQHPA
NUOD_XANOR       MSEFRQATDAFASNPAESKQEI-------------------------RNYTMNFGPQHPA
NUOD_XANOM       MSEFRQATDAFASNPAESKQEI-------------------------RNYTMNFGPQHPA
NUOD_XANOP       MSEFRQATDAFASNPAESKQEI-------------------------RNYTMNFGPQHPA
NUOD1_STRM5      NTERTMAGGPAPMRDGRRDTEI-------------------------RNYVMNLGPQHPA
NUOD_MAGMM       -----------MPATITDHKEF-------------------------QNYAINFGPQHPA
NUOD2_RHIME      ----------MTEVTELMRPEG--------------------EALNTKEVLLNLGPQHPS
NUOD2_SINMW      ----------MTEVTELMRPEG--------------------EALNTKEVLLNLGPQHPS
NUOD2_RHIEC      ----------MTEVTELSRPEG--------------------EALNTREVLLNLGPQHPS
NUOD2_RHIE6      ----------MTEVTELSRPEG--------------------EALNTREVLLNLGPQHPS
NDHH_CAPBU       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_NASOF       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_BARVE       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_ARATH       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_DRANE       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_ARAHI       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_OLIPU       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_LEPVR       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_CRUWA       --------------MKRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_LOBMA       --------------MTRPVTGKD-------------------------LMIVNMGPHHPS
NDHH_AETCO       --------------MNRPVTRKD-------------------------LMIVNIGPHHPS
NDHH_AETGR       --------------MSRPVRRKD-------------------------LMIVNIGPHHPS
NDHH_SOYBN       --------------MNISTTRKD-------------------------FMIVNMGPHHPS
NDHH_PHAVU       --------------MNISTIRKD-------------------------FMIVNMGPHHPS
NDHH_LOTJA       --------------MNVPATRKD-------------------------LMIVNMGPHHPS
NDHH_CICAR       --------------MNVPTTRKD-------------------------LMIVNMGPQHPS
NDHH_CUCSA       --------------MNGPATRKD-------------------------LMIVNMGPHHPS
NDHH_MORIN       --------------MNIPAPRKD-------------------------LMIVNMGPHHPS
NDHH_OENEH       --------------MNVTTTRKD-------------------------LMIVNMGPHHPS
NDHH_OENBI       --------------MNVTTTRKD-------------------------LMIVNMGPHHPS
NDHH_OENGL       --------------MNVTTTRKD-------------------------LMIVNMGPHHPS
NDHH_OENAR       --------------MNVTTTRKD-------------------------LMIVNMGPHHPS
NDHH_OENPA       --------------MNVTTTRKD-------------------------LMIVNMGPHHPS
NDHH_EUCGG       --------------MNVTTTRKD-------------------------LMIVNMGPHHPS
NDHH_GOSBA       --------------MNLSATEKD-------------------------LMIVNMGPHHPS
NDHH_GOSHI       --------------MNLSATEKD-------------------------LMIVNMGPHHPS
NDHH_CITSI       --------------MSILATEKEK-----------------------EFMIVNMGPHHPS
NDHH_CARPA       --------------MNIPATGKD-------------------------FMIVNMGPHHPS
NDHH_IPOPU       --------------MTAPATRKD-------------------------LMIVNMGPHHPS
NDHH_PELHO       --------------MTIPATRKD-------------------------LMIVNMGPHHPS
NDHH_POPAL       --------------MNVPATRKD-------------------------FMIVNMGPHHPS
NDHH_POPTR       --------------MNVPATRKD-------------------------FMIVNMGPHHPS
NDHH_MANES       --------------MNVPATRKD-------------------------LMIVNMGPHHPS
NDHH_SOLLC       --------------MTAPTTRKD-------------------------LMIVNMGPQHPS
NDHH_SOLBU       --------------MTAPTTRKD-------------------------LMIVNMGPQHPS
NDHH_SOLTU       --------------MTAPTTRKD-------------------------LMIVNMGPQHPS
NDHH_TOBAC       --------------MTAPTTRKD-------------------------LMIVNMGPQHPS
NDHH_NICSY       --------------MTAPTTRKD-------------------------LMIVNMGPQHPS
NDHH_ATRBE       --------------MTTPTTRKD-------------------------LMIVNMGPQHPS
NDHH_NICTO       --------------MTAPTTRKD-------------------------LMIVNMGPQHPS
NDHH_COFAR       --------------MTVPATRKD-------------------------LMIVNMGPHHPS
NDHH_JASNU       --------------MIAPTTRKD-------------------------LMIINMGPHHPS
NDHH_SPIOL       --------------MAVPTTRKD-------------------------LMIVNMGPHHPS
NDHH_VITVI       --------------MNVPATRED-------------------------LMIVNMGPHHPS
NDHH_DAUCA       --------------MTAPATRND-------------------------LMIVNMGPQHPS
NDHH_PANGI       --------------MTASATRND-------------------------LMIVNLGPQHPS
NDHH_FAGEA       --------------MTGPITRKD-------------------------LMIVNMGPQHPS
NDHH_GUIAB       --------------MTVPSTRKD-------------------------LMIVNMGPHHPS
NDHH_HELAN       --------------MTVPSTRKD-------------------------LMIVNMGPHHPS
NDHH_LACSA       --------------MTGPATRKD-------------------------LMIVNMGPHHPS
NDHH_PLAOC       --------------MTVPATRKD-------------------------LMIVNMGPHHPS
NDHH_NANDO       --------------MTVPTTRKD-------------------------LMIVNMGPQHPS
NDHH_RANMC       --------------MTVPTTRKD-------------------------LMIVNMGPQHPS
NDHH_BUXMI       --------------MTVPSTRKD-------------------------LIIVNMGPHHPS
NDHH_AMBTC       --------------MTVPAT--RN-----------------------DLMIVNMGPHHPS
NDHH_DIOEL       --------------MTVPDT--RK-----------------------GLMIVNMGPHHPS
NDHH_ILLOL       --------------MTVPAT--RK-----------------------DLMIVNMGPHHPS
NDHH_CHLSC       --------------MTVPATSTRK-----------------------DLMIVNMGPHHPS
NDHH_CALFG       --------------MNVPAT--RK-----------------------DLMIVNMGPHHPS
NDHH_DRIGR       --------------MTVPAT--KK-----------------------DLMIINMGPHHPS
NDHH_CERDE       --------------MTVPDKRKD-------------------------LMIVNMGPQHPS
NDHH_LIRTU       --------------MTVPDIRKD-------------------------FMIVNMGPHHPS
NDHH_NUPAD       --------------MTVPDARKD-------------------------LLVVNMGPHHPS
NDHH_NYMAL       --------------MTVPDARKD-------------------------LLVVNMGPHHPS
NDHH_PIPCE       --------------MTVPATRKD-------------------------LMIVNMGPHHPS
NDHH_ACOAM       --------------MTVPATRQD-------------------------LMIVNMGPHHPS
NDHH_ACOCL       --------------MTVPATRQD-------------------------LMIVNMGPHHPS
NDHH_HORVU       --------------MSLPLT--KK-----------------------DLMIVNMGPQHPS
NDHH_WHEAT       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_BRADI       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_ORYNI       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_ORYSA       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_ORYSI       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_ORYSJ       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_LOLPR       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_AGRST       --------------MSLPLT--RK-----------------------DLMIVNMGPQHPS
NDHH_SACHY       --------------MSLSLK--RK-----------------------DLMIVNMGPQHPS
NDHH_SACOF       --------------MSLSLK--RK-----------------------DLMIVNMGPQHPS
NDHH_SORBI       --------------MSLSLK--RK-----------------------DLMIVNMGPQHPS
NDHH_MAIZE       --------------MSLSLK--RK-----------------------DLMIVNMGPQHPS
NDHH_LEMMI       --------------MTGPTTNTKN-----------------------DLMIVNMGPQHPS
NDHH_CRYJA       --------------MIMVAREKD-------------------------LMMVSMGPHHPS
NDHH_CYCTA       --------------MTVLATEKD-------------------------SVIVSMGPHHPS
NDHH_ANTAG       --------------MTMLAAKAD-------------------------PMTLSMGPHHPS
NDHH_ANGEV       --------------MTMLATKKD-------------------------PMIVSMGPQHPS
NDHH_MARPO       ---------------MMILTKNK-------------------------PMIVSMGPHHPS
NDHH_PHYPA       ----------------MLATKTK-------------------------PMIVSMGPHHPS
NDHH_HUPLU       --------------MTMLATEKN-------------------------PMIVSMGPHHPS
NDHH_ADICA       --------------MSIRLEDID-------------------------PVVVSMGPHHPS
NDHH_PSINU       --------------MAMLLKNKD-------------------------QMIVSMGPHHPS
NDHH_CHAGL       ----------------MLTKKTD-------------------------PMIVSMGPHHPS
NDHH_CHAVU       ----------------MLIRKTN-------------------------SMIVSMGPHHPS
NDHH_STAPU       --------------MTMLKTKAD-------------------------PMIVSMGPHHPS
NDHH_ZYGCR       ----------------MLITKAD-------------------------PMVVSMGPHHPS
NDHH_MESVI       ----------------MLQTKTD-------------------------PMVISMGPHHPS
NDHH_CHLAT       --------------MTMLETKTD-------------------------PMVISMGPHHPS
NDHH_NEPOL       ----------------MIEAKTD-------------------------PMIVSMGPHHPS
NDHH1_GLOVI      --------------MSMLETRAE-------------------------RMVINLGPHHPS
NDHH_NOSS1       --------------MARIETRTE-------------------------PMVLNMGPHHPS
NDHH_THEEB       --------------MPKIETRTE-------------------------PMVINMGPHHPS
NDHH_SYNY3       --------------MTKIETRTE-------------------------PMVLNMGPHHPS
NUOD_AMOA5       HIQYQGGNFKNTAPTKYQPTDLKV-----------------------EEVLINIGPQHPA
NUOD1_CYTH3      --------MESSEPLVLDVGNLKR-----------------------GEIIINMGPQHPS
NUOD_CHLP8       VESNSIRVTRQDDKRITIEKDLDT-----------------------EHMVLSMGPQHPS
NUOD_CHLTE       AETNSTRIIRQDDKRVTIEKDLDT-----------------------EHMVLSMGPQHPS
NUOD_CHLL2       AEQGSIRVSRKDDNVVVIEKDLAT-----------------------EEMLLSMGPQHPS
NUOD_CHLPD       TGQGSVRVTRKEGNVVVLEKDLAT-----------------------EQMVLAMGPQHPS
NUOD_PELLD       AGQGSVRLTRKSDNVVIIEKDLAT-----------------------EEMVLSMGPQHPS
NUOD_CHLPM       AGQGSLRLSRKSDTIVVLEKDLST-----------------------EQMVLSMGPQHPS
NUOD_PELPB       AGVGSVRVTRKNDNVVVIEKDLAT-----------------------EQMILAMGPQHPS
NUOD_CHLCH       AVPSSVRVTRQSENLVILEKDLAT-----------------------EQMVLAMGPQHPS
NUOD_CHLPB       AEHTSIRVTPQGENRVIVEKDLSS-----------------------EEMILNMGPQHPS
NUOD_PROA2       AVNRSVRVIPQGEGRVTIEKDLSS-----------------------EEMILNMGPQHPS
NUOD2_CHLT3      QLESSVRFTQTGPQTIVLEKDLDT-----------------------EYMIVNMGPQHPS
NUOD2_ANADE      ---MEKLILRRVDRQ--------N-----------------------EEMILNFGPQHPS
NUOD1_ANASK      ---MEKLILRRVDRQ--------N-----------------------EEMILNFGPQHPS
NUOD1_ANADF      ---MEKLILRRVDRN--------N-----------------------EEMVLNFGPQHPS
NUOD2_SORC5      ---MSQVIFS-VDRGGAEPGAEMD-----------------------DEMTLNMGPHHPS
NUOD_BACAN       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACCR       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACAH       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACCZ       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACHK       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACC1       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACMK       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_BACCN       --------------------MIRT-----------------------EEMLLNVGPQHPS
NUOD_GEOKA       -------------------MMLRT-----------------------EEMILNVGPQHPS
NUOD_GEOTN       --------------------MLRT-----------------------EEMILNVGPQHPS
NUOD_DESPS       -----------MSEHIILNPD--------------------------ETFTLNLGPQHPA
NUOD2_OPITP      APTLRTTAEIAATAAMGHAPH--------------------------ETFTINLGPQHPA
NUOD_SYNFM       ----------MPKRFLAPVTE--------------------------QIYTLNLGPQHPS
NUOD2_SALAI      --MTTDAELRELTVGTGAGGEQLG-----------------------TDMVLNIGPQHPS
NUOD2_SALTO      TGMTTDADLRELTVGTGAGGEQLG-----------------------TDMVLNIGPQHPS
NUOD2_STRAW      -----MTPTTETMVGIGGAAE--S-----------------------TDMVLNIGPQHPS
NUOD1_STRCO      -----MTPTTETTVGIGGAAE--S-----------------------TDMVLNIGPQHPS
NUOD2_STRGG      PGQGILSRMTETTIGIGGAAE--S-----------------------TDMVLNIGPQHPS
NUOD_RUBXD       EAITLIRPATSRLVDPDIRDEFGL-----------------------ETLDMNMGPQHPA
NUOD_DESHY       ---------------MSDLYNEGT-----------------------EELLLNMGPQHPS
NUOD_HELMI       ---------------------MQT-----------------------QTYELNFGPQHPS
NUOD_CARHZ       --------------------MLKT-----------------------QEISINVGPQHPS
NUOD2_SYMTH      ------------------MNVERT-----------------------QELLVNMGPQHPS
NUOD_CAMJE       ----MQIPSKLKPYYENIAFEQED-----------------------SKMIINLGPQHPS
NUOD2_ROSCS      --------------------MLQT-----------------------QELQINIGPQHPS
NUOD1_ROSS1      --------------------MLQT-----------------------QELQINIGPQHPS
NUOD2_HERA2      --------------------MLKT-----------------------EELQINIGPQHPS
NQO4_THET8       REEFLEEIPLDAPPEEAKELRTE-------------------------VMTLNVGPQHPS
NUOD_THET2       REEFLEEIPLDAPPEEAKELRTE-------------------------VMTLNVGPQHPS
NUOD_DEIRA       TAE--------LQPEAGALLHTE-------------------------LMSLNVGPQHPS
NUOD_DEIGD       TTEPL------TPPTSGALLHTE-------------------------IMSLNVGPQHPS
NUOD2_KORVE      ---MAHM----NPTPVLEAGQDK-------------------------TMVLNMGPQHPS
NUOD1_SOLUE      ---MSESEIPGQVVVDLEADQSAE---------------------GGRRMVLNMGPQHPS
NUOD1_ROSCS      ETRARNLSIPAPSQITRPALEGV-----------------------KETMVLNMGPHHPS
NUOD2_ROSS1      EIRARNLSIPAPSQITRPALAGE-----------------------KETMVLNMGPHHPS
NUOD2_CHLAA      --MTEPITVPTPQQIIEPAVAGR-----------------------TETMVLNMGPHHPS
NUOD1_HERA2      AHAYPDIEIPTPSQIAAVALNNEPDEN------------------GEQSMVLSMGPQHPS
NUOD_GEOMG       ------------------MASTE-------------------------IMTVNMGPQHPS
NUOD_GEOSL       ------------------MASTE-------------------------IMTVNMGPQHPS
NUOD_GEOBB       -------------------MASE-------------------------IMTLNMGPQHPS
NUOD_GEOUR       ------------------MASTE-------------------------IMTINMGPQHPS
NUOD_GEOLS       ------------------MANNE-------------------------IMTINMGPQHPS
NUOD_MYCBP       ----ETVLVAGGQDWQQVVDAAR-------------------SADPGERIVVNMGPQHPS
NUOD_MYCTA       ----ETVLVAGGQDWQQVVDAAR-------------------SADPGERIVVNMGPQHPS
NUOD_MYCTU       ----ETVLVAGGQDWQQVVDAAR-------------------SADPGERIVVNMGPQHPS
NUOD_MYCBO       ----ETVLVAGGQDWQQVVDAAR-------------------SADPGERIVVNMGPQHPS
NUOD_MYCMM       ----ETVLVAGGQDWNEIVEAAR-------------------GADPGERIVVNMGPQHPS
NUOD_MYCUA       ----ETVLVAGGQDWNEIVEAAR-------------------GADPGERIVVNMGPQHPS
NUOD_MYCA1       ----ETLVVAGGQDWDKVVEAAR-------------------SADPGERIVVNMGPQHPS
NUOD_MYCPA       ----ETLVVAGGQDWDKVVEAAR-------------------SADPGERIVVNMGPQHPS
NUOD_MYCGI       ----ERVIVVGGQDWDQVVTAARQMSNSSSRA-------GDAAEHAGERIVVNMGPQHPS
NUOD_MYCVP       ----ERVVVVGGQDWDQVVAAARQN----------------AAEHAGERIVVNMGPQHPS
NUOD_MYCSJ       RTGTDTVIVVGGEDWEQVVAAA-------------------EQAQAGERIVVNMGPQHPS
NUOD_MYCSK       RTGTDTVIVVGGEDWEQVVAAA-------------------EQAQAGERIVVNMGPQHPS
NUOD_MYCSS       RTGTDTVIVVGGEDWEQVVAAA-------------------EQAQAGERIVVNMGPQHPS
NUOD_MYCS2       ----EKVVVVGGNDWHEVVAAARAG----------------AAAQAGERIVVNMGPQHPS
NUOD_MYCA9       -------LMAGGQDWDEIVTAA--------------------GQATDERIVVNMGPQHPS
NUOD_NOCFA       DTTGDTVVTVSGQDWDTVTETLGGAR--------------------EERIVVNMGPQHPS
NUOD_RHOJR       -MSEDTVFTVAGQDWDDVVDAVKASSG------------GGGSEGGEERIVVNMGPQHPS
NUOD1_STRAW      ETTEGTVYTVTGGDWDEVVQSAAK--------------------SDDERIVVNMGPQHPS
NUOD2_STRCO      ETTEGTVYTVTGGDWDEVVQSAAR--------------------ADDERIVVNMGPQHPS
NUOD1_STRGG      ATTEGTVYTVTGGDWDEVVESAVK--------------------SDDERIIVNMGPQHPS
NUOD_NOCSJ       -TTEGRVFTVTGQDWDSIAEGLA-------------------EDEAQERIVVNMGPQHPS
NUOD_THEFY       -------VDASGGDWDEVVAAAQ--------------------RSQTDRLVINMGPQHPS
NUOD_FRAAA       ESASGRVYTVTGGDWEEILGAGE--------------------QDA-ERIVVNMGPQHPS
NUOD_FRACC       ESANGRVYTVTGSDWEQILGVGE--------------------EEN-ERIVVNMGPQHPS
NUOD_FRASN       ESSAGRVYTVTGGDWEQVLGVGE--------------------DDG-ERITVNMGPQHPS
NUOD1_SALAI      ETAEGKVFTVTGGDWDVVVSGTD--------------------PINDERIVVNMGPQHPS
NUOD1_SALTO      ETAEGKVFTVTGGDWDVVLSGTD--------------------PINDERIVVNMGPQHPS
NUOD_ACIC1       LDPTAPVYTVTGGDWQDIVSDIA--------------------DRHPDRIVVNMGPQHPS
NUOD_SACEN       ETTEGRVYTVTGGDWDEFIDESAG----------------------EERIVINFGPQHPS
NUOD_CUTAK       -MSENHEYLSQGGDWAQIVDEAAE--------------------RGDETVVVNFGPSHPS
NUOD1_SYMTH      --------MSMAEDLHLEEQRPE-------------------------RMTLSIGPHHPA
NUOD_THEM4       ---------------------MG-------------------------EVKLFFGPNHPG
NUOD_PARUW       ------MTKVSKERLKELEESG-------------------------DVMELNLGPQHPS
NUOD_FLAJ1       SELLLPPEHRYAKIIKERHNEDGS-----------------------ELSVLNLGPTHPA
NUOD_FLAPJ       SELLLPPEHRYAKIIKEKLNEDGS-----------------------ELSILNLGPTHPA
NUOD2_CYTH3      --------------------MDND-----------------------HLTTLNLGPTHPA
NUOD_LEPBA       ----MVMYEKTAEHFGQKFKDLPE-----------------------GHLLVNLGPSHPA
NUOD_LEPBP       ----MVMYEKTAEHFGQKFKDLPE-----------------------GHLLVNLGPSHPA
NUOD_LEPBJ       ------MYEKTAEHFEQKYKNLPE-----------------------GHLLVNLGPSHPA
NUOD_LEPBL       -----MMYEKTAEHFEQKYKNLPE-----------------------GHLLVNLGPSHPA
NUOD_LEPIN       -----MMYEKTAEHFEQKYKNLPE-----------------------GHLLVNLGPSHPA
NUOD_LEPIC       -----MMYEKTAEHFEQKYKNLPE-----------------------GHLLVNLGPSHPA
NUOD1_SORC5      -------MEPLDRELDEAELDLPS-----------------------EPMLLNMGPSHPA
NUOD_METI4       TREVRMEVPDTAELLRRSEDISGAPEG--------------------ERLILNMGPSHPS
                                                                    : .** **.

NUOD1_RHIME      AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDYVAPMNQEHA
NUOD1_SINMW      AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDYVAPMNQEHA
NUOD1_RHIEC      AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHA
NUOD1_RHIE6      AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHA
NUOD_RHIL3       AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHA
NUOD_AGRFC       AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHA
NUOD_BRUAB       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUA2       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUA1       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUC2       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUSI       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUO2       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUSU       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_BRUME       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_OCHA4       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQALPYLDRLDYVAPMNQEHA
NUOD_CHESB       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHILO       AHGVLRLVLELDGEVVDRVDPHIGLLHRGTEKLIEAKTYLQAVPYLDRLDYCAPMNQEHA
NUOD_AZOC5       AHGVLRMVLELNGEVVERVDPHIGLLHRGTEKLIEAKTYLQAVPYFDRLDYCAPMNQEHA
NUOD_XANP2       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEAKTYLQAVPYFDRLDYCAPMNQEHA
NUOD_BRASB       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIETKTYLQAMPYFDRLDYVAPMNQEHA
NUOD_BRASO       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIETKTYLQAMPYFDRLDYVAPMNQEHA
NUOD_BRADU       AHGVLRLVLELDGEIVARVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD2_NITHX      AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_NITWN       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHOP5       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHOPB       AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHOPS       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHOP2       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHOPA       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_RHOPT       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHA
NUOD_METEP       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQATPYFDRLDYVAPMNQEHA
NUOD_METPB       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQATPYFDRLDYVSPMNQEHA
NUOD_METRJ       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQATPYFDRLDYVSPMNQEHA
NUOD_METS4       AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEVKTYLQATPYFDRLDYVAPMNQEHA
NUOD1_BEII9      AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEARTYLQNVPYFDRLDYVAPMNQEHA
NUOD2_BEII9      AHGVLRLVLELDGEVVERADPHIGLLHRGTEKLIEYRTYLQALPYFDRLDYVAPMNQEHA
NUOD1_NITHX      AHGVLRLVLELDGEVVRRVDPHIGLLHRGTEKLIEHKTYLQALPYFDRLDYVAPMNQEHA
NUOD_PARL1       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQATPYFDRLDYVAPMNQEHA
NUOD_BARBK       AHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDYVAPMNQEHA
NUOD_BARHE       AHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDYVAPMNQEHA
NUOD_BART1       AHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDYVAPMNQEHA
NUOD_BARQU       AHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAVPYLDRLDYVAPMNQEHA
NUOD_CAUVC       AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLMEARTYLQNIPYFDRLDYVAPMNQEHA
NUOD_CAUSK       AHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLMEARTYLQNIPYFDRLDYVAPMNQEHA
NUOD_PHEZH       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEARPYAQTIPYFDRLDYVAPMNQEHA
NUOD_MARMM       AHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLLEHKTYLQGIGYFDRLDYVAPMNQEHA
NUOD_RUEPO       AHGVLRMVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_RUEST       AHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_ROSDO       AHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_DINSH       AHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_RHOS4       AHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_RHOS1       AHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_RHOS5       AHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMETRTYLQNLPYFDRLDYVAPMNQEHA
NUOD_JANSC       AHGVLRLVLELDGEICERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVGTMNQEHA
NUOD_PARDP       AHGVLRMVLELDGEIVERADPHIGLLHRGTEKLMESRTYLQNLPYLDRLDYVAPMNQEHA
NUOD_HYPNA       AHGVLRMILDLDGEIVTRVDSHIGLLHRGTEKLLEYKTYLQGMPYFDRLDYCAPMNQEHA
NUOD_PELUB       AHGVLRLILELDGEVVEKADPHIGLLHRGTEKLIENKTYMQAVPYFDRLDYVAPMNQEHA
NUOD_RICBR       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICB8       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICCN       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICM5       THGVLRLILEMDGEVVNNAVPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICRO       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICRS       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICFE       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICAH       THGVLRLILEMDGEIVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICCK       THGVLRLILEMDGEVVNNTDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICPR       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_RICTY       THGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_ORITB       THGVLRLILEMDGEIVERADPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_ORITI       THGVLRLILEMDGEIVERADPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDYVSPMCQEHA
NUOD_ANAMM       AHGVMRLILEMSGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMSQEHA
NUOD_ANAPZ       AHGVMRLILEMSGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMSQEHA
NUOD_EHRCJ       AHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMAQEHA
NUOD_EHRCR       AHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMCQEHA
NUOD_EHRRG       AHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMAQEHA
NUOD_EHRRW       AHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMAQEHA
NUOD_WOLPP       AHGVLRLVLEMDGEVIERADPHIGLLHRGTEKLIEHKTYLQALPYFDRLDYVSPMSQEHA
NUOD_WOLPM       AHGVLRLVLEMDGEVIERADPHIGLLHRGTEKLIEHKTYLQALPYFDRLDYVSPMSQEHA
NUOD_WOLTR       AHGVLRLVLEMDGEIIERADPHIGLLHRGTEKLIEHKTYLQALPYFDRLDYVSPMSQEHA
NUOD_NEOSM       AHGVLRLIMQLDGETVERLDPHIGFLHRGTEKLIEHKTYLQALPYFDRLDYVSPMAQEHA
NUOD_MAGSA       AHGVLRLILEMSGEVVDRADPHVGLLHRGTEKLIEHKTYLQATPYFDRLDYVGTMNQEHA
NUOD_RHORT       AHGVLRLVLELSGEVIERADPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYACPMNQEHA
NUOD_GLUDA       AHGVLRLVLEMEGEVVARAIPHIGLLHRGTEKLIEYKTYPKALPYFDRLDYVSPMCEEQA
NUOD_GRABC       AHGVLRLVLELDGEVVERADPHIGLLHRGTEKLIEYKSYLQALPYFDRLDYVSPMCEEHA
NUOD_ACICJ       THGVLRLIMELEGETVTRADPHIGLLHRGTEKLIEYKSYLQAVPYFDRLDYVSPMCCEHA
NUOD_ERYLH       AHGVLRMIMELDGEIIERVDPHVGLLHRGTEKLIEHKTYLQALPYFDRLDYCSPLCMEHS
NUOD_NOVAD       AHGVLRMVMELDGEIIERIDPHVGLLHRGTEKLIEHKTYLQALPYFDRLDYCSPLGMEHS
NUOD_SPHAL       AHGVLRMVMELDGEIIERVDPHVGLLHRGTEKLIEYKTYLQALPYFDRLDYCSPLGMEHS
NUOD_SPHWW       AHGVLRMVMELDGEIVERVDPHVGLLHRGTEKLIEYKTYLQALPYFDRLDYCSPLGMEHS
NUOD_ACIAC       AHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTFIQSLPYMDRLDYVSMMCNEHA
NUOD_ACISJ       AHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTYIQSLPYMDRLDYVSMMCNEQA
NUOD_DELAS       AHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDYVSMMCNEHA
NUOD_LEPCP       AHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAESKTFIQSLPYMDRLDYVSMMCNEHA
NUOD_METPP       AHGVLRLILELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDYVSMMCNEHA
NUOD_CHRVO       AHGVLRLVLELDGEVVQRADPHIGLLHRGTEKLAESKTFIQSLPYMDRLDYVSMMCNEHA
NUOD_RHOFT       AHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTYIQALPYMDRLDYMSMMCNESA
NUOD_AZOSB       AHGVLRLVLELDGEVVERADPHIGLLHRGTEKLAETRTWVQSVPYMDRLDYVSMMCNEHA
NUOD_AROAE       AHGVLRLVLELDGEVVVRADPHIGLLHRGTEKLAETRTWVQSVPYMDRLDYVSMMCNEHA
NUOD_METFK       AHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAENRTYLQSVPYMDRLDYVSMMVNEHA
NUOD_BORA1       AHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAEHKTFIQALPYMDRLDYVSMMCNEHA
NUOD_BORPE       AHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDYVSMMCNEHA
NUOD_HYDCU       AHGVLRLVLELDGETIVRSDPHIGLLHRGTEKLAEYKPFNQSIGYMDRLDYVSMMANEHA
NUOD_ACIF5       AHGVLRLVLELDGEVIERADPHIGLLHRATEKLAENKTYLQNLPYMDRLDYVSMLCNEHA
NUOD_NEIG1       AHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQA
NUOD_NEIG2       AHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQA
NUOD_NEIMA       AHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQA
NUOD_NEIMB       AHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQA
NUOD_NEIM0       AHGVLRMILELEGETIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQA
NUOD_NEIMF       AHGVLRMILELEGETIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQA
NUOD_XANOR       AHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHA
NUOD_XANOM       AHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHA
NUOD_XANOP       AHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHA
NUOD1_STRM5      AHGVLRLVLEMDGETVVRADPHVGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHA
NUOD_MAGMM       AHGVLRLLLELDGEVVERADPHVGLLHRGTEKLLEQKTYIQGTPYFDRLDYMSMMSEEHA
NUOD2_RHIME      THGVLRLVLQLDGEYVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLA
NUOD2_SINMW      THGVLRLVLQLDGEYVERIDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLA
NUOD2_RHIEC      THGVLRLVLELDGEFVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLA
NUOD2_RHIE6      THGVLRLVLELDGEFVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLA
NDHH_CAPBU       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_NASOF       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_BARVE       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_ARATH       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_DRANE       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_ARAHI       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_OLIPU       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_LEPVR       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_CRUWA       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_LOBMA       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_AETCO       MHGVLRLIVTLDGGDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_AETGR       MHGVLRLIVTLDGEDVVDCQPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAI
NDHH_SOYBN       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_PHAVU       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_LOTJA       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CICAR       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CUCSA       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_MORIN       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_OENEH       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDYLATMFTEAI
NDHH_OENBI       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDYLATMFTEAI
NDHH_OENGL       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDYLATMFTEAI
NDHH_OENAR       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDYLATMFTEAI
NDHH_OENPA       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDYLATMFTEAI
NDHH_EUCGG       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDYLATMFTEAI
NDHH_GOSBA       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_GOSHI       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CITSI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CARPA       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_IPOPU       MHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_PELHO       MHGVLRLILTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEVI
NDHH_POPAL       MHGVLRLILSLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_POPTR       MHGVLRLILSLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_MANES       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_SOLLC       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_SOLBU       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_SOLTU       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_TOBAC       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_NICSY       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ATRBE       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_NICTO       MHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_COFAR       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_JASNU       MHGVLRLIITLDGEDVIDCEPILGYLHRGMEKIAENRTILQYLPYVTRWDYLATMFTEAI
NDHH_SPIOL       MHGVLRLIVTLDGEDVIDCEPIVGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_VITVI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_DAUCA       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_PANGI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_FAGEA       MHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_GUIAB       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_HELAN       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_LACSA       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_PLAOC       MHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_NANDO       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_RANMC       MHGVLRLVVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_BUXMI       MHGVLRLIVSLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_AMBTC       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_DIOEL       MHGVLRLIVTLEGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ILLOL       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CHLSC       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CALFG       MHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_DRIGR       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CERDE       MHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_LIRTU       MHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_NUPAD       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_NYMAL       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_PIPCE       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ACOAM       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ACOCL       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_HORVU       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_WHEAT       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_BRADI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ORYNI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ORYSA       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ORYSI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ORYSJ       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_LOLPR       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_AGRST       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_SACHY       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDYLATMFTEAI
NDHH_SACOF       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDYLATMFTEAI
NDHH_SORBI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDYLATMFTEAI
NDHH_MAIZE       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDYLATMFTEAI
NDHH_LEMMI       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_CRYJA       MHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_CYCTA       MHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAV
NDHH_ANTAG       MHGVLRLIVTLDGENVTDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_ANGEV       MHGVLRLIVTSDGENVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_MARPO       MHGVLRLIVTLDGEDVLDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_PHYPA       MHGVLRLIVTLDGENVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_HUPLU       MHGVLRLIVTLDGENVTNCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_ADICA       MHGVLRLVVALQGENVVDCELILGYLHRGMEKIAENRTTSQYLPYVTRWDYLATMFTEAV
NDHH_PSINU       MHGVLRLIVTLDGENVADCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_CHAGL       MHGVLRLVVSLDGENVIDCDPVLGYLHRGMEKIAENRSIVQYLPYVTRWDYLATMFTEAI
NDHH_CHAVU       MHGVLRLIITLDGENVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAI
NDHH_STAPU       MHGVLRLIVTLDGENVIDCEPILGYLHRGMEKIAENRTTLQYLPYVTRWDYLATMFTEAV
NDHH_ZYGCR       MHGVLRLIVTLDGENVADCEPVLGYLHRGMEKIAESRTTLQYLPYVTRWDYLATMFTEAI
NDHH_MESVI       MHGVLRLIVTLDGENVIDCEPVLGYLHRAMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_CHLAT       MHGVLRLIVTLDGENVIDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH_NEPOL       MHGVLRLIVTLDGENVLDCEPVVGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEAI
NDHH1_GLOVI      MHGVLRLIVTLDGENVVDCVPVLGYLHRSMEKIAESRTIIQYLPYVTRWDYLATMFTEAI
NDHH_NOSS1       MHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAENRTTVMYVPYVSRWDYAAGMFNEAV
NDHH_THEEB       MHGVLRLMVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNIMFIPYVSRWDYAAGMFNEAV
NDHH_SYNY3       MHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAESRTNIMYVPYVSRWDYAAGMFNEAI
NUOD_AMOA5       THGILRLEVILDGEIVVDVVPHLGYLHRCFEKHAATLPYNQTIPFVDRLDYLAAMNSEHA
NUOD1_CYTH3      THGVLRLEILTDGEIVKDVIPHMGYLHRCYEKHAEKLPYNQVIPFVDRMDYLAAMNSEHA
NUOD_CHLP8       THGVLRLECITDGEVIVEAEPYLGYLHRCFEKHCENVDYPGIVPYTDRMDYLAGMNSELA
NUOD_CHLTE       THGVLRLECITDGEVVVEAEPYLGYLHRCFEKHCEKIDYPAIVPYTDRMDYLAGMNNELA
NUOD_CHLL2       THGVLKLECMTDGEVVTSAEPYLGYLHRCFEKHCEVVDYPGIVPYTDRMDYLAGMNNEWA
NUOD_CHLPD       THGVLKLECFTDGEVVTHAEPYLGYLHRCFEKHCEVVDYPGIVPYTDRMDYLAGMNSEWA
NUOD_PELLD       THGVLRLECRTDGEVVTEAEPYLGYLHRCFEKYCENVDYPAIVPYTDRMDYLAGMNSEMA
NUOD_CHLPM       THGVLRLECLTDGEVVTEAEPYLGYLHRCFEKHCEHVDYPAIVPYTDRMDYLAGINSEMA
NUOD_PELPB       THGVLKLECLTDGEVITEAEPYLGYLHRCFEKSCEHVDYPAIVPYTDRLDYLASMNSEQA
NUOD_CHLCH       THGVLKLECLTDGEVVTEAEPVLGYLHRCFEKTAENVDYPAVVPFTDRLDYLAAMNSEFA
NUOD_CHLPB       THGVLRLECKTDGEVVIEAEPYLGYLHRCFEKHAEMVDYPGIVPFVDRMDYLASMNNDFA
NUOD_PROA2       THGVLRLECKTDGEVVTEAEPYLGYLHRCFEKHAEVVDYPGIVPFVDRMDYLAAMNSEFA
NUOD2_CHLT3      THGVLRVELLTDGEVVVKATAHLGYLHRCFEKHAEYVDYPGIVPYVDRMDYLASMNNDFA
NUOD2_ANADE      THGVINFLVETDGEVLKRATPDVGYLHRSIEKIGELVGYPGFMPYTDRVDYVAAMFANEG
NUOD1_ANASK      THGVINFLVETDGEVLKRATPDVGYLHRSIEKIGEMVGYPGFMPYTDRVDYVAAMFANEG
NUOD1_ANADF      THGVINFIVETDGEVMKRAIPDVGYLHRSIEKIGEVTGYPGFMPFTDRIDYVAAMFANEG
NUOD2_SORC5      THGVLRFVISTDGEIIRKAVPDVGYLHRSIEKIGERCTYSGFMPYTDRVDYIAAMFANEA
NUOD_BACAN       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACCR       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACAH       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACCZ       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACHK       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACC1       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACMK       THGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_BACCN       THGVFRLIIKIDGETIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_GEOKA       THGVFRLILKIDGEIIQEATPVIGYLHRGTEKIAEGLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_GEOTN       THGVFRLILKIDGEIIQEATPVIGYLHRGTEKIAEGLQYTQIIPYTDRMDYLSAMTNNYV
NUOD_DESPS       THGVLRVKLTMDGEYIYSAETVIGYIHRMHEKMGENRTYNQYLPNLSRLDYLSAMAYCHG
NUOD2_OPITP      AHGVLRVLMRMDGEWVENAEPVIGYIHRMHEKMGENRTWAKFLPNTSRIDYLSAMHYTHA
NUOD_SYNFM       THGVLRVLLDLDGEFIVKADPVIGYGHRGHEKMGENRLFKQFLPNTSRLDYLSGFLFNHG
NUOD2_SALAI      THGVLRLRLVLDGERVVSAEPIVGYMHRGAEKLFEVRDYRQIIVLANRHDWLSAFANELG
NUOD2_SALTO      THGVLRLRLVLDGERVVSAEPVVGYMHRGAEKLFEVRDYRQIIVLANRHDWLSAFANELG
NUOD2_STRAW      THGVLRLRLVLDGERIQHAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDWLSAFSNELG
NUOD1_STRCO      THGVLRLKLVLDGERITSAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDWLSAFSNELG
NUOD2_STRGG      THGVLRLRIVLDGERVQHAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDWLSAFSNELG
NUOD_RUBXD       MHGLLRLILELDGETIVRCDPVMGYLHRCQEKIAENRTYPAVIPLTDRLDYFANMHNEHG
NUOD_DESHY       MHGVFRMVVRLQGETVTGIEPKIGYLHRGLEKIAESRTYPQFIPYTDRLDYLASPHNNLA
NUOD_HELMI       THGVLRIVLELDGEVVVKATPVIGYLHRGIEKICENRTYIQTVPFTDRMDYLAGMGNNLG
NUOD_CARHZ       THGVFRIILKLDGETIVDAEPVVGYLHRGIEKLAEDRTYTQVIPYTDRMDYLGAMSYNLG
NUOD2_SYMTH      THGVLRLMIKLDGEQVTWCEPDIGYLHRCFEKLAEQKTYPQVIPFTDRTDYLAAMLNELC
NUOD_CAMJE       AHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDYIAASANNYA
NUOD2_ROSCS      THGVFRMIVTVDGETIIDLKPVFGYLHRNHEQLAEVSTYIQSMPYTDRLDYFNSMANNHA
NUOD1_ROSS1      THGVFRMIVTVDGETIVDLKPVFGYLHRNHEQLAEVSTYIQSMPYTDRLDYFNSMANNHA
NUOD2_HERA2      THGVFRMLVTVDGETLVDLKPVFGYLHRNHEQLGEVNTYLQNMPFTDRLDYFNSMVNNHA
NQO4_THET8       THGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLA
NUOD_THET2       THGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLA
NUOD_DEIRA       THGVLRLVVDMDGEYVTRVEPHMGYLHTGFEKTMEHRTYQQNVTYAPRTDYLHSFSHELA
NUOD_DEIGD       THGVLRLVVDMDGEYVTRVTPHMGYLHTGFEKTFEHRTYHQGVTYAPRTDYLHCFGHELA
NUOD2_KORVE      THGVLRLLLEIDGETIVRIMPDIGYLHTGIEKTCEAKFYQQVVPMTDRIDYLCPMTNNLA
NUOD1_SOLUE      THGVLRLLMELDGENIMKCVPDIGFLHTGIEKEFEEKFYQQAVTLTDRVDYLAPLSNNLG
NUOD1_ROSCS      THGVLRLVVELDGETVVDVAPDIGYLHTGIEKTMESKTYQKAVVLTDRTDYLAPLSNNLS
NUOD2_ROSS1      THGVLRLVVELDGETVVDVAPDIGFLHTGIEKTMESKTYQKAVVLTDRTDYLAPLSNNLS
NUOD2_CHLAA      THGVLRLVLELDGEVVVNVAPDVGYLHTGIEKTMESKTYQKAVVLTDRMDYLAPLSNNLC
NUOD1_HERA2      THGVLRLAVELNGENVVQLAPDVGFLHTGIEKTIETKTYTKSIVLTDRMDYLAPMSNNMV
NUOD_GEOMG       THGVLRLVVELDGEIIQKITPHIGYLHRGVEKLSEHRTYHQTIPLTDRLDYLAPMHNNLG
NUOD_GEOSL       THGVLRMVIELDGEVIQKITPHIGYLHRGVEKLSEHRTYHQTIPLTDRLDYLAPMSNNLG
NUOD_GEOBB       THGVLRLVVELDGEVIQKITPHIGYLHRGIEKLSEHRTYHQALPLTDRMDYLAPMHNNLG
NUOD_GEOUR       THGVLRLIVELDGEIIQKVTPHIGYLHRGIEKLSEHRTYHQTIPLTDRLDYLAPMSNNLG
NUOD_GEOLS       THGVLRMVIELDGETILKIDPDIGYLHRGVEKLSEHRTYHQTLPLTDRLDYLAPMSNNLG
NUOD_MYCBP       THGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCTA       THGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCTU       THGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCBO       THGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCMM       THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCUA       THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCA1       THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCPA       THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCGI       THGVLRLILEIEGETIVEARCGIGYLHTGIEKNLEFRTWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCVP       THGVLRLILEIEGEIIVEARCGIGYLHTGIEKNLEFRNWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCSJ       THGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCSK       THGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCSS       THGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCS2       THGVLRLILEIEGEIITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETA
NUOD_MYCA9       THGVLRLILEIEGETVTDVRCGIGYLHTGIEKNLEYRTWTQGVTFVTRMDYLSPFFNETA
NUOD_NOCFA       THGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRTWMQGVTFVTRMDYLSPFYNETA
NUOD_RHOJR       THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRTWTQGVTFVTRMDYLSPFFNETA
NUOD1_STRAW      THGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEYRTWTQGTTFVTRMDYLTPFFNETA
NUOD2_STRCO      THGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEYRTWTQGTTFVTRMDYLTPFFNEAA
NUOD1_STRGG      THGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEFRNWTQGTTFVTRMDYLTPFFNETA
NUOD_NOCSJ       THGVLRLILELEGETVTEARAGIGYLHTGIEKNMEYRTWTQGVTFCTRMDYLSPFFNEMT
NUOD_THEFY       THGVLRLILTLDGETVTEARVGIGYLHTGIEKNMEYRTWTQGTTFVTRMDYLTPLFNETA
NUOD_FRAAA       THGVLRLVLEIDGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADYLSPLYNEAA
NUOD_FRACC       THGVLRLVLEIEGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADYLSPLFNEAA
NUOD_FRASN       THGVLRLVLEIEGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADYLSPLYNEAA
NUOD1_SALAI      THGVLRLVLELEGETVREARSVVGYLHTGIEKNLEFRNWVQGSTFVTRMDYLAPLFNETA
NUOD1_SALTO      THGVLRLVLELEGETVRELRSVVGYLHTGIEKNMEFRNWVQGAAFVTRMDYLAPLFNETA
NUOD_ACIC1       THGVLRLVLELEGETVTQARVVVGYLHTGIEKNCEYRTYTQAVTFLTRADYLSPLFTETA
NUOD_SACEN       AHGVLRLVFELEGETIVKARSVIGYLHTGIEKNVEYRTWTQGVTFVTRMDYLAPLHNETA
NUOD_CUTAK       THGVMRLIIELDGESVSDLRVGIGFLHTGIEKNMEFRTWTQGVTFMTRCNYVANFFNELV
NUOD1_SYMTH      THGVLRVKLELEGETVVKAEPETGFLHTGIEKTAEHLTWNQATTVMDRMDYLSPISNNTG
NUOD_THEM4       MHGNFSVHMYVEGDTVVKARPLPGFLHRGFEKLMERRLWYQNLALIPRICVPEPDINELC
NUOD_PARUW       THGVLRLKLRLEGEVVLSCDPVIGYLHTGVEKECESRTYHQVFTLVDRLDYLSGPAEEQA
NUOD_FLAJ1       THGIFQNILLMDGERILEAEPTIGYIHRAFEKIAENRPFYQITPLTDRMNYCSSPINNMG
NUOD_FLAPJ       THGIFQNILLMDGERIVDAEPTIGYIHRAFEKIAENRPFYQITPLTDRMNYCSSPINNMA
NUOD2_CYTH3      THGVFQNILKMDGERIVDAVPTVGYIHRAFEKIAERRAFYQITTLTDRMNYCSAPLNNMG
NUOD_LEPBA       THGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNYVSTPLNNIG
NUOD_LEPBP       THGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNYVSTPLNNIG
NUOD_LEPBJ       THGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIG
NUOD_LEPBL       THGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIG
NUOD_LEPIN       THGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIG
NUOD_LEPIC       THGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIG
NUOD1_SORC5      MHGTVRIVLELSGETINKADVQIGYLHRGFEKMCERGTWSQVFPYVDRLNYVSPMLNNVG
NUOD_METI4       THGVFQLLLELDGEVITKAIPEVGYLHRGDEKIAENMQYNQFVPYTDRLDYLAPLANNVV
                  ** .       *          *  *   *:               *            

NUOD1_RHIME      FALAVERLTG--TQVPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD1_SINMW      FALAVERLTG--TQVPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD1_RHIEC      YALAVEKLLG--IQIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD1_RHIE6      YALAVERLLG--IEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHIL3       YAMAVEKLLG--IEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_AGRFC       FALAVEKLLG--LEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGA-MTPPVWGFEER
NUOD_BRUAB       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUA2       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUA1       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUC2       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUSI       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUO2       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUSU       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRUME       YALAVERLLD--IEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_OCHA4       YALAVERLLG--IDVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_CHESB       FALAIERLLG--IDVPIRGQLIRVLYSEISRILNHLLNITTQAMDVGA-LTPPLWGFEER
NUOD_RHILO       FALAAERLLG--IEVPKRGQLIRVLYCEIGRIMSHILNVTTQAMDVGA-LTPPLWGFVER
NUOD_AZOC5       FCLAVERLAG--IEVPKRGQLIRVLYSEIGRLLSHLLNVTTFAMDVGA-LTPPLWGFEAR
NUOD_XANP2       FCLAAEKLLG--IEVPKRGQLIRVLYSEIGRLLSHLLNVTTFAMDVGA-LTPPLWGFEER
NUOD_BRASB       FCLAAERLLG--IEVPRRGQLIRVLYSEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRASO       FCLAAERLLG--IEVPRRGQLIRVLYSEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BRADU       FCLAAEKLLG--IEVPRRGQLIRVLYCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD2_NITHX      FCLAAEKLLG--IAVPRRGQLIRVLYCEIGRILSHLLNVTTQALDVGA-LTPPLWGFEER
NUOD_NITWN       FCLAAERLLG--IAVPRRGQLIRVLYCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOP5       FCLAAEKLLG--IAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOPB       FCLAAEKLLD--IAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOPS       FCLAVEKLLG--IAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOP2       FCLAAEKLLG--IEAPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOPA       FCLAVEKLLG--IAVPRRAQLIRVLYAEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOPT       FCLAVEKLLG--IAVPRRAQLIRVLYAEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_METEP       FCLAIERLAG--IEVPRRAQLIRTLFCEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_METPB       FCLAIERLAG--IEVPRRAQLIRTLFCEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_METRJ       FCLAIEKLAG--IEVPRRAQLIRVLFCEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_METS4       FCLAVEKLLG--IEVPRRAKLIRTLFCEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD1_BEII9      FCLAIEKLLG--IEVPRRGQLLRVLWCEIGRILSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD2_BEII9      FCLAIEKLLQ--MPVPRRGQLIRVLFCEIGRLLSHLLNITTQALDIGA-LTPPLWGFEER
NUOD1_NITHX      FCLATEKLLN--ITIPKRGQLIRVLYCEIGRLLSHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_PARL1       FVLAAERLLG--LEVPRRAQFIRVLYSEIGRILAHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_BARBK       FVLAVEKLLG--VEVPKRGQLIRVLFSEIGRLLNHLLNVTTQAMDVGA-LTPPLWGFEQR
NUOD_BARHE       FVLAIEKLLG--VEVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEQR
NUOD_BART1       FVLAIEKLLN--IKVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEQR
NUOD_BARQU       FVLAIEKLLG--VEVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEQR
NUOD_CAUVC       FCLAIEKLLG--VEVPIRGQIIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_CAUSK       FCLAIEKLLG--VDVPLRGSLIRVLFCEIGRVLNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_PHEZH       YCLAIEKLLG--VEVPVRGLLIRTLYDEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_MARMM       FCMAAEKLAG--ITVPKRGEYVRVLYCEIGRVLNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RUEPO       WCLAIEKLTG--VEVPRRASLIRVLYSEIGRILNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RUEST       WCLAIEKLTG--VEVPRRAQLIRVLYSEIGRILNHLLNITTQAMDVGA-LTPPLWGFEER
NUOD_ROSDO       WCLAIEKLTG--VEVPRRASLIRVLFCEIGRILNHILNITTQAMDVGA-LTPPLWGFEER
NUOD_DINSH       WCLAIEKLTG--TVVPRRGSLIRVLYCEIGRILNHLLNITTQAMDVGA-LTPPLWGFEER
NUOD_RHOS4       WCLAIERLTG--VAVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOS1       WCLAIERLTG--VAVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_RHOS5       WCLAIERLTG--VQVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGA-LTPPLWGFEER
NUOD_JANSC       WCLAIERMTG--TDVPRRAQLIRVLYCEIGRILNHLLNVTTQALDVGA-LTPPLWGFEER
NUOD_PARDP       WCLAIERLTG--TVIPRRASLIRVLYSEIGRILNHLMGVTTGAMDVGA-LTPPLWGFEAR
NUOD_HYPNA       WCLAIEKLLG--VEVPRRASIIRVMYSEIGRIMSHLLNVGTGVMDVGA-LTPITWCFEER
NUOD_PELUB       FALAIEKILK--INVPIRAQLIRVMFCEIGRILSHILNVTTQALDVGA-LTPSLWGFEER
NUOD_RICBR       FALAAESLLE--CEIPRRAQFIRVLFSELTRILNHTLNIGSQALDVGA-TTPLLWLFEER
NUOD_RICB8       FALAAESLLE--CEIPRRAQFIRVLFSELTRILNHTLNIGSQALDVGA-TTPLLWLFEER
NUOD_RICCN       FALAVESLLE--CEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICM5       FALAVESLLE--CEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICRO       FALAVESLLE--CEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICRS       FALAVESLLE--CKVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICFE       FALAVESLLE--CEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICAH       FALAVESLLE--CEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICCK       FALAVESLLK--CEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICPR       FALAVESLLE--CSVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_RICTY       FALAVESLLE--CSVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGA-TTPLLWLFEER
NUOD_ORITB       FALAIEHLLK--CEVPLRAQYIRVMFSELTRILNHTLNIATQALDVGA-TTPLLWMFEER
NUOD_ORITI       FALAIEHLLK--CEVPLRAQYIRVMFSELTRILNHTLNIATQALDVGA-TTPLLWMFEER
NUOD_ANAMM       YSLCVEKLLQ--CVVPPRAKYIRVIFCELTRVLNHLLNVSSQALDTGA-TTPLLWMFEER
NUOD_ANAPZ       YSLCVERLLG--CEVPIRAKYLRVIFCELTRLLNHLLNVACQALDSGA-TTPLLWIFEER
NUOD_EHRCJ       YSLCVEKLLK--CEIPIRAKYLRVIFCELTRILNHLLNISSQALDIGA-MTPLLWMFEER
NUOD_EHRCR       YSLCVEKLLK--CEIPIRAKYLRVIFCELTRILNHLLNISSQALDIGA-MTPLLWMFEER
NUOD_EHRRG       YSLCVEKLLK--CEVPIRAKYLRVIFCELTRILNHLLNISSQALDIGA-MTPLLWMFEER
NUOD_EHRRW       YSLCVEKLLK--CEVPIRAKYLRVIFCELTRILNHLLNISSQALDIGA-MTPLLWMFEER
NUOD_WOLPP       YSLCVEKLLQ--CEIPIRAKYLRVLFCELTRILNHLLNISSQALDVGA-MTPLLWLFEER
NUOD_WOLPM       YSLCVEKLLQ--CEVPIRAKYLRVLFCELTRILNHLLNVSSQALDVGA-MTPLLWLFEER
NUOD_WOLTR       YSLCVEKLLQ--CEVPIRAKYLRVLFCELTRILNHLLNISSQALDVGA-MTPLLWLFEER
NUOD_NEOSM       YSLCVEKLLG--ITVPPRAQYLRVIFVEITRILNHLLNVTTHALDVGA-MNPLFWMFEER
NUOD_MAGSA       FVLATEKLLG--IDIPIRAKFIRTLYDEIGRILNHLLNVTAFIFDVGG-MTPLLYGFEER
NUOD_RHORT       YVLAVEKLLG--ITVPPRAQYLRTLFNEVTRLINHIMNTTSMALDIGA-MTPLLYGFEER
NUOD_GLUDA       FALATEKLLG--IDIPDRAKWIRVMFAEITRILNHILNLTALGLDCGA-VTPALWGYEER
NUOD_GRABC       FALATEKLLG--ITAPERAQWIRTMFAEITRILNHLLNLTTYALDGGA-MTPVLWGHEER
NUOD_ACICJ       FALATERLLG--VKVPERAQWIRVLFAEITRILNHLLNAVHLALDIGA-QSPSLWGYEER
NUOD_ERYLH       YVLAIEKLLN--IEVPERAQYLRVLFAELTRISNHMLNLGAHVLDVGA-FTPNLWMFELR
NUOD_NOVAD       YVLAVEKLLN--IEVPLRAQYLRVLFAELTRICNHMLNLGSHVMDVGA-MTPNLWLFEIR
NUOD_SPHAL       YVLAIEKLLD--LEVPARAQYLRTMFAELTRICNHMLNIGSHVMDVGA-MTPNLWVFELR
NUOD_SPHWW       YVLAIEKLLQ--LEVPLRAQYLRVLFAELTRICNHMLNIGSHVMDVGA-MTPNLWLFEIR
NUOD_ACIAC       YCLAIEKLLG--IDVPLRAQYIRVMFSEITRLLNHLMWLGSHGNDCGS-STILIYTFRER
NUOD_ACISJ       YCLAIEKMLG--IEVPLRAKYIRTMFGEITRLLNHLMWLGSHGNDCGS-STILIYTFRER
NUOD_DELAS       YCLAIEKLLG--IEVPIRAQYIRVMYSEITRIMNHLMWLGSSGNDAGS-STTLIYTFRER
NUOD_LEPCP       YCLAIEKLMG--IQVPERAQYIRVMFSEITRLLNHLLWLGCHGMDCGA-MNMLIYCFRER
NUOD_METPP       YCLAIEKLLG--VDVPVRAQYIRVMFSEITRILNHLLWIGAHGLDCGA-MNILIYAFRER
NUOD_CHRVO       YCLAIEKMMG--IEVPERAQYIRVMFAEITRILNHLLWIGAHALDIGA-MTMFLYAFRER
NUOD_RHOFT       YCLAVEKMLG--LEVPIRAKYIRVMFAEITRLLNHLLCVGAGALDCGA-MTVMLYAFRER
NUOD_AZOSB       YCMAIERLLG--VEVPLRAQYIRVMFDEITRILNHLLNIGTHALDIGA-MTMVLYTFRER
NUOD_AROAE       YCLAIERLLG--LEVPIRAQYIRVMFDEITRILNHLLGIGTHALDIGA-MTMVLYTFRER
NUOD_METFK       YVMAIEKLLG--LEVPLRAQYIRVMFDEITRILNHLLWLGAHALDVGA-MTVFLYAFRER
NUOD_BORA1       YVMAIEKMLG--VEAPLRAQYIRVMFDEITRILNHLMSLGSHALDVGA-MAVFLYAFRER
NUOD_BORPE       YVMAIEKLLG--IEAPLRAQYIRVMFDEITRVLNHLMSLGSHALDVGA-MAVFLYAFRER
NUOD_HYDCU       YVMGIEKMLG--IEVPERAQYIRVMFDEITRILNHLMWLGAHALDIGA-MTVFLYAFRER
NUOD_ACIF5       YCLAVEKLLG--VEVPVRAQYIRTLFDEITRILNHLLWLGAYALDVGA-MSVFLYCFRER
NUOD_NEIG1       YCLAVEKLAG--IDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGA-MTAILYAFRDR
NUOD_NEIG2       YCLAVEKLAG--IDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGA-MTAILYAFRDR
NUOD_NEIMA       YCLAVEKLAG--IDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGA-MTAILYAFRDR
NUOD_NEIMB       YCLAVEKLVG--IDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGA-MTAILYAFRDR
NUOD_NEIM0       YCLAVEKLAG--IDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGA-MTAILYAFRDR
NUOD_NEIMF       YCLAVEKLAG--IDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGA-MTAILYAFRDR
NUOD_XANOR       YVRAIESLMG--IEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGA-MAVMLYAFRER
NUOD_XANOM       YVRAIESLMG--IEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGA-MAVMLYAFRER
NUOD_XANOP       YVRAIESLMG--IEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGA-MAVMLYAFRER
NUOD1_STRM5      YVRAIETLLG--IEAPIRAQYIRTMFDEITRILNHLMNIGTGALDLGA-MAVMLYAFRER
NUOD_MAGMM       WVIAVERLGQ--IEVPERAQYIRTIYAEITRFINHLLFFAAHGLDVGA-MTMFLYCFRER
NUOD2_RHIME      FALAVEKLLG--IEAPIRAQYIRVMMAELARISGHLLITGALPMDLGA-MTALLYAMRER
NUOD2_SINMW      FALAVEKLLG--IEAPIRAQYIRVMMAELARISGHLLITGALPMDLGA-MTALLYAMRER
NUOD2_RHIEC      FALAVEKLLG--IEAPIRAQYIRVMMAELARISGHLLITGALPMDLGA-MTALLYVMRER
NUOD2_RHIE6      FALAVEKLLG--IEAPIRAQYIRVMMAELARISGHLLITGALPMDLGA-MTALLYVMRER
NDHH_CAPBU       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NASOF       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_BARVE       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ARATH       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_DRANE       TVNGPEQLGN--IQIPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ARAHI       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_OLIPU       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_LEPVR       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CRUWA       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_LOBMA       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_AETCO       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_AETGR       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_SOYBN       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_PHAVU       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_LOTJA       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CICAR       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CUCSA       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_MORIN       TINGPELLGN--IQVPKRASYIRAIMLELSRIASHLLWLGPFLADIGA-QTPFFYIFRER
NDHH_OENEH       TINGPEQLGN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_OENBI       TINGPEQLGN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_OENGL       TINGPEQLGN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_OENAR       TINGPEQLGN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_OENPA       TINGPEQLGN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_EUCGG       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_GOSBA       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_GOSHI       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CITSI       TVNGPEQLGN--IRVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CARPA       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_IPOPU       TVNGPERLSN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_PELHO       TVNAPEQLGN--IQVPKRAGYIRTIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_POPAL       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGG-QTPFFYIFRER
NDHH_POPTR       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGG-QTPFFYIFRER
NDHH_MANES       TVNGPELLGN--IQVPKRAGYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_SOLLC       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_SOLBU       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_SOLTU       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_TOBAC       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NICSY       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ATRBE       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NICTO       TINGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_COFAR       TVNGPEQLGN--IQVPKRASYIRAILLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_JASNU       SVNGPEQLGN--IQVPKRASYIRTIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_SPIOL       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_VITVI       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_DAUCA       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_PANGI       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFLADIGA-QTPFFYIFRER
NDHH_FAGEA       TINAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_GUIAB       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_HELAN       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_LACSA       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_PLAOC       TVNAPEQLGN--IQVPKRASYIRAIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NANDO       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_RANMC       TVNGPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_BUXMI       TINAPEQLGN--IQVPKRASHIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_AMBTC       TVNAPEELGN--IQVPRRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_DIOEL       TVNAPEQLGN--VQVPQRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ILLOL       TVNAPEELGN--IQIPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYISRER
NDHH_CHLSC       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CALFG       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_DRIGR       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CERDE       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_LIRTU       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NUPAD       TVNAPEELGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NYMAL       TVNAPEELGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_PIPCE       TVNAPEQLGN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ACOAM       TVNGPEQLGN--IQIPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ACOCL       TVNGPEQLGN--IQIPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_HORVU       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_WHEAT       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_BRADI       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_ORYNI       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_ORYSA       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_ORYSI       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_ORYSJ       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_LOLPR       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_AGRST       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_SACHY       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_SACOF       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_SORBI       TVNAPEFLEN--IQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_MAIZE       TVNAPEFLEN--IQIPKRASYIRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYIFRER
NDHH_LEMMI       TVNAPEQLGN--IQVPQRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CRYJA       TVNAPEKLEN--IQIPKRASYIRMIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_CYCTA       TVNAPERLGN--IQVPKRASCIRVIMLELSRIAPHLLWLGPFMADIGA-QTPFFYISRER
NDHH_ANTAG       TVNAPEKLTN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_ANGEV       TVNAPEKLAN--IQIPKRASYIRIIMLELSRIASHLLWLGPFMADVGA-QTPFFYIFRER
NDHH_MARPO       TVNAPEKLTN--IQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_PHYPA       TVNAPEKLTN--IQVPKRASYIRMIMLELSRVASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_HUPLU       TVNAPEKLAN--IQVPKRASYIRVIMPELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ADICA       TVNAPEKLAN--IQIPERASYIRVIMLELSRIASHLLWLGPFLADIGA-QTPFFYIFRER
NDHH_PSINU       TVNAPEKLAN--IRIPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_CHAGL       TVNAPEKLAN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_CHAVU       TINAPEKLAN--IQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_STAPU       TVNAPERLAN--IQVPKRASYIRVIMLELSRLASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_ZYGCR       TVNAPERLAN--IQVPKRASYIRMIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_MESVI       TVNAPEKLAN--IEVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYILRER
NDHH_CHLAT       TVNAPERLAN--IEVPKRASYIRVIMLELSRIASHLLWLGPFMADIGA-QTPFFYIFRER
NDHH_NEPOL       TVNAPERLAN--IEVPRRASYLRVIMLELSRIASHLLWLGPFMADLGA-QTPFFYILRER
NDHH1_GLOVI      TVNAPEQLAG--VQVPRRARYIRVIMLELSRIASHLLWLGPFMADIGA-TSPFFYIFRER
NDHH_NOSS1       TVNAPEKLAG--VAVPKRASYIRVIMLELNRIANHLLWFGPFLADVGA-QTPFFYQFRER
NDHH_THEEB       TVNAPEKLAG--IPVPKRASYIRVIMLELNRIANHLLWLGPFLADVGA-QTPFFYIFRER
NDHH_SYNY3       TVNAPEKLAD--IEVPKRAQYIRVIMLELNRIANHLLWLGPFMADVGA-QTPFFYIFRER
NUOD_AMOA5       FAMGVEHMLGLTGKLPRRVEYIRVLMAELNRLASHFMAIGTYGIDLGA-FTSFLWLMRDR
NUOD1_CYTH3      YAMGVERMLGIENDIPKRVEYIRVLVAELNRISSHFVAIGTYGLDIGA-FTPFLWVMRDR
NUOD_CHLP8       YCLTVEKLLDIE--IPRRVEFIRVITSELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD_CHLTE       YCITVEKLLDIE--IPRRVEFIRVIVAELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD_CHLL2       YCIAVEKLLDIE--IPRRVEFIRVMVSELNRIASHLVAIGTYGIDLGA-FTPFLFCFRDR
NUOD_CHLPD       YCLAVEKLLDLE--LPRRVEFIRVIVSELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD_PELLD       YAIAVEKLLDIE--IPRRVEFIRVIVSELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD_CHLPM       YCVAVEKLLDLE--IPRRVEFIRVIVSELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD_PELPB       YAMAVEKLLDIE--IPRRVEFIRVIVAELNRIASHLVAIGTYGIDLGA-FTPFLFCFRDR
NUOD_CHLCH       YALTVEKLLDIE--IPRRVEFIRILVAELNRIASHLVAIGTYGIDLGA-FTPFLFCFRDR
NUOD_CHLPB       YCIAVEKLLDIE--IPRRVEFMRVIVSEINRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD_PROA2       YCIAVEKLLDVE--IPRRVEFMRVIVSELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD2_CHLT3      YCVAVEKLLGIE--IPRRIEFMRVIVAELNRIASHLVAIGTYAIDLGA-FTPFLFCFRDR
NUOD2_ANADE      YAIAVERLLKIE--VPQRAQWLRAISCELCRIASHLVSVGTMVMDIGA-FTPMLHGIRER
NUOD1_ANASK      YAIAVERLLKIE--VPQRAQWLRAISCELCRIASHLVSVGTMVMDIGA-FTPMLHGIRER
NUOD1_ANADF      YAIAVEKLLKVE--VPPRAQWLRAISGELVRIASHLIAVGTMTMDIGA-FTPMVHGLRER
NUOD2_SORC5      WASACEKLMGIE--VPKRAQYLRVISCELNRIGSHMIALGAMAMDVGA-VTPFPWALRER
NUOD_BACAN       ICHAVETMMG--LEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACCR       ICHAVETMMG--LEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACAH       ICHAVETMIG--LEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACCZ       ICHAVETMMG--LEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACHK       ICHAVETMMG--LEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACC1       ICHAVETMMG--LEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACMK       LCHAVETMMD--LEIPERAEYLRVLAMELGRVASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_BACCN       ICHAVETMMG--LEIPERAEYLRVLAMELGRVASHLVWWGTNLLDIGA-VSPFLYAFRER
NUOD_GEOKA       LCHAVETMMG--IEVPERAEYLRVLAMELGRIASHLVWWGTYLLDLGA-TSPFLYAFRER
NUOD_GEOTN       LCHAVETMMG--IEVPERAEYLRVLAMELGRIASHLVWWGTYLLDLGA-TSPFLYAFRER
NUOD_DESPS       YVLAVEKAGS--IEVPERAEYIRAITVELNRLSSHLVWFGAFIMDLGG-FSPLMYAFDDR
NUOD2_OPITP      WVGVVERGLK--IEVPERAEYIRVITSELNRIASHQVWWGALLLDLGG-FTPILYAFDDR
NUOD_SYNFM       YVLAVEKLAG--IPVPPRAQFIRTICSEFNRIASHLLWFGTYVMDLGG-FTPFLYAFDDR
NUOD2_SALAI      VVLAVERLMG--MEVPERATWLRMALAELNRVLNHLMFLGSYPLEIGA-ITPMFYAFRER
NUOD2_SALTO      VVLAVERLLG--MEVPERATWLRMALAELNRVLNHLMFLGSYPLEIGA-ITPMFYAFRER
NUOD2_STRAW      VVLAVERMLG--MEVPERAVWTRTLLAELNRVLNHLMFLGSYPLELGG-ITPIFYAFTER
NUOD1_STRCO      VVLAVERMLG--MEVPTRAVWTRTLLAELNRVLNHLMFLGSYPLELGG-ITPVFYAFRER
NUOD2_STRGG      VVMAVERMLG--MEVPERAVWTRTLLAELNRVLNHLMFLGSYPLELGG-ITPVFHAFRER
NUOD_RUBXD       YCLAVEDLLG--VEIPPRAEYIRVLMCELMRIASHLPSIGFLLLELGA-FTPILYAFRER
NUOD_DESHY       YVQTVEKLMG--LEIPERAEYLRIILAELARFASHQVFIASAALDMAG-WTAWGYPFRDR
NUOD_HELMI       ISQAVEKLMG--VEVPERAEYIRVIMCELSRIASHMICCGSLVQDLGG-VTGFVFFIRDR
NUOD_CARHZ       YVQAIEKLMG--IEVPERAEFIRVIATELSRIASHHVFLASMSLDMGS-YTGWMYPFRDR
NUOD2_SYMTH      YVEAVEKLFGDAIQVPERAQYIRVMLAELQRITSHLLALGSMAMDLGA-TTPFLYCWRDR
NUOD_CAMJE       YCAAVEKLCG--LEIPRRAAVIRMILLELNRITSHLLWLATHALDIGA-MSVFLYCFRER
NUOD2_ROSCS      LALAVEKLAG--ISVPQRAEYIRVLMVELTRILNHASAVGFLLNDMGAWQTPLMFGMRER
NUOD1_ROSS1      LALAVEKLAG--ISVPQRAEYIRVLMVELTRILNHASAVGFLLNDMGAWQTPLMFGMRER
NUOD2_HERA2      YARAVETLAG--VEVPERAQYIRVIMDELSRILNHATAMGFMLGDMGAWQTALLWGMRER
NQO4_THET8       YALAVEKLLGA--VVPPRAETIRVILNELSRLASHLVFLGTGLLDLG-ALTPFFYAFRER
NUOD_THET2       YALAVEKLLGA--VVPPRAETIRVILNELSRLASHLVFLGTGLLDLG-ALTPFFYAFRER
NUOD_DEIRA       YVLSVEKLLGA--EVPERANVVRVILHELGRIHSHLVFVGTGLLDLG-ALTPFFYAFREK
NUOD_DEIGD       YVLSVEKLLGA--EVPERATTVRVMLHELGRIHSHLVFVGTGLLDLG-ALTPFFYAFREK
NUOD2_KORVE      YVLAVEKLLGL--EIPERAQWIRVLCNELTRINSHLVWLGTGAMDLG-AMTVFLYCFRER
NUOD1_SOLUE      WCLAVEKLLQL--EIPPQAQWMRVMLTELTRLNSHLVWLGTHALDIG-AMSVFLYCFRER
NUOD1_ROSCS      YVLAVEKLLGC--EVPERATVARVLLVELQRIASHLVWLGTHALDLA-AMSVFLYGFRER
NUOD2_ROSS1      YVLAVEKLLGC--EVPERATVARVLLVELQRIASHLVWLGTHALDLA-AMSVFLYGFRER
NUOD2_CHLAA      YALAVEKLLDV--EIPERAQIARVLLTELQRISSHLVWLGTHALDLA-AMSVFLYAFRER
NUOD1_HERA2      YVAAIEKLMQQ--DVPERAQTLRVLLLELTRINSHLVWLGTHALDLA-AMSVFFYAMRER
NUOD_GEOMG       YVLAVEKLLGI--EVPERAQTIRVILAELTRLKSHLVWVACHALDIG-AMTVFIYAFRER
NUOD_GEOSL       YVLAVEKLLGI--EIPERAQTIRVIMAELTRLKSHLVWIACHALDIG-AMTVFIYAFRER
NUOD_GEOBB       YVLAVEKLLGI--EVPERAETIRVIMAELTRLKSHLVWIACHALDIG-AMTVFIYAFRER
NUOD_GEOUR       YVLAVEKLLGI--DVPERAQVIRVIMAELTRLKSHLVWIACHALDIG-AMTVFLYAFRER
NUOD_GEOLS       YMLAVEKLLGI--EVPERAQTIRIIMTELTRLQSHLVWLACHALDIG-AMTVFIYAFRER
NUOD_MYCBP       YCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELG-AMTPMFVGFRAR
NUOD_MYCTA       YCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELG-AMTPMFVGFRAR
NUOD_MYCTU       YCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELG-AMTPMFVGFRAR
NUOD_MYCBO       YCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELG-AMTPMFVGFRAR
NUOD_MYCMM       YCLGVEKLLGITDEIPERVNVIRVMMMELNRISSHLVALATGGMELG-AMTPMFVGFRAR
NUOD_MYCUA       YCLGVEKLLGITDEIPERVNVIRVMMMELNRISSHLVALAAGGMELG-AMTPMFVGFRAR
NUOD_MYCA1       YCLGVEKLLGITDQIPERVNVIRVMMMELNRISSHLVALATGGMELG-AMTPMFVGFRGR
NUOD_MYCPA       YCLGVEKLLGITDQIPERVNVIRVMMMELNRISSHLVALATGGMELG-AMTPMFVGFRGR
NUOD_MYCGI       YCLGVEKLLGVTDDIPERASVIRVMMMELNRISSHLVALATGGMELG-AMTAMFLGFRER
NUOD_MYCVP       YCLGVEKLLGITDAIPERASVIRVMMMELNRISSHLVALATGGMELG-AMTAMFLGFRER
NUOD_MYCSJ       YCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSHLVALATGGMELG-AMSAMFYGFRER
NUOD_MYCSK       YCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSHLVALATGGMELG-AMSAMFYGFRER
NUOD_MYCSS       YCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSHLVALATGGMELG-AMSAMFYGFRER
NUOD_MYCS2       YCLGVEKLLGITDDIPERASVIRVMLMELNRISSHLVALATGGMELG-AMSAMFYGFRER
NUOD_MYCA9       YCLGVEQLLGIADEIPERANVIRVLMMELNRISSHLVALATGGMELG-AMTAMFLGFRER
NUOD_NOCFA       YCLGVERLLGITEQIPERASIVRVLLMELNRISSHLVCLATGGMELG-ALTPMLFGFRER
NUOD_RHOJR       YCLGVEKLLDITDEVPERASVIRVMLMELNRISSHLVALATGGMELG-AVTAMLFGFRER
NUOD1_STRAW      YCLAVEKLLGIENEIPDRASIIRVLLMELNRMSSHLVCIATGGMELG-ATTIMIYGFRDR
NUOD2_STRCO      YCLGVEKLLGIDDQIPDRATIIRVLLMELNRLSSHLVAIATGGMELG-ATTIMIYGFRDR
NUOD1_STRGG      YCLGVEKLLGIEDQIPDRATVLRVLLMELNRLSSHLVCIATGGMELG-ATTIMIYGFRDR
NUOD_NOCSJ       YVLGIERLLDIEDRVPEKAQVMRVLLMELNRISSHLVAIATGGMELG-ALTVMTIGFRER
NUOD_THEFY       YCLAVEKLLGITDQVPERANVIRVMMMELNRISSHFVAMATFGMELG-ATTVMTNGFRER
NUOD_FRAAA       YCLSVEKLLGITDDIPERATVIRVLVMELQRIASHLVWLATGGMELG-ATTAMIFGFRER
NUOD_FRACC       YCLSVERLLGITEQVPERATVIRVMVMELQRIASHLVWLATGGMELG-ATTAMIFGFRER
NUOD_FRASN       YCLSVEKLLGITGEVPERATVIRVLVMELQRIASHLVWLATGGMELG-ATTGMIFGFRER
NUOD1_SALAI      YALAVEKLLGIEEQITERATTIRVLMMELNRISSHLVWVATTAMELG-AINMMLYGFRER
NUOD1_SALTO      YALAVEKLLGIEEQITERATTIRVLMMELNRISSHLVWVATTAMELG-AINMMLYGFRER
NUOD_ACIC1       YCLAVEKLLGITDQIPERANVIRVMMMELNRIASHLVWLATGGMEIG-ALSAMLYGFRER
NUOD_SACEN       YCMAVEKLLGV--EAPPRAQTFRVMLMELSRIASHLVFLATGAMEMG-ATTGMTFGFRER
NUOD_CUTAK       YCLAVEKLLGITDDVPERARVLRVMITELNRISSHLIAVGTGGLELG-ASSVAEVGLRER
NUOD1_SYMTH      YVMAVEKLLGIEDRIPEKARVTRVILLELNRVASHLVGLGTGGLDYGNIGTPIFWAFELR
NUOD_THEM4       YALAVEKIAKID--VPERAQWIRMIVLELARIANHLWSFSGIGGPIG-LYTGSFWGTADR
NUOD_PARUW       FAGALERLMNI--EVPERAQTIRIILLELSRIASHLLWAGTSALELN-MSSVFMYSFAER
NUOD_FLAJ1       WWMTLEKLLG--IEVPKRAQYLRVIVMELARITDHIICNSILGVDTGA-YTGFLYVFQFR
NUOD_FLAPJ       WWMTLEKLLD--IEVPKRAQYLRVIVMELARITDHIICNSILGVDTGA-YTGFLYVFQFR
NUOD2_CYTH3      WHMTVEKLAG--IELPKRVEYMRVVIMELSRIADHLICNSILGVDAGA-FTGFLYIMQSR
NUOD_LEPBA       WILTVEKMMQ--IQVPDRVTYVRMIISELSRIMDHIICNGIMGVDLGA-FSGLLHLFHHR
NUOD_LEPBP       WILTVEKMMQ--IQVPDRVTYVRMIISELSRIMDHIICNGIMGVDLGA-FSGLLHLFHHR
NUOD_LEPBJ       WILAVEKMMQ--VEVPDRVTYVRMIISELSRIMDHIICLGILGVDLGA-FSGMLHLFHHR
NUOD_LEPBL       WILAVEKMMQ--VEVPDRVTYVRMIISELSRIMDHIICLGILGVDLGA-FSGMLHLFHHR
NUOD_LEPIN       WILAVEKMMQ--IEVPDRVTYVRMIISELSRIIDHIICTGILGVDLGA-FSGMLHLFHHR
NUOD_LEPIC       WILAVEKMMQ--IEVPDRVTYVRMIISELSRIIDHIICTGILGVDLGA-FSGMLHLFHHR
NUOD1_SORC5      FALAVEKMLG--VTVPERCQYYRVILGELARICDHMICSGAMSMELGA-FTPFLYLCRAR
NUOD_METI4       YACAVEKLLG--WEIPARAQVIRVICSEMARISSHLMGLGAYAMDCGA-VSVFLYTFTER
                      *         . :    *    *. *.  *                        :

NUOD1_RHIME      EKLMVFYERACGARMHAA-YFRPGGVHQDLPH--------------------------QL
NUOD1_SINMW      EKLMVFYERACGARMHAA-YFRPGGVHQDLPH--------------------------QL
NUOD1_RHIEC      EKLMVFYERASGSRMHAA-YFRPGGVHQDLPE--------------------------KL
NUOD1_RHIE6      EKLMVFYERASGSRMHAA-YIRPGGVHQDLPE--------------------------KL
NUOD_RHIL3       EKLMVFYERASGSRMHAA-YFRPGGVHQDLPE--------------------------QL
NUOD_AGRFC       EKLMVFYERACGARMHSA-YVRPGGVHQDLPP--------------------------EL
NUOD_BRUAB       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUA2       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUA1       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUC2       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUSI       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUO2       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUSU       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_BRUME       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_OCHA4       EKLMVFYERACGARMHAA-YFRPGGVHQDLPD--------------------------QL
NUOD_CHESB       EKLMVFYERASGARMHAA-YFRPGGVHQDLPE--------------------------KL
NUOD_RHILO       EKLMVFYERASGSRMHAA-YFRPGGVHQDLPR--------------------------QL
NUOD_AZOC5       EKLMMFYERASGSRMHAA-YFRPGGVHQDLPQ--------------------------KL
NUOD_XANP2       EKLMIFYERASGSRMHAA-YFRPGGVHQDLPR--------------------------AL
NUOD_BRASB       EKLMVFYERASGSRMHAN-YFRIGGVHQDLPP--------------------------KL
NUOD_BRASO       EKLMVFYERASGSRMHAN-YFRIGGVHQDLPP--------------------------KL
NUOD_BRADU       EKLMVFYERASGSRMHAA-FFRVGGVHQDLPQ--------------------------KL
NUOD2_NITHX      EKLMMFYERASGSRMHAA-YFRIGGVHQDLPP--------------------------KL
NUOD_NITWN       EKLMMFYERASGSRMHAA-YFRIGGVHQDLPP--------------------------RL
NUOD_RHOP5       EKLMVFYERASGSRMHAA-YFRIGGVHQDLPP--------------------------QL
NUOD_RHOPB       EKLMMFYERASGSRMHAA-YFRVGGVHQDLPP--------------------------KL
NUOD_RHOPS       EKLMMFYERASGSRMHAA-YFRVGGVHQDLPP--------------------------QL
NUOD_RHOP2       EKLMMFYERASGSRMHAA-YFRIGGVHQDLPP--------------------------KL
NUOD_RHOPA       EKLMMFYERASGSRMHAA-YFRVGGVHQDLPP--------------------------KL
NUOD_RHOPT       EKLMMFYERASGSRMHAA-YFRVGGVHQDLPP--------------------------KL
NUOD_METEP       EKLMIFYERASGARLHAN-YFRPGGVHQDLPP--------------------------AL
NUOD_METPB       EKLMIFYERASGARLHAN-YFRPGGVHQDLPP--------------------------AL
NUOD_METRJ       EKLMIFYERASGARLHAN-YFRPGGVHQDLPP--------------------------KL
NUOD_METS4       EKLMIFYERASGARLHAN-YFRPGGVHQDLPP--------------------------GL
NUOD1_BEII9      EKLMVFYERASGARMHAN-YFRPGGVHIDCPQ--------------------------QL
NUOD2_BEII9      EKLMVFYERASGARMHAN-YFRVGGVHQDLPE--------------------------KL
NUOD1_NITHX      EKLMVFYERASGARMHAN-YFRVGGVHQDLPS--------------------------KL
NUOD_PARL1       EKLMIFYERASGARLHAN-YFRTGGVHRDLPP--------------------------KL
NUOD_BARBK       EKLMIFYERACGARLHAN-YFRPGGVHQDLPE--------------------------VL
NUOD_BARHE       ERLMIFYERACGARLHAN-YFRPGGVHQDLPE--------------------------SL
NUOD_BART1       ERLMIFYERACGARLHAN-YFRPGGVHQDLPE--------------------------SL
NUOD_BARQU       ERLMIFYERACGARLHAN-YFRPGGVHQDLPE--------------------------SL
NUOD_CAUVC       EKLMVFYERACGARLHSN-YFRPGGVHQDLPP--------------------------EL
NUOD_CAUSK       EKLMVFYERACGARLHAN-YFRPGGVHQDLTP--------------------------SL
NUOD_PHEZH       EKLMIFYERASGARLHAN-YYRVGGVRQDLPP--------------------------EL
NUOD_MARMM       EKLMVFYERASGSRMHAH-YFRPGGVHQDLPM--------------------------KL
NUOD_RUEPO       EKLMVFYERACGARLHAA-YFRPGGVHQDLPD--------------------------AL
NUOD_RUEST       EKLMIFYERACGARLHAA-YFRPGGVHQDLPD--------------------------EL
NUOD_ROSDO       EKLMVFYERASGARLHAA-YFRPGGVHQDLPP--------------------------AL
NUOD_DINSH       EKLMVFYERACGARLHAA-YFRPGGVHQDLPP--------------------------DL
NUOD_RHOS4       EKLMVFYERASGARLHAA-YFRPGGVHQDLTP--------------------------RL
NUOD_RHOS1       EKLMVFYERASGARLHAA-YFRPGGVHQDLTP--------------------------RL
NUOD_RHOS5       EKLMVFYERASGARLHAA-YFRPGGVHQDLTP--------------------------RL
NUOD_JANSC       EKLMIFYERASGARLHAA-YFRPGGVHQDLPP--------------------------EL
NUOD_PARDP       EELMIFYERACGARLHAA-YFRPGGVHQDLPP--------------------------DL
NUOD_HYPNA       EKLCVFYERASGSRMHAA-YFRPGGVHQDLPQ--------------------------RL
NUOD_PELUB       ETLMTFYERASGSRLHAN-YFRAGGVHQDLPM--------------------------GL
NUOD_RICBR       EKIMEFYERVSGSRMHSN-YFRPGGVAEDLPD--------------------------GL
NUOD_RICB8       EKIMEFYERVSGSRMHSN-YFRPGGVAEDLPD--------------------------GL
NUOD_RICCN       EKIMEFYEHVSGSRMHSN-YFRPGGVAADLPE--------------------------GL
NUOD_RICM5       EKIMEFYEHVSGSRMHSN-YFRPGGVAADLPE--------------------------GL
NUOD_RICRO       EKIMEFYEHVSGSRMHSN-YFRPGGVVADLPE--------------------------GL
NUOD_RICRS       EKIMEFYEHVSGSRMHSN-YFRPGGVVADLPE--------------------------GL
NUOD_RICFE       EKIMEFYERVSGSRMHSN-YFRPGGVAEDLPD--------------------------GL
NUOD_RICAH       EKIMEFYERVSGSRMHSN-YFRPGGVAEDLPD--------------------------GL
NUOD_RICCK       EKIMEFYERVSGSRMHSN-YFRPGGVAEDLPD--------------------------GL
NUOD_RICPR       EKIMEFYERVSGSRMHSN-YFRPGGVAEDLPE--------------------------NL
NUOD_RICTY       EKIMEFYERVSGSRMHAN-YFRPGGVAEDLPE--------------------------KL
NUOD_ORITB       EKIMEFYERVSGSRLHAN-YFRPGGVAQDLPE--------------------------GL
NUOD_ORITI       EKIMEFYERVSGSRLHAN-YFRPGGVSQDLPE--------------------------GL
NUOD_ANAMM       ERLLSFYERASGARFHAA-YIRPGGIAADVPD--------------------------GL
NUOD_ANAPZ       EKILSFYERASGARFHSA-YIRPGGLAADVPD--------------------------GL
NUOD_EHRCJ       EKILGFYERASGARFHSA-YIRPGGVAADVPS--------------------------DL
NUOD_EHRCR       EKILGFYERASGARFHSA-YIRPGGVAADVPD--------------------------DL
NUOD_EHRRG       EKILNFYERASGARFHSA-YIRPGGVAADIPE--------------------------DL
NUOD_EHRRW       EKILNFYERASGARFHSA-YIRPGGVAADIPE--------------------------DL
NUOD_WOLPP       EKILEFYERASGARFHAA-YIRPGGLAADIPE--------------------------GL
NUOD_WOLPM       EKILEFYERASGARFHAA-YIRPGGIAADVPE--------------------------DL
NUOD_WOLTR       EKILEFYERASGARFHAA-YIRPGGVAADVPE--------------------------GL
NUOD_NEOSM       EKMLSFYEKASGARFHAA-YIRPGGLAADIPD--------------------------GL
NUOD_MAGSA       EKLMEFYERVCGARLHAN-YYRPGGVAADLPA--------------------------GL
NUOD_RHORT       EHLLEFSERASGARMHAA-WFRPGGVARDVPP--------------------------DL
NUOD_GLUDA       EKLIEFYEAASGARFHAN-YFRPGGVSRDLPA--------------------------GL
NUOD_GRABC       EKLLEFHEAVSGARFHAN-YFRPGGVAKDLPA--------------------------GL
NUOD_ACICJ       EKLLTFHEAVSGARFHAN-YFRPGGVSKDMPT--------------------------GL
NUOD_ERYLH       EDCMNFFERASGARMHMA-WFRPGGVHQDVPE--------------------------KL
NUOD_NOVAD       EDCLNFFERASGARMHSA-WFRPGGVHQDVPL--------------------------KL
NUOD_SPHAL       EDCLNFFERASGARMHSA-YFRPGGVHQDVPE--------------------------KL
NUOD_SPHWW       EDCLNFFERASGARMHAA-WFRPGGVHQDVPL--------------------------KL
NUOD_ACIAC       EDLFDMYEAVSGARMHAA-YFRPGGVYRDLPDSMPQYQA-SKVRNAKAIEVLNQNRQGSL
NUOD_ACISJ       EDLFDMYEAVSGARMHAA-YFRPGGVYRDLPDSMAQYKV-SKIKNAKAIEELNRNRQGSL
NUOD_DELAS       EDLMDMYEAVSGARMHAA-YFRPGGVYRDLPDTMPQYKA-SKVRNARSVEIMNRNRHGSL
NUOD_LEPCP       EDLFDMYEAVSGARMHAA-YFRPGGVYRDLPDVMPQYKV-SKIRNAKAMARLNENRQGSL
NUOD_METPP       EDLFDMYEAVSGARMHAA-YFRPGGVYRDLPDTMPQYRV-SKIRNAKALAKMNENRQGSL
NUOD_CHRVO       EDLMDCYEAVSGARMHAA-YFRPGGVYRDLPDSMPQYTV-SKIKNAKELARLNEGRKGSM
NUOD_RHOFT       EDLLDMYEAVSGARMHAA-YFRPGGVYRDLPDTMARHQP-NKIRSAKSTEKLNRNRDGSL
NUOD_AZOSB       EDLMDAYEAVSGARMHAA-YYRPGGVYRDLPDRMPQYQP-NKFKNANVVKDLNAARQGSL
NUOD_AROAE       EDLMDAYEAVSGARMHAA-YYRPGGVYRDLPDRMPQYVV-NKFKNANTVRELNENRQGSL
NUOD_METFK       EDLFDCYEAVSGARMHAA-YYRPGGVYRDLPDRMPQYEE-STVRSKEDVKQLNENRQGSL
NUOD_BORA1       EDLMDCYEAVSGARMHAA-YYRPGGVYRDLPDTMAQYGETSKYRSDKELRAMNDARSGSL
NUOD_BORPE       EDLMDCYEAVSGARMHAA-YYRPGGVYRDLPDTMPQYGDSSKYRGEKEVRAMNDARSGSL
NUOD_HYDCU       EDLMDCYEAVSGARMHAT-YYRPGGVYRDLPDTMAKYEE-SKWHSGKKLDQLNETREGSL
NUOD_ACIF5       EDLMDVYEAVSGARMHAA-YYRPGGVYRDLPAQMPQYQP-SPYRDARRLQELNANRQGSM
NUOD_NEIG1       EELMDLYEAVSGARMHAA-YFRPGGVYRDLPGFMPKYES-SKFRNAKVLKQLNESREGTM
NUOD_NEIG2       EELMDLYEAVSGARMHAA-YFRPGGVYRDLPGFMPKYES-SKFRNAKVLKQLNESREGTM
NUOD_NEIMA       EELMDLYEAVSGARMHAA-YFRPGGVYRDLPDFMPKYES-SKFRNAKVLKQLNESREGTM
NUOD_NEIMB       EELMDLYEAVSGARMHAA-YFRPGGVYRDLPDFMPKYEG-SKFRNAKVLKQLNESREGTM
NUOD_NEIM0       EELMDLYEAVSGARMHAA-YFRPGGVYRDLPDFMPKYES-SKFRNAKVLKQLNESREGTM
NUOD_NEIMF       EELMDLYEAVSGARMHAA-YFRPGGVYRDLPDFMPKYES-SKFRNAKVLKQLNESREGTM
NUOD_XANOR       EELMDVYEAVSGARMHAA-YYRPGGVYRDLPDRMPRYKE-SRWHKGGALKKLNAAREGSM
NUOD_XANOM       EELMDVYEAVSGARMHAA-YYRPGGVYRDLPDRMPRYKE-SRWHKGGALKKLNAAREGSM
NUOD_XANOP       EELMDVYEAVSGARMHAA-YYRPGGVYRDLPDRMPRYKE-SRWHKGGALKKLNAAREGSM
NUOD1_STRM5      EELMDCYEAVSGARMHAT-YYRPGGVYRELPEQMPKYKE-SRWKTGKQLRRLNAAREGSL
NUOD_MAGMM       EELMDIYEAACGARMHAN-YFRPGGVARDLPDGLEQRIR---------------------
NUOD2_RHIME      EMIMDLLEMITGARMHTS-YCRVGGVREDLPD--------------------------GF
NUOD2_SINMW      EMIMDLLEMITGARMHTS-YCRVGGVREDLPD--------------------------GF
NUOD2_RHIEC      EMIMDLLEMITGARMHTS-FCRVGGVREDLPD--------------------------GF
NUOD2_RHIE6      EMIMDLLEMITGARMHTS-FCRVGGVREDLPD--------------------------GF
NDHH_CAPBU       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_NASOF       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_BARVE       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_ARATH       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_DRANE       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_ARAHI       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_OLIPU       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_LEPVR       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_CRUWA       EFIYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_LOBMA       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_AETCO       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_AETGR       EFVYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_SOYBN       ELIYDLFEAATGMRMMHN-FFRIGGVATDLPY-------------------------GWV
NDHH_PHAVU       EFIYDLFEAATGMRMMHN-FFRIGGVATDLPY-------------------------GWV
NDHH_LOTJA       EFIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_CICAR       ELIYDLFEAATGMRMMHN-FFRIGGVSADLPY-------------------------GWI
NDHH_CUCSA       ELVYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_MORIN       ELVYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_OENEH       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_OENBI       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_OENGL       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_OENAR       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_OENPA       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_EUCGG       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_GOSBA       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWL
NDHH_GOSHI       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWL
NDHH_CITSI       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_CARPA       ELVYDLFEAATGMRMMHN-YFRIGGIAADLPH-------------------------GWI
NDHH_IPOPU       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_PELHO       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_POPAL       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWL
NDHH_POPTR       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWL
NDHH_MANES       ELVYDLFEAATGMRMMHN-FFRIGGVASDLPH-------------------------GWI
NDHH_SOLLC       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_SOLBU       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPY-------------------------GWI
NDHH_SOLTU       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_TOBAC       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_NICSY       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_ATRBE       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_NICTO       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPY-------------------------GWI
NDHH_COFAR       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_JASNU       EFIYDLFEAATGMRMMHN-FFRIGGIAADLPH-------------------------GWI
NDHH_SPIOL       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_VITVI       ELVYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_DAUCA       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_PANGI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_FAGEA       ELIYDLFEAATGMRMMHN-FFRIGGIAADLPY-------------------------GWI
NDHH_GUIAB       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_HELAN       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_LACSA       ELIYDLFEAATGMRMMHN-FFRIGGIAADLPH-------------------------GWI
NDHH_PLAOC       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_NANDO       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_RANMC       ELIYDLFESATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_BUXMI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_AMBTC       ELLYDLFETATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_DIOEL       ELLYDLFEASTGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_ILLOL       ELLYDLFEAVTGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_CHLSC       ELLYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWV
NDHH_CALFG       ELLYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_DRIGR       ELLYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_CERDE       ELIYDLFEAATGMRMMHN-FFRIGGVAADLPH-------------------------GWI
NDHH_LIRTU       ELLYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_NUPAD       ELLYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_NYMAL       ELLYDLFEAATGMRMMHN-YFRIGGVAADLPH-------------------------GWI
NDHH_PIPCE       ELLYDLFEAATGMRMMHN-YFRIGGVATDLPY-------------------------GWI
NDHH_ACOAM       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_ACOCL       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_HORVU       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_WHEAT       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_BRADI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_ORYNI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_ORYSA       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_ORYSI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_ORYSJ       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_LOLPR       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_AGRST       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_SACHY       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWM
NDHH_SACOF       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWM
NDHH_SORBI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWM
NDHH_MAIZE       ELIYDLFEAVTGMRMMHN-YFRIGGVAADLPY-------------------------GWM
NDHH_LEMMI       ELIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_CRYJA       EMIYDLFEAATGMRMMHN-YFRIGGVAVDLPY-------------------------GWI
NDHH_CYCTA       EIIYDLFEAATGMRMMHN-YFRIGGVAVDLPY-------------------------GWI
NDHH_ANTAG       EMIYDLFEAATGMRMMHN-FFRIGGVAVDLPY-------------------------GWV
NDHH_ANGEV       EMIYDLFEAATGMRMMHN-YFRIGGVAVDFPY-------------------------GWV
NDHH_MARPO       EMIYDLFESATGMRMMHN-YFRIGGVAVDLPY-------------------------GWI
NDHH_PHYPA       EMIYDLFEAATGMRMMHN-YFRIGGVAVDLPY-------------------------GWI
NDHH_HUPLU       ETIYDLFEAATGMRMMHN-YFRIGGVAVDSPY-------------------------GWV
NDHH_ADICA       EMIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWI
NDHH_PSINU       EMIYDLFEAATGMRMMHN-YFRIGGVAVDLPY-------------------------GWI
NDHH_CHAGL       EMVYDLFESATGMRMMHN-YFRIGGVAVDLPY-------------------------GWL
NDHH_CHAVU       EMIYDLFESATGMRMMHN-YFRIGGVAVDLPY-------------------------GWI
NDHH_STAPU       EMIYDLFESATGMRMMHN-YFRIGGVAVDLPY-------------------------GWV
NDHH_ZYGCR       EMIYDLFEAATGMRMMHN-YFRIGGVAVDLPY-------------------------GWV
NDHH_MESVI       EMIYDLFEAATGMRMMHN-YFRIGGVASDLPY-------------------------GWV
NDHH_CHLAT       EMIYDLFEAATGMRMMHN-YFRIGGVAADLPY-------------------------GWV
NDHH_NEPOL       EMIYDLFEAATGMRMMHN-YFRVGGVAADVPY-------------------------GWI
NDHH1_GLOVI      EMIYDLFEAATGMRMMHN-YFRVGGVAVDLPY-------------------------GWV
NDHH_NOSS1       EMIYDLWEAATGYRMVNNNYFRVGGVAADLPY-------------------------GWV
NDHH_THEEB       EYIYDLFEAATGMRFINNNYFRIGGVAADLTY-------------------------GWV
NDHH_SYNY3       EMIYDLWEAASGMRLINNNYFRVGGVAVDLPY-------------------------GWN
NUOD_AMOA5       EYILRLFEWASGARMLYN-YIWIGGLYYDLPV-------------------------GFE
NUOD1_CYTH3      EHINRLLEWVSGARMLYN-YIWVGGLFYDLPV-------------------------GFE
NUOD_CHLP8       EHIMNLLEWISGARMLYN-YIWIGGLAYDVPA-------------------------DFK
NUOD_CHLTE       EHIMSLLEWISGARMLYN-YIWIGGLAYDVPA-------------------------DFK
NUOD_CHLL2       EHILNLLEWASGARMLYN-YIWIGGVAFDIPA-------------------------DFN
NUOD_CHLPD       EHILSLLEWASGARMLYN-YIWIGGLAYDVPA-------------------------DFN
NUOD_PELLD       EHILNMLEWASGARMLYN-YIWIGGLAYDVPA-------------------------DFQ
NUOD_CHLPM       EHILNMLEWATGARMLYN-YIWVGGLAYDVPA-------------------------GFN
NUOD_PELPB       EIILGLLEWASGARMLYN-YIWIGGLAYDVPS-------------------------DFF
NUOD_CHLCH       EIILGLLEWASGARMLYN-YVWVGGLAYDVPA-------------------------DFL
NUOD_CHLPB       EHMLNLLEWTSGARMLYN-YILIGGVAYDFPK-------------------------DFA
NUOD_PROA2       EHIMSLLEWASGARMLYN-YIWIGGASFDFPP-------------------------GFK
NUOD2_CHLT3      EHLLNLLEWICGARMLYN-YIWVGGVSHDFPA-------------------------KFE
NUOD2_ANADE      ETINDLLEALCGARLTYN-YHRIGGVAFDLPE-------------------------GWR
NUOD1_ANASK      ETINDLLEALCGARLTYN-YHRIGGVAFDLPE-------------------------GWR
NUOD1_ANADF      EEINDYIEALCGARLTYN-YHRIGGVAFDLPE-------------------------GWR
NUOD2_SORC5      EYINDFIEELCGARLTFN-YHRIGGVSFDMPK-------------------------GWA
NUOD_BACAN       EMIINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACCR       EMIINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACAH       EMIINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACCZ       EMIINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACHK       EMIINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACC1       EMIINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACMK       EMIINLLSELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_BACCN       EMVINLLNELCGARLTFN-YMRVGGVKWDAPD-------------------------GWI
NUOD_GEOKA       EMIINLLNELSGARLTFN-YMRIGGVKWDAPD-------------------------GWI
NUOD_GEOTN       EMIINLLNELSGARLTFN-YMRIGGVKWDAPD-------------------------GWI
NUOD_DESPS       EQILDLLESITGSRLTYC-YYRFGGLYNDIDD-------------------------EFL
NUOD2_OPITP      EKILDLLEGLCGARLTYC-YYRFGGLYNDADD-------------------------DFL
NUOD_SYNFM       ERILDILDWVTGSRLTYS-YCRFGGVDRDIDT-------------------------RFT
NUOD2_SALAI      ETLQAVLEEVSGGRIHYM-FNRVGGLKEEVPA-------------------------GWT
NUOD2_SALTO      ETLQTALEEVSGGRIHYM-FNRVGGLKEEVPA-------------------------GWT
NUOD2_STRAW      EELQHVMEEISGGRMHYM-FNRVGGLKEDLPA-------------------------GWA
NUOD1_STRCO      EVLQNVMEEVSGGRMHYM-FNRVGGLKEDLPA-------------------------GWT
NUOD2_STRGG      EELQAVMEEVSGGRMHYM-FNRVGGLKEDVPA-------------------------GWA
NUOD_RUBXD       ERIQNFFEAVTGARMMFH-YIRIGGVKADLPP-------------------------DIP
NUOD_DESHY       ERILDLFEMMSGSRLTVN-CMRIGGVSAEPPA-------------------------EFW
NUOD_HELMI       EHILELFNRACGARMTFN-YIRPGGVAQDLPD-------------------------GWV
NUOD_CARHZ       ELVLELLEMLTGSRMTFS-FMRIGGVADDLPE-------------------------GFI
NUOD2_SYMTH      EKLYSLFERITGGRMLYN-YLRIGGVRNDLPE-------------------------GIL
NUOD_CAMJE       EYVLDLIEKYCGARLTHS-SMRIGGVMLDLPE-------------------------NYL
NUOD2_ROSCS      EKILDLFEMASGARMMCN-YFRFGGVWRDLPP-------------------------EFI
NUOD1_ROSS1      EKILDLFEMASGARMMCN-YFRFGGVWRDLPP-------------------------EFI
NUOD2_HERA2      EKILDMFEYVSGARMMCN-YCRFGGVVRDIDD-------------------------WFI
NQO4_THET8       ETILDLFEWVTGQRFHHN-YIRIGGVKEDLPE-------------------------EFV
NUOD_THET2       ETILDLFEWVTGQRFHHN-YIRIGGVKEDLPE-------------------------EFV
NUOD_DEIRA       EACQDLFEAVCGYRMNQG-YFRVGGLARDLPE-------------------------GWT
NUOD_DEIGD       EAVQDLFEAVCGYRMNQG-YFRVGGLARDIPE-------------------------DWP
NUOD2_KORVE      EELLKLFEAVAGQRMMTS-YFRVGGVSLEPPL-------------------------GWF
NUOD1_SOLUE      EEILKIFELFSGQRMMTS-YFRIGGLALEPPR-------------------------GWQ
NUOD1_ROSCS      EQILDIFELVSGARMMTS-YFRVGGLAYDLPI-------------------------EFD
NUOD2_ROSS1      EQILDIFELVSGARMMTS-YFRVGGLAYDLPA-------------------------GFD
NUOD2_CHLAA      EQILDIFELVSGARMMTS-YFRIGGLAYDLPS-------------------------DFI
NUOD1_HERA2      EYILDIFEMLTGARMMTS-YFRVGGLAWDIPA-------------------------DFI
NUOD_GEOMG       EMVMSLYEKISGARMTSS-YFRVGGLSSDVYD-------------------------GFE
NUOD_GEOSL       EMIMSLYEKISGARMTSN-YFRVGGLSSDVYD-------------------------GFE
NUOD_GEOBB       EKIMELYEMVSGARMTSN-YFRVGGLSRDLPA-------------------------GFE
NUOD_GEOUR       ENIMDIYEMVSGARMTSN-FFRVGGLSKDIPE-------------------------GFT
NUOD_GEOLS       EVIMETYELISGARMTSN-FFRAGGLSQDVPA-------------------------EFE
NUOD_MYCBP       EIVLTLFEKITGLRMNSA-YIRPGGVAQDLPP-------------------------NAA
NUOD_MYCTA       EIVLTLFEKITGLRMNSA-YIRPGGVAQDLPP-------------------------NAA
NUOD_MYCTU       EIVLTLFEKITGLRMNSA-YIRPGGVAQDLPP-------------------------NAA
NUOD_MYCBO       EIVLTLFEKITGLRMNSA-YIRPGGVAQDLPP-------------------------NAA
NUOD_MYCMM       EIILSLFESITGLRMNSA-YIRPGGVAQDLPP-------------------------DGP
NUOD_MYCUA       EIILSLFESITGLRMNSA-YIRPGGVAQDLPP-------------------------DRP
NUOD_MYCA1       EIVLTLFESITGLRMNSA-YIRPGGVAQDLPP-------------------------NAK
NUOD_MYCPA       EIVLTLFESITGLRMNSA-YIRPGGVAQDLPP-------------------------NAK
NUOD_MYCGI       ELILSVFETITGLRMNSA-YIRPGGVAADLPE-------------------------EGL
NUOD_MYCVP       ELILSVFETITGLRMNNA-YIRPGGVAADLPD-------------------------EAL
NUOD_MYCSJ       EEILSVFEMITGLRMNHA-YIRPGGLAADLPD-------------------------GAV
NUOD_MYCSK       EEILSVFEMITGLRMNHA-YIRPGGLAADLPD-------------------------GAV
NUOD_MYCSS       EEILSVFEMITGLRMNHA-YIRPGGLAADLPD-------------------------GAV
NUOD_MYCS2       EEILRVFESITGLRMNHA-YIRPGGLAADLPD-------------------------DAI
NUOD_MYCA9       EMILKVFEAITGLRMNHA-YVRPGGLAQDLPD-------------------------GAE
NUOD_NOCFA       ELILDVFETITGLRMNHA-YIRPGGLAQDLPD-------------------------DGV
NUOD_RHOJR       ELVLDVFEMITGLRMNHA-YIRPGGLSQDLPE-------------------------GAV
NUOD1_STRAW      ELILDIYELITGLRMNHA-YIRPGGLAQDLPP-------------------------GAV
NUOD2_STRCO      ELILDIYELITGLRMNHA-YIRPGGLAQDLPP-------------------------GAV
NUOD1_STRGG      ELVLDLFELFTGLRMNHA-FVRPGGLAQDLPP-------------------------GAV
NUOD_NOCSJ       ELVLDLFELITGLRMNHA-FIRPGGVAQDMPP-------------------------GAL
NUOD_THEFY       EMVLDIFEMVTGLRMNHA-YIRPGGVAQDLPP-------------------------GTV
NUOD_FRAAA       EKVLDLLELITGLRMNHA-FIRPGGLAQDLPD-------------------------GTE
NUOD_FRACC       EKVLDLLELITGLRMNHA-YIRPGGLAQDLPD-------------------------GAE
NUOD_FRASN       EKILDLLETITGLRMNHA-YIRPGGLAQDIPD-------------------------EVI
NUOD1_SALAI      EYILEIFELITGLRMNHA-YVRPGGVAQDVPD-------------------------EAI
NUOD1_SALTO      EYVLEIFELITGLRMNHA-YVRPGGVAQDVPD-------------------------EAI
NUOD_ACIC1       EMILDIFEMITGLRMNHA-YIRPGGVIQDLPP-------------------------GAV
NUOD_SACEN       EEVLHLLEYLTGLRMNHA-FVRPGGVAQDLPE-------------------------DYR
NUOD_CUTAK       EIILEFNQAVTGLRMNNA-WIRPGGVATDLPE-------------------------TGL
NUOD1_SYMTH      DRILDIFEHTTGQRMNPS-YMRVGGLAYDLPH-------------------------NFK
NUOD_THEM4       DRILDIFENLTGARVYHM-YIVPGGVRKDLTP-------------------------KIE
NUOD_PARUW       EKILDLFEQVSGARMFPS-LWRIGGLAKDLNS-------------------------DFI
NUOD_FLAJ1       EKIYEIYEEICGARLTTN-MGRIGGFERDWSP-------------------------EAF
NUOD_FLAPJ       EKIYEIYEEICGARLTTN-MGRIGGFERDWSP-------------------------KAF
NUOD2_CYTH3      EQIYEIFEEICGARLTTN-MGRIGGFERDFND-------------------------IAM
NUOD_LEPBA       ENIYQILEKLTGARLTTT-FCRVGGMERDIYP-------------------------EFQ
NUOD_LEPBP       ENIYQILEKLTGARLTTT-FCRVGGMERDIYP-------------------------EFQ
NUOD_LEPBJ       ENIYQIIEKLTGARLTTT-FCRIGGLERDIYP-------------------------EFE
NUOD_LEPBL       ENIYQIIEKLTGARLTTT-FCRIGGLERDIYP-------------------------EFE
NUOD_LEPIN       ENIYQIIEKLTGARLTTT-FCRIGGLEKDIYP-------------------------DFV
NUOD_LEPIC       ENIYQIIEKLTGARLTTT-FCRIGGLEKDIYP-------------------------DFV
NUOD1_SORC5      EIFWEIFEEETGARLTHS-FGRVGGMARPPTA-------------------------DFK
NUOD_METI4       EKIYLLIEELTGARFTTS-YTRIGGLTRDLPP-------------------------GWT
                 :      .   * *.        **                                   

NUOD1_RHIME      VEDIG----------NWIDP-FLKTVDDIDELLTGNRIFKQRNVDIGVVSLEDAWAWGFS
NUOD1_SINMW      VEDIG----------KWIDP-FLKTVDDIDELLTGNRIFKQRNVDIGVVSLEDAWAWGFS
NUOD1_RHIEC      VQDIG----------DWCDP-FLKALDDIDDLLTGNRIFKQRNVDIGVVSLEDCWAWGFS
NUOD1_RHIE6      VQDIG----------DWCDP-FLKALDDIDNLLTGNRIFKQRNVDIGVVSLEDCWAWGFS
NUOD_RHIL3       VQDIG----------AWCDP-FLKALDDIDNLLTGNRIFKQRNVDIGVVSLDECWAWGFS
NUOD_AGRFC       VDDIG----------KWCDP-FLTVLDNIEGLLTDNRIYKQRNVDIGVVSLEDAFAWGFT
NUOD_BRUAB       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUA2       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUA1       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUC2       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUSI       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUO2       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUSU       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_BRUME       IEDIG----------KWIDP-FFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_OCHA4       VEDIG----------KWIDP-FFNTLNNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFS
NUOD_CHESB       VEDIG----------KWIDP-FLKTVDDLDELLTENRIFKQRNADIGIVSLEDAWAWGFS
NUOD_RHILO       VEDIG----------KWIDP-FLKSIDDLDRLLTGNRIFKQRNVDIGIVSLADAWAWGFS
NUOD_AZOC5       VEDIG----------EFCRT-FPSLLDDLDALVTGNRIFKQRTVDIGVVTLEDALAWGFS
NUOD_XANP2       VEDIG----------AFCDP-FLKLLDDLDGLVTENRIFKQRTVDIGVVSLEDALAWGFS
NUOD_BRASB       IDDID----------AFCDP-FLKVVDDLDQLLTGNRIFKQRNVDIGVVTLKQAWEWGFS
NUOD_BRASO       VDDID----------AFCDP-FLKVVDDLDQLLTGNRIFKQRNVDIGVVTLKQAWEWGFS
NUOD_BRADU       VDDIE----------AWCDP-FLKVVDDLDRLLTANRIFKQRNVDIGVVPLKEAWEWGFS
NUOD2_NITHX      IDDID----------AWCDP-FLQVVADLDALLTDSRIFKQRNVDIGVVSLKQAWEWGFS
NUOD_NITWN       IDDIE----------AWCDP-FLQVVADLDRLLTANRIFKQRNVDIGVVTLEQAWEWGFS
NUOD_RHOP5       IEDIE----------TWCDA-FPQVVDDLDRLLTGNRIFKQRNVDIGVVTLPQAWEWGFS
NUOD_RHOPB       VDDIE----------AWCVA-FPQVIDDLDRLLTGNRIFKQRNVDIGVVTLAQAWEWGFS
NUOD_RHOPS       VADID----------SWCDS-FIQVVDDLETLLTDNRIFKQRNVDIGVVTLEQAWEWGFS
NUOD_RHOP2       IDDID----------NWCDN-FIQTVDDLETLLTDNRIFKQRNVDIGVVTLEQAWEWGFS
NUOD_RHOPA       VDDID----------AWCDA-FPAVVNDLDRLLSDNRIFKQRNVDIGVVTLDQAWSWGFS
NUOD_RHOPT       VDDID----------AWCDA-FPAVVNDLDRLLSDNRIFKQRNVDIGVVTLDQAWSWGFS
NUOD_METEP       IDDIE----------AFCDP-FLKVVDDLDNLVMANRIFKQRNVDIGIVSVDEAMAWGFS
NUOD_METPB       IDDIE----------AFCDP-FLKVVDDLDNLVMANRIFKQRNVDIGIVSVDEAMAWGFS
NUOD_METRJ       IDDID----------AFCDP-FLQVVQDLDDLVMANRIFKQRNVDIGIVSVDEAMQWGFS
NUOD_METS4       IDDIE----------AFCDP-FLQVVDDLDALVIGNRIFKQRNVDIGIVTVDAAMAWGFS
NUOD1_BEII9      IDDIG----------AWCDP-FLKVCDDLNDLFIENRIFKQRNVDIGVISLEDCWRWGFS
NUOD2_BEII9      LDDIW----------NFCEP-FLKVCNDLEELLSYNRIFKQRNVDVGVISLDEAWTRGFS
NUOD1_NITHX      LDDIW----------DFCDP-FLKVCDDLEGLLTENRIFKQRNVGIAEVKLADAWGWGFS
NUOD_PARL1       LEDIY----------NFCDP-CSQVLDDLEGLITDNRIFKQRNVDIGVVSQEEALEWGFS
NUOD_BARBK       IEDIG----------NFIDP-FLVALGNLDALITPNRIFKQRNVDIGVVSIDEAWARGFS
NUOD_BARHE       VEDIG----------NFIDP-FLIALGKLDALITPNRIFKQRNVDIGVVSIDEAWARGFS
NUOD_BART1       VEDIG----------NFIDP-FLVSLEKLDALVTPNRIFKQRNVDIGIVSIDEAWARSFS
NUOD_BARQU       IEDIG----------HFIDP-FLISLSRLDALVTPNRIFKQRNVDIGVISIDEAWVRGFS
NUOD_CAUVC       VEDID----------TWAKA-FPKICDDIEGLITDNRIFKQRNVDIGVVSKEEAISWGFS
NUOD_CAUSK       IDDIE----------KWAKA-FPKICDDIEGLITDNRIFKQRNVDIGVVTKEDALAWGFS
NUOD_PHEZH       VQDIS----------DWCDA-FPKILDDIEGLITDNRIFKQRNVDIGVVTKEEAIAWGFS
NUOD_MARMM       VEDIR----------AWCDQ-FPAKLDDIDSLLTENRIFKQRNVDIGVVTKEDVLAWGFS
NUOD_RUEPO       LDDIE----------AWSHT-FPNVLDDIDGLLTENRIFKQRNCDIGVVSEEEILQYGFS
NUOD_RUEST       LDDID----------LWAME-FPKVMDDIDGLLTENRIFKQRNCDIGVVTEDDIQKYGFS
NUOD_ROSDO       IDDIE----------TWAHE-FPRVIDDIDGLLTENRIFKQRNADIGVVTEEDILEYGFS
NUOD_DINSH       LDDIE----------AWSHE-FPSVMDDIDGLLTENRIFKQRNCDIGVVTEEEILEWGYS
NUOD_RHOS4       IEDIE----------EWAEH-FPKVLDDLDELLTENRIFKQRNVDIGIISEKDILDWGFS
NUOD_RHOS1       IEDIE----------EWAEH-FPKVLDDLDELLTENRIFKQRNVDIGIISEKDILDWGFS
NUOD_RHOS5       IEDIE----------EWAEH-FPKVLDDLDGLLTENRIFKQRNVDIGVVTEKDILDWGFS
NUOD_JANSC       IEDID----------TWAHE-FPQMLDDIDGLLSENRIFKQRNVDIGVVTEEDIQNWGFS
NUOD_PARDP       LDDIE----------EWCER-FPKLVDDLDTLLTENRIFKQRLVDIGIVTEADALDWGYT
NUOD_HYPNA       IDDIA----------TWCDQ-FPGKLDQIEGLVTENRIFKQRNVDIGVVDQRTILDWGFS
NUOD_PELUB       AEDIG----------NFCES-FPKIIDDLETLLTDNRIFKQRNVDIGIVTKEDALDYSFS
NUOD_RICBR       LEDID----------KFIQQ-FPPKLQDIENLLNENRLWKQRLVDIGVVSQKEAMDWGFS
NUOD_RICB8       LEDID----------KFIQQ-FPPKLQDIENLLNENRLWKQRLVDIGVVSQKEAMDWGFS
NUOD_RICCN       LEDID----------KFIEQ-FPPKLHDIESLLNENRLWKQRLVDIGVASQKEAMDWGFS
NUOD_RICM5       LEDID----------KFIEQ-FPPKLHDIESLLNENRLWKQRLVDIGVASQKEAMDWGFS
NUOD_RICRO       LEDID----------KFIEQ-FPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFS
NUOD_RICRS       LEDID----------KFIEQ-FPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFS
NUOD_RICFE       LEDID----------KFIEQ-FPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFS
NUOD_RICAH       LEDID----------KFIDQ-FPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFS
NUOD_RICCK       LEDID----------KFIEQ-FHPKLQDVESLLNENRLWKQRLVDIGVVLQQEAMEWGFS
NUOD_RICPR       LEDIN----------KFIEQ-FPSKLNDIENLLNENRLWKQRLVDIGVVSQKDAMDWGFS
NUOD_RICTY       LEDIN----------KFIEQ-FPSKLNDIENLLNENRLWKQRLVDIGVVSQKDAMDWGFS
NUOD_ORITB       IENIV----------DFCEQ-FPCKIADLETLLTDNRIWKQRTVDIGIVSKQQAMDWGFS
NUOD_ORITI       IENIA----------DFCEQ-FPCKIADLETLLTDNRIWKQRTVDIGIVSKQQAMDWGFS
NUOD_ANAMM       LDDIH----------AFTES-FPKLLDDVDGLLTENSIWKQRNVDIGVVSKAQALDWGFS
NUOD_ANAPZ       LDDIH----------EFTNY-FPKLLDSVDDLLTENSIWKQRNVEIGKVTKQQALDWGFS
NUOD_EHRCJ       IDDIF----------KFVST-FSKFMDDIDDLLTENRIWKQRNVDIGVVSKKQALDWGFS
NUOD_EHRCR       IDDIF----------KFIKT-FPKFIDDVDELLTENRIWKQRNVDIGIVSKEQALDWGFS
NUOD_EHRRG       IHDIF----------QFVNT-FPKFMDDVDSLLTENRIWKQRNVDIGVVSKKQALNWGFS
NUOD_EHRRW       IHDIF----------QFVNT-FPKFMDDVDSLLTENRIWKQRNVDIGVVSKKQALNWGFS
NUOD_WOLPP       IEDIA----------KFIEQ-FPKYIDDVDELLTENRIWKQRTVGISEISIKQALDWGFS
NUOD_WOLPM       IEDIA----------KFIEQ-FPKYIDDVDELLTENRIWKQRTVGISEISIKQALDWGFS
NUOD_WOLTR       IEDIA----------KFIEQ-FPQYIDDVDELLTENRIWKQRTVGISEISIKQALDWGFS
NUOD_NEOSM       DEEIM----------SFLES-FTHKLDDVADVLTDNPIFKQRLVDIGKVSKREAVALGFS
NUOD_MAGSA       LEDIA----------AWCET-FPKVLDDIETLATDNRIFKQRVVDIGVVSPEQALDWGFT
NUOD_RHORT       LEDIL----------KFCDS-FPKYLDDVEHLLDENRIFKQRTVDIGKVTAQQALDWGFT
NUOD_GLUDA       EDRIA----------EWARQ-FPAWIDDLESLLTNNRIWKQRTVGIGIFTTEQALAWGFS
NUOD_GRABC       TDRIA----------DWTEK-FPAFIDDMAGLLSDNRIWKQRVVDIGRMTPEQALAWGFS
NUOD_ACICJ       AEQIW----------EWSEK-FPKFLDDLQSLLNENRIFRQRLVDIGVISAEDALAMGFS
NUOD_ERYLH       LVDIG----------EWLDTRLPELFGDAMSLVLDNRIFKQRNVDIAVVSKDDAVKWGFS
NUOD_NOVAD       LTDMA----------DWIDERLHPLFDDAMSLVVDNRIFKQRNVDIAVVSKEDALRWGFS
NUOD_SPHAL       LVDIG----------EWVETRLPKLFGDAMSLVIDNRIFKQRNVDIATVSKEDALAWGFS
NUOD_SPHWW       LTDIG----------DWLDTRLPRLFEDAVSLFADNRIFKQRNVDVGVVSKEDALAWGFS
NUOD_ACIAC       LDFID----------DFTQR-FPKCVDEYETLLTDNRIWKQRTVDIGIVTPERALNLGMT
NUOD_ACISJ       LDFID----------DFTQR-FPKCVDEYETLLTDNRIWKQRTVGIGVVPAERALNLGMT
NUOD_DELAS       LDFID----------DFTQR-FPKCADEYETLLTDNRIWKQRNVDIGVVTAERAMNLGLT
NUOD_LEPCP       LDFID----------DFTKR-FPTLVDEYETLLTDNRIWKQRTVGIGVLTPERALNLGLT
NUOD_METPP       LDFIE----------DFCRR-FPKNVDDYETLLTDNRIWKQRTVGIGVVTPERALNLGFT
NUOD_CHRVO       LDFIE----------DFTKR-FPTYVDEYETLLTDNRIWKQRTVGIGVVTPERALNLGMT
NUOD_RHOFT       LDFID----------DFTQR-FPTYLGEYHTLLTDNRIWKQRTVGIGVVTAERALNLGFS
NUOD_AZOSB       LDFLD----------DFTQR-FPRYCDEYETLLTDNRIWKQRTVGIGVVTPEQALAWGFS
NUOD_AROAE       LDFLE----------DFTER-FNGYCDDYETLLTDNRIWKQRTVGIGVVTPEQAKAWGFT
NUOD_METFK       LDFIE----------DFTNR-FPAYVDEYETLLTDNRIWKQRTVGIGVVSPERAMALGMT
NUOD_BORA1       LDFIE----------DFTNR-FPACVDEYETLLTDNRIWKQRLVGIGVVDPDRAKALGFT
NUOD_BORPE       LDFIE----------DFTNR-FPSCVDEYETLLTDNRIWKQRLVGIGVVDPDRAKALGFT
NUOD_HYDCU       LDFIE----------AFTER-FPGYVDEYETLLTDNRIWKQRTVDIGIVSPERALQLGFT
NUOD_ACIF5       LDFIE----------DFARR-FPTYVDEYETLLTDNRIWKQRTVGIGVVGPERAIQLGFT
NUOD_NEIG1       LDFID----------AFCER-FPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFT
NUOD_NEIG2       LDFID----------AFCER-FPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFT
NUOD_NEIMA       LDFID----------AFCER-FPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFT
NUOD_NEIMB       LDFID----------AFCER-FPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFT
NUOD_NEIM0       LDFID----------AFCER-FPKNIDTLETLLTDNRIWKQRTVGIGVVTPERAMQKGFT
NUOD_NEIMF       LDFID----------AFCER-FPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFT
NUOD_XANOR       LDFLE----------DFTNT-FPLRVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMT
NUOD_XANOM       LDFLE----------DFTNT-FPLRVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMT
NUOD_XANOP       LDFLE----------DFTNT-FPLRVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMT
NUOD1_STRM5      LDFIE----------NFTRE-FPNRIDEYETLLTDNRIWKQRTVGIGVVSPQQAMEWGMT
NUOD_MAGMM       ---------------DFCNH-FPSKLDEYETLLTNNRIWKQRLVDIGKVSQEDAFSWGFT
NUOD2_RHIME      LPKIR----------EFCEI-FPNRIRDYERLIENNRVFLSRTQGVGVISATDAIDLGLS
NUOD2_SINMW      LPKIR----------EFCEI-FPNRIRDYERLIENNRVFLSRTQGIGVISAADAVDLGLS
NUOD2_RHIEC      FPKIR----------EFCDI-FPNRIRDYERLLEDNRVFLNRTKGIGVISAEDAVDLGLS
NUOD2_RHIE6      FPKIR----------EFCDI-FPNRIRDYERLLEDNRVFLNRTKGIGVISAEDAVDLGLS
NDHH_CAPBU       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_NASOF       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_BARVE       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIVGGEEAINWGLS
NDHH_ARATH       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_DRANE       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIDGEEAINWGLS
NDHH_ARAHI       DKCLD-----------FCDYFLTEV-IEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_OLIPU       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_LEPVR       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_CRUWA       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_LOBMA       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_AETCO       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGILGGEEAINWGLS
NDHH_AETGR       DKCLD-----------FCDYFLTEV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWSLS
NDHH_SOYBN       DKCYD-----------FCDYFLTRI-VEYQKLITRNPIFLERVEGVGVVDIKEVINWGLS
NDHH_PHAVU       DKCSD-----------FCDYFLTSI-AEYQKLITRNPIFLERVEGVGVVDVKEVINWGLS
NDHH_LOTJA       DKCFD-----------FCNYFFTRV-VEYQKLITRNPIFLERVEGVGVVGGEEVINWGLS
NDHH_CICAR       DKCFD-----------FCNYFLTRV-IEYQKLITRNPIFLERVEGVGIIGREEVINWGLS
NDHH_CUCSA       DKCLD-----------FCDYFLTAV-AEYQKLITQNPIFLERVEGVGIISGEEVINWGLS
NDHH_MORIN       DKCLD-----------FCDYFLIGV-TEYQKLITRNPIFLERVEGVGVIGREEVINWGLS
NDHH_OENEH       DKCLD-----------FCDYFLTAV-SEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_OENBI       DKCLD-----------FCDYFLTAV-SEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_OENGL       DKCLD-----------FCDYFLTAV-SEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_OENAR       DKCLD-----------FCDYFLTAV-SEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_OENPA       DKCLD-----------FCDYFLTAV-SEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_EUCGG       DKCLD-----------FCDYFLTAV-SEYQKLITRNPIFLERVEGVGIIGPEEAINWGLS
NDHH_GOSBA       DKCLD-----------FCDYFLTGI-VEYQKLITRNPIFLERVEGIGVIGGEEAINWGLS
NDHH_GOSHI       DKCLD-----------FCDYFLTGI-VEYQKLITRNPIFLERVEGIGVIGGEEAINWGLS
NDHH_CITSI       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_CARPA       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_IPOPU       DKCLD-----------FCNYFLTGV-AEYQKLITQNPIFLERVEGIGTIRAEEALNWGLS
NDHH_PELHO       DKCLD-----------FCNYFLTGL-AEYEKLITRNPIFLERVEGIGIIGKEEAISWGLS
NDHH_POPAL       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGIGIVSAEEAINWGLS
NDHH_POPTR       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGIGIVSAEEAINWGLS
NDHH_MANES       DKCLD-----------FCDYFLTGV-TEYQKLITRNPIFLERVEGVGIVGTEEAINWGLS
NDHH_SOLLC       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGRDEALNWGLS
NDHH_SOLBU       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGRDEALNWGLS
NDHH_SOLTU       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGRDEAVNWGLS
NDHH_TOBAC       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGGDEALNWGLS
NDHH_NICSY       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGGDEALNWGLS
NDHH_ATRBE       DKCLD-----------FCDYFLTGI-AEYQKLITRNPIFLERVEGVGIIGGDEALNWGLS
NDHH_NICTO       NKCLD-----------FCDYFLTGV-AEYQKLITRNPLFLERVEGVGIIGGDEALNWGLS
NDHH_COFAR       DKCLD-----------FCDYFLTGV-AEYQKFITRNPIFLERVEGVGIIGGEEALNWGLS
NDHH_JASNU       DKCLD-----------FCDYFLRGV-VEYQKLITRNPIFLERVEGVGIIGAEEALNWGLS
NDHH_SPIOL       DKCLD-----------FCDYFLIGL-TEYQKLITRNPIFLERVENVGIIGGEEAINWGLS
NDHH_VITVI       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGVEEAINWGLS
NDHH_DAUCA       DKCLD-----------FCDYFLTRV-TEYQRLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_PANGI       DKCLD-----------FCDFFLTRV-TEYQKLITRNPIFLERVEGVGIIGGAEAINWGLS
NDHH_FAGEA       DKCLD-----------FCEYFLPAI-AEYQTLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_GUIAB       DKCLD-----------FCDYFLTGI-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_HELAN       DKCLD-----------FCDYFLTGI-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_LACSA       DKCLD-----------FCDYFLTGI-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_PLAOC       DKCLD-----------FCDYFLTGI-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_NANDO       DKCLD-----------FCDYFVTGV-TEYQKLITRNPIFLERVEGVGFISGEEAINWGLS
NDHH_RANMC       DKCLD-----------FCDYFLTGV-TEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_BUXMI       DKCLD-----------FCDYFLTGV-VEYQKLITRNPVFLERVEGVGIIGGEEAINWGLS
NDHH_AMBTC       DKCLD-----------FCDYFLPEV-AEYQKLITRNPIFLERVEGVGFIAEEEAINWGLS
NDHH_DIOEL       DKCLD-----------FCDYFLTRV-AEYEKLITRNPIFLDRVEGVGIIGGEEAINWGLS
NDHH_ILLOL       DKCLD-----------FCDYSLTGV-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_CHLSC       DKCLD-----------FCDYFLTGV-AEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_CALFG       DKCLD-----------FCDYFLTGV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_DRIGR       DKCLD-----------FCDYSLTGV-VEYQKLITRNPIFLERVEEVGIIGGEEAINWGLS
NDHH_CERDE       DKCLD-----------FCDYFLTGV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_LIRTU       DKCLD-----------FCDYSLTGV-VEYQKLITRNPIFLERVEGVGIIGGEEAINWGLS
NDHH_NUPAD       DKCLD-----------FCDYFLTGV-VEYQKLITRNPIFLERVEGVGFIGGEEAINWGLS
NDHH_NYMAL       DKCLD-----------FCDYFLTGV-VEYQKLITRNPIFLERVEGVGFIGGEEAINWGLS
NDHH_PIPCE       DKCFD-----------FCDYFLTGV-VEYQKLITQNPIFLERVEGIGIIGGEEAINWGLS
NDHH_ACOAM       DKCLD-----------FCDYFLTGI-VEYEKLITQNPIFLERVERVGIISGEEAINWGLS
NDHH_ACOCL       DKCLD-----------FCDYFLTGI-VEYEKLITQNPIFLERVERVGIISGEEAINWGLS
NDHH_HORVU       DKCLD-----------FCDYFLRGV-VEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_WHEAT       EKCLD-----------FCDYFLRGV-VEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_BRADI       EKCLD-----------FCDYFLRGV-VEYQQLITQNPIFLERVERVGFISGEEAVNWGLS
NDHH_ORYNI       DKCLD-----------FCDYFLRGV-IEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_ORYSA       DKCLD-----------FCDYFLRGV-IEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_ORYSI       DKCLD-----------FCDYFLRGV-IEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_ORYSJ       DKCLD-----------FCDYFLRGV-IEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_LOLPR       DKCLD-----------FCDYFLRGI-IEYQQLIKQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_AGRST       DKCLD-----------FCDYFLRGV-VEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_SACHY       DKCLD-----------FCDYFLQGV-VEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_SACOF       DKCLD-----------FCDYFLQGV-VEYQQLITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_SORBI       DKCLD-----------FCDYFLQGV-VEYQQLITRNPIFLERVEGVGFISGEEAVNWGLS
NDHH_MAIZE       DKCLD-----------FCDYFLQGV-VEYQELITQNPIFLERVEGVGFISGEEAVNWGLS
NDHH_LEMMI       DKCLD-----------FCDYFLTGI-DEYEKLITRNPIFLERVEGIGIISGEEAINWGLS
NDHH_CRYJA       DKCLD-----------FCYYFFPKV-TEYERLITRNPIFLKRVEGVGIISREEAIDWSLS
NDHH_CYCTA       DKCLD-----------FCDYFLSKV-AEYERLITRNPIFLERVEGVGIIGREEAIDWGLS
NDHH_ANTAG       DKCLD-----------FCDYFSLKV-DEYERLITYNSIFLKRVEGVGTISREEAINWGLS
NDHH_ANGEV       DKCLD-----------FCDYFLPKV-DEYEQLITNNPIFLKRVEGVGFIGREEAINWGLS
NDHH_MARPO       DKCLD-----------FCDYFLPKI-NEYERLITNNPIFLKRVEGIGTVTREEAINWGLS
NDHH_PHYPA       DKCLD-----------FCDYFLPKV-NEYERLITNNPIFLKRVEGIGIIGKEEAINWGLS
NDHH_HUPLU       DKCSD-----------FCNYSLPKV-NEYERLITRNPIFLKRVEGVGTIGGEEAINWGLS
NDHH_ADICA       DKCLD-----------FCQYCLPKI-YEYERLVTKNPIFLKRVQGVGFINRQEAINWGLS
NDHH_PSINU       DKCLD-----------FCDYFSPKI-SEYEKLIVHNPIFLERVKGVGFISREEAINWGLS
NDHH_CHAGL       DKCLD-----------FCDYFLPKI-AEYENLITNNPIFRKRVEGIGIISREDAINWGLS
NDHH_CHAVU       DKCLD-----------FCEYFLPKV-NEYENLITQNPIFLKRVEGIGVINKEEAINWGLS
NDHH_STAPU       DKCLD-----------FCDYFLPKI-DEYERLITRNPIFLKRVEGVGFIGREEAINWGLS
NDHH_ZYGCR       DKCLD-----------FCDYFLPKV-NEYERLITRNPIFLKRVEGIGVIGREEAINWGLS
NDHH_MESVI       DKCLD-----------FSDYFLPKV-DEYERLITNNPIFLKRVRDVGFISREEAINWGLS
NDHH_CHLAT       DKCLD-----------FCDYFLPKV-DEYERLITNNPIFLKRVKDIGKISKEDAINWGLS
NDHH_NEPOL       DKCLD-----------FCEYFLPKV-DEYEALITRNPIFLKRVKGVGTISPQQAINWGLS
NDHH1_GLOVI      DKARD-----------FCNYLPPKI-DEYERLITNNPIFRGRVEGLGYIGREDAINWGLS
NDHH_NOSS1       DKCLE-----------FCDYFLPVI-DEYEKLVTNNPIFRRRIEGIGTISREEAINWGLS
NDHH_THEEB       TKCRD-----------FCDYFLPKV-DEYERLITNNPIFVRRLQGVGKISREEAINWGLS
NDHH_SYNY3       DKCED-----------FCDYFLPKV-DEYEKLITNNPIFRRRVEGVGTVTREEAINWGLS
NUOD_AMOA5       ERCLE-----------FITYLKPKL-EEINQLLIDNTLFIKRTANVGVLPLATAINHGVS
NUOD1_CYTH3      ERCKD-----------FISYLKPKL-AELQKVIIDNKIFIERTANIGVLPLDLAINYGIT
NUOD_CHLP8       KRVAE-----------FVTYFRPKA-VELYKLLTENEIFVKRTKGIGIMPADVAINFAWS
NUOD_CHLTE       TRVAE-----------FVTYFRPKA-KELYQLLTENEIFVKRTYDIGIMPADVAINYGWS
NUOD_CHLL2       KRVKE-----------FVDYFRPKV-VELYKLLTENEIFVKRTKGIGIMPADVAINYAWS
NUOD_CHLPD       KRVKE-----------FVDYFRPKA-VELYQLLTENEIFVKRTKGIGIMPADVAINYGWS
NUOD_PELLD       KRVGE-----------FVDYFRPKA-LELSRLLTENEIFVKRTKGIGIMPADVAINYGWS
NUOD_CHLPM       ERVLE-----------FVNYFRPKA-LELQQLLTENEIFVKRTKGIGIMPADVAINYGWS
NUOD_PELPB       KRVGE-----------FVTYFRPKA-VELCNLLTENEIFVKRTRGIGIMPADVAINYGWS
NUOD_CHLCH       KRIRE-----------FCAYFRPKA-KELADLLTSNEIFVKRTHGIGIMPADVAINYGWS
NUOD_CHLPB       RRTLE-----------FVKYFRPKA-LELQKLLTENEIFVKRTKGVGMMPADVAINYGWS
NUOD_PROA2       ERTAE-----------FVNYFRPKA-LELQRLLTENEIFVKRTKGIGMMPPDVAVNYGWS
NUOD2_CHLT3      ERVME-----------FVRYFKPQA-RELYQLLTENEIFVQRTKDIGLLPADVAINAGAS
NUOD2_ANADE      DKVLH-----------FLDHFDKFL-AEFDRLISFNEIYVKRLANVAVIPGPMAINYGLV
NUOD1_ANASK      DKVLH-----------FLDHFDKFL-AEFDRLISFNEIYVKRLANVAVIPGPMAINYGLV
NUOD1_ANADF      DKVLA-----------FLDRFDKFL-PEFDRLITFNEIYKKRLANVATISREQAISYGLV
NUOD2_SORC5      DKVKH-----------WLDRFEPIM-VEFDRLISLNDIFIKRLANVAVVTAEEAKDWGLV
NUOD_BACAN       EKVKE-----------FVPYMREQL-AGYHDLVSGNEIFLNRVKGVGIYSAEEAISYSLS
NUOD_BACCR       EKVEE-----------FVPYMREQL-AGYHDLVSGNEIFLNRVKGVGIYSAEEAISYSLS
NUOD_BACAH       EKVEE-----------FVPYMREQL-AGYHDLVSGNEIFLNRVKGVGIYSAEEAISYSLS
NUOD_BACCZ       EKVEE-----------FVPYMREQL-AGYHDLVSGNEIFLNRVKGVGIYSEEDAISYSLS
NUOD_BACHK       EKVEE-----------FVPYMREQL-AGYHDLVSGNEIFLNRVKGVGIYSAEEAISYSLS
NUOD_BACC1       EKVEE-----------FVPYMREQL-AGYHDLVSGNEIFLNRVKGVGIYSEEDAISYSLS
NUOD_BACMK       EKVKE-----------FVPYMREQL-EGYHDLVSGNEIFLNRVKGVGVYSAEEAISYSLS
NUOD_BACCN       QKVRE-----------FVPYMKEQL-KGYHDLVSGNEIFVNRVKGIGIYSAEEAISYSLS
NUOD_GEOKA       DKVKQ-----------FVPYMREKL-HGYHELVTGNEIFRQRVTGVGRYTKEEAISYSLS
NUOD_GEOTN       DKVKQ-----------FVPYMREKL-AGYHDLVTGNEIFRERVTGVGRYTKEEAISYSLS
NUOD_DESPS       VGTRK-----------FIIRMRKSL-KTYRDLVTNNIILMKRLKDIGHISPEICRKYGAT
NUOD2_OPITP      KGTRE-----------FVKYMRPRL-KMYRDLVTDNVILRQRLTGIGPISADTCRKYGAT
NUOD_SYNFM       DMARD-----------FIKRLRSRW-PDYHNLVTRNIIFIHRTRGVGVITPEQARQFGVT
NUOD2_SALAI      GRART-----------AIGEVRRRM-PDLDRLIRRNEIFLARTVGVGVLSAAQAAAFGAS
NUOD2_SALTO      GRARA-----------AIGEVRRSL-PDLDNLIRRNEIFLARTVGVGVLSAAQAAAYGAS
NUOD2_STRAW      TRARA-----------CVAALRSRL-DVYDDLVLGNEIFRGRTRGVGVLTPEAVHAYGVS
NUOD1_STRCO      TRARG-----------AVAAVRSRM-DVFDDLVLGNEIFRGRTRGVGALSAEAVHAYGVS
NUOD2_STRGG      GRVRD-----------AVASVRSRM-DVYENLVLGNEIFRGRTRDVGVLSAAAVHAYGVS
NUOD_RUBXD       EKIWE-----------YVEGLEKRIKPDFIDLIEGNEIFIERTRGISRLTQEEAIELGLT
NUOD_DESHY       PALES-----------FLDDMPEKLE-EYFNIYMGNEIAQARMKKVGILSKEVAENLCIT
NUOD_HELMI       AQCRK-----------FLADFKGMME-TYDKLIVGNEIFQMRLKGVAPLSAERAIAMSAT
NUOD_CARHZ       EKAKE-----------YLPKILDGVD-EEEGLLAGNEIFLARTKGLAPVSVEKALAWGWG
NUOD2_SYMTH      GTPQDGEDKADKTIWGFINYFDSYVYPEWKALVTGNRIFQYRTKNIGVLTAEQAIAYSCS
NUOD_CAMJE       EEMLA-----------FCDKFPNDL-KDYEDLLDDNRIWRLRTENVGVVTKEQALNWGCT
NUOD2_ROSCS      PQLKE-----------LMQGLPSFF-DEFERLLRENEILLSRTVNVGILPKEVAVSYSVT
NUOD1_ROSS1      PQLKE-----------LMQGLPSFF-DEFERLLKENEILLSRTINVGVLPKEVAVSYSVT
NUOD2_HERA2      TELKK-----------LMQGLPHYF-DDFEGLLLNSEILLARARNIGVLPKELALAYSVT
NQO4_THET8       PELKK-----------LLEVLPHRI-DEYEALFAESPIFYERARGVGVIPPEVAIDLGLT
NUOD_THET2       PELKK-----------FLEVMPHRI-DEYEALFAESPIFYERARGVGVIPPEVAIDLGLT
NUOD_DEIRA       ARVEA-----------FLNQMERGV-EEYTTLFAANPIFLDRAKGVGVIPADAALDLGLT
NUOD_DEIGD       ARVAA-----------FLDTFERGV-DEYETLFAKNPIFLDRAKGVGVIPRDVAIDLGLT
NUOD2_KORVE      DRVKK-----------FADTFPSKM-DEYEGLLTQNPIFVMRTKGVAKITKEDALALGAS
NUOD1_SOLUE      QRVKK-----------FLDVFPSRI-DEYENLLTNNRIWTGRTKGIGFISLEDMLDLGIT
NUOD1_ROSCS      AAVEA-----------FLAIMPGRI-DEYEALLTDNPLWIERTQGIGAIDSEAAIALGLT
NUOD2_ROSS1      AAVEA-----------FLQIMPGRI-DEYEALLTDNPLWIERTQGIGAIDSEAAIALGLT
NUOD2_CHLAA      PTVEQ-----------FLAVMPSRI-DEYEDLLTANPLWLERTVGVGVIDAQSAIALGLT
NUOD1_HERA2      PTVED-----------FLTHFLPKV-DEYEDLLTNNLLWKQRTKGVGVVNAADAIALGLS
NUOD_GEOMG       KDVRE-----------IVDTFPGHF-DTYEGLLTKNTIWLNRTVGNGVISAEDAIDYGIT
NUOD_GEOSL       KDVRE-----------VIDTFPGHF-DTYEGLLTKNTIWVNRTVGNGVISAEDAVDYGIT
NUOD_GEOBB       SAVQE-----------ILDTFPGHF-DTYEGLLTKNTIWLQRTIGNGVISADDAIDFGIS
NUOD_GEOUR       AAVRE-----------VLDTFPGHF-DTYEGLLTKNTIWLQRTIGNGVISAEDAIDYGIT
NUOD_GEOLS       KKVRD-----------FVAEMPGFI-DTYEGLLTGNPIWRKRTIGNGVISAEDATDIGIT
NUOD_MYCBP       TEIAE-----------ALKQLRQPL-REMGELLNENAIWKARTQGVGYLDLTGCMALGIT
NUOD_MYCTA       TEIAE-----------ALKQLRQPL-REMGELLNENAIWKARTQGVGYLDLTGCMALGIT
NUOD_MYCTU       TEIAE-----------ALKQLRQPL-REMGELLNENAIWKARTQGVGYLDLTGCMALGIT
NUOD_MYCBO       TEIAE-----------ALKQLRQPL-REMGELLNENAIWKARTQGVGYLDLTGCMALGIT
NUOD_MYCMM       TEIAK-----------AIADLRQPL-REMGDLLNENAIWKARTQDVGYLDLAGCMALGIT
NUOD_MYCUA       TEIAK-----------AIADLRQPL-REMGDLLNENAIWKARTQDVGYLDLAGCMALGIT
NUOD_MYCA1       TEIAQ-----------ALDQLRQPL-REMGDLLNENAIWKARTQDIGYLDLTGCMALGIT
NUOD_MYCPA       TEIAQ-----------ALDQLRQPL-REMGDLLNENAIWKARTQDIGYLDLTGCMALGIT
NUOD_MYCGI       PQIRE-----------LLTLLPTRL-RDMENLLNENYIWKARTLGVGYLDLTGCMALGIT
NUOD_MYCVP       PQVRD-----------LLTLLPKRL-RDMEDLLNENYIWKARTQGIGYLDLTGCMALGIT
NUOD_MYCSJ       PRIRE-----------LLALLPGRL-RDLENLLNENYIWKARTQGIGYLDLAGCMALGIT
NUOD_MYCSK       PRIRE-----------LLALLPGRL-RDLENLLNENYIWKARTQGIGYLDLAGCMALGIT
NUOD_MYCSS       PRIRE-----------LLALLPGRL-RDLENLLNENYIWKARTQGIGYLDLAGCMALGIT
NUOD_MYCS2       TQVRR-----------LVEILPKRL-KDLEDLLNENYIWKARTVGVGYLDLTGCMALGIT
NUOD_MYCA9       QEVRD-----------LLEILPGRL-RDMENLLNENYIWKARTQGVGYLDLTGCMALGIT
NUOD_NOCFA       AKVRE-----------LLDLMPKRL-RDMEHLLTQNPIFKARTQDIGYLDLTGCMALGIT
NUOD_RHOJR       EKVRE-----------LLALMPERL-RDMENLLNDNRIWKGRTQGIGYLDLTGCMALGIT
NUOD1_STRAW      DQIRE-----------FVKKMKKNL-PEYDKLATGNPIFKARMQDVGYLDLAGCMALGAT
NUOD2_STRCO      DQIRE-----------FVKKMNKNL-PEYDKLATGNPIFKARMQDVGYLDLAGCMALGAT
NUOD1_STRGG      DRLRE-----------FIKTMKKNL-PEYDKLATGNPIFKARMQDVGYLDLTGCMALGAT
NUOD_NOCSJ       DEIRG-----------FVALMKKRL-PEYADLCNANPIFKGRLEGIGHLDLAGCLALGLT
NUOD_THEFY       GKVRE-----------LLTEMPKRL-KDMRKLLDANPIYLARTRDVAYLDVTGCLALGVT
NUOD_FRAAA       RAIRE-----------FLADMPKRI-REYHRLLTGQPIWKARMVDVNVLDAAGCIALGVT
NUOD_FRACC       RAIRA-----------FLADMPKRI-REYHALLTGQPVWKARMVDVNVLDAAGCIALGTT
NUOD_FRASN       PEIRA-----------FLDYMPKRI-REYHALLTGQPIWKARMVDVNFLDAAACLALGTT
NUOD1_SALAI      AKIRD-----------FLKLMPKKL-EEYEKMLSGQPIWLERTQNVGVLDATGCLALGVT
NUOD1_SALTO      AKIRD-----------FLELMPKKL-AEYEKMLSGQPIWLERTQNVGVLDATGCLAMGVT
NUOD_ACIC1       EKIRE-----------FLDIMPARI-DEYHDLLTGQPIWVRRLKGVGYLDLTGAVALGAT
NUOD_SACEN       QKVLD-----------FIKVMDSRL-PSYDKLFTGQPIWKQRLKDVGYLPLDGCMQLGVT
NUOD_CUTAK       DQLRD-----------LIKRMEKYL-PEIGQFCNENPIFKARTQGIGYADLSTCMALGVT
NUOD1_SYMTH      EMVED-----------FLKVAPGRI-QELKDVMLHNPIFVDRAKGVSVITYEQALRYGLT
NUOD_THEM4       KMILE-----------TLDYIESRL-PDYEKLILKNRIVHTRLKGIAKLDRETALEMGVT
NUOD_PARUW       SHLKE-----------FISGFQKIW-KELDRLLTDNFVWCKRLQGVAVIDQEICKQYMCT
NUOD_FLAJ1       RKLDK-----------FLEEFPPAW-KEFENLFERNRIFLDRTVNVGGITAEKAMAYGFT
NUOD_FLAPJ       QLLNT-----------FLEEFPIAW-KEFENLFERNRIFIDRTVNVGAISAEKAMAYGFT
NUOD2_CYTH3      RKIDK-----------FLADYPAVL-TEFENLFNRNRIFMDRTIGTGGITAERALNYGFT
NUOD_LEPBA       TEIKL-----------ILKGLKPAL-DEFEELLIRNKIFNERTKGIGGISADRAIAYGFS
NUOD_LEPBP       TEIKL-----------ILKGLKPAL-DEFEELLIRNKIFNERTKGIGGISADRAIAYGFS
NUOD_LEPBJ       KEVKL-----------VCKGLKPAI-EEFNSLLLKNKIFLGRTEGIGGISAENAIAYGFS
NUOD_LEPBL       KEVKL-----------VCKGLKPAI-EEFNSLLLKNKIFLGRTEGIGGISAENAIAYGFS
NUOD_LEPIN       KEVKL-----------VCKGLKPAI-EEFNSLLLKNKIFLGRTEGIGGISAENAIAYGYT
NUOD_LEPIC       KEVKL-----------VCKGLKPAI-EEFNSLLLKNKIFLGRTEGIGGISAENAIAYGYT
NUOD1_SORC5      AMVRV-----------GLARVLALV-NDAEKLILKNRIFLDRLDGVGQISQEDALALGWT
NUOD_METI4       EKLKD-----------FIKQFLPKV-DEIEGLLTKNKIFVDRTQDIGIISKEDAIDYGLT
                                                .   . :   *                  

NUOD1_RHIME      GVMVRGSGAAWDLRRSQPYECYSDLE--FDIPIGKN-----GDCFDRYLIRMIEMRQSAR
NUOD1_SINMW      GVMVRGSGAAWDLRRSQPYECYSDLE--FDIPIGKN-----GDCFDRYLIRMIEMRESAR
NUOD1_RHIEC      GVMVRGSGAAWDLRRAQPYECYSDLE--FDIPIGKN-----GDNYDRYLIRMIEMRQSVR
NUOD1_RHIE6      GVMVRGSGAAWDLRRAQPYECYSDLE--FDIPIGKN-----GDNYDRYLIRMIEMRQSVR
NUOD_RHIL3       GVMVRGSGAAWDLRRAQPYECYSDLE--FDIPIGKN-----GDNYDRYLIRMIEMRESVR
NUOD_AGRFC       GVMVRGSGAAWDLRRSQPYECYSDLE--FDIPVGKN-----GDCYDRYLIRMQEMRESVK
NUOD_BRUAB       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUA2       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUA1       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUC2       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUSI       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUO2       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUSU       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_BRUME       GVMVRGSGAAWDLRKSQPYECYSEME--FDIPVGKN-----GDCYDRYLIRMEEMRQSVR
NUOD_OCHA4       GVMVRGSGAAWDLRKSQPYECYNEME--FDIPIGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_CHESB       GVMVRGSGAAWDLRKSQPYECYPEMD--FDIPVGKN-----GDCYDRYLIRMEEMRQSAK
NUOD_RHILO       GVMVRGSGAAWDLRKSQPYECYSEMD--FDIPIGKN-----GDCYDRYLVRMEEMRQSAR
NUOD_AZOC5       GVMVRGSGAPWDLRRAQPYECYSELD--FDIPIGKH-----GDCYDRYVVRMEEMRQSNK
NUOD_XANP2       GVMVRGSGAAWDLRRAQPYECYSELD--FDIPIGKH-----GDCYDRYVVRMEEMRQSTK
NUOD_BRASB       GVMVRGSGAAWDLRKSQPYDVYAEME--FDVPIGKN-----GDCYDRYLIRMEEMRQSVR
NUOD_BRASO       GVMVRGSGAAWDLRKSQPYDVYAEME--FDIPIGKN-----GDCYDRYLIRMEEMRQSVR
NUOD_BRADU       GVMVRGSGAAWDLRKSQPYECYAEMD--FDIPIGKN-----GDCYDRYLIRMEEMRQSVR
NUOD2_NITHX      GVMVRGSGAAWDLRKAQPYECYAEMD--FDIPIGKN-----GDCYDRYLIRMEEMRQSAR
NUOD_NITWN       GVMVRGSGAAWDLRKAQPYECYAEMD--FDIPIGKN-----GDCYDRYLIRMEEMRQSVR
NUOD_RHOP5       GVMVRGSGAAWDLRKSQPYECYAEMD--FDVPIGKN-----GDCYDRYLLRMEEMRQSVS
NUOD_RHOPB       GVMVRGSGAAWDLRKSQPYECYAELE--FDIPIGKN-----GDCYDRYCIRMEEMRQSVR
NUOD_RHOPS       GVMVRGSGAAWDLRKSQPYECYAEMD--FDIPIGKN-----GDCYDRYCLRVEEMRQSIR
NUOD_RHOP2       GVMVRGSGAAWDLRKSQPYECYAEMD--FDVPIGKN-----GDCYDRYCIRVEEMRQSVR
NUOD_RHOPA       GVMVRGSGAAWDLRKSQPYECYAELD--FEVPIGKN-----GDCYDRYHIRMEEMRQSVR
NUOD_RHOPT       GVMVRGSGAAWDLRKSQPYECYAELD--FEVPIGKN-----GDCYDRYHIRMEEMRQSVR
NUOD_METEP       GVMVRGSGIPWDLRKSQPYELYEEME--FDIPVGKN-----GDTYDRQVIRMEEMRESVK
NUOD_METPB       GVMVRGSGIPWDLRKSQPYECYEEMD--FDIPVGKN-----GDTYDRQVIRMEEMRESVK
NUOD_METRJ       GVMVRGSGIPWDLRKAQPYECYEEME--FDVPVGKN-----GDTYDRQVIRMEEMRQSVR
NUOD_METS4       GVMLRGSGIPWDLRRAQPYEAYEEME--FDVPVGKN-----GDTYDRQVIRMEEMRQSVR
NUOD1_BEII9      GVMVRGSGAAWDLRKAQPYECYEEMD--FDIPVGRH-----GDNYDRQVIRMEEMRQSTK
NUOD2_BEII9      GVMVRGSGAAWDLRKAQPYECYDELQ--FDIPVGKH-----GDCYDRYLIRMEEMRQSVR
NUOD1_NITHX      GVMVRGSGAAWDLRKAQPYECYSELD--FDIPIGKH-----GDCYDRYLVRMEEMRQSVR
NUOD_PARL1       GVMVRGSGMAWDLRRAQPYEVYSELD--FDIPVGKN-----GDCYDRYLCRMEEMRQSLR
NUOD_BARBK       GVMIRGAGVPWDLRKSQPYECYDEME--FDIPVGKN-----SDCYDRYLIRMEEMRQSAK
NUOD_BARHE       GVMIRGAGVPWDLRKSQPYECYDEME--FDIPVGKN-----SDCYDRYLIRMEEMRQSAK
NUOD_BART1       GVMIRGAGVPWDLRKSQPYECYDEME--FDIPIGKN-----SDCYDRYLIRMEEMRQSAK
NUOD_BARQU       GVMIRGAGVPWDLRKSQPYECYDEME--FDIPVGKN-----SDCYDRYLIRMEEMRQSAR
NUOD_CAUVC       GVMVRGSGIAWDLRRSQPYENYNDFE--FDIPLGKN-----GDCYDRYLCRMQEMRESTK
NUOD_CAUSK       GVMVRGSGIAWDLRRNQPYECYNDFE--FDIPLGKN-----GDCYDRYLCRMQEMRESTK
NUOD_PHEZH       GVMVRGSGIPWDLRRSQPYALYSEME--FDIPLGVN-----GDCYDRYLCRMQEMRESTK
NUOD_MARMM       GVMVRGSGLAWDLRRSQPYSVYDELK--FDIPVGKN-----GDCYDRYLCRMEEMRESVK
NUOD_RUEPO       GVMVRGSGLAWDLRRAQPYECYDEFE--FQVPVGKN-----GDCYDRYLCRMEEMRQSIS
NUOD_RUEST       GVMVRGSGLAWDLRRAQPYECYDEFD--FQIPVGKN-----GDCYDRYLVRMEEMRQSLS
NUOD_ROSDO       GVMVRGSGLAWDLRRAQPYERYDEFD--FQIPIGKN-----GDCYDRYLVRMEEMRQSLS
NUOD_DINSH       GVMVRGSGLAWDLRRAQPYECYDEFD--FQIPVGKN-----GDCYDRYLVRMQEMRESLK
NUOD_RHOS4       GVMVRGSGFAWDLRRSQPYECYDEFD--FQIPVGKN-----GDCYDRYLCRMEEMRQSTR
NUOD_RHOS1       GVMVRGSGFAWDLRRSQPYECYDEFD--FQIPVGKN-----GDCYDRYLCRMEEMRQSTR
NUOD_RHOS5       GVMVRGSGLAWDLRRSQPYECYDEFD--FQIPVGKN-----GDCYDRYLCRMEEMRQSTR
NUOD_JANSC       GVMVRGSGFAWDLRRAQPYECYDEFE--FQIPVGKN-----GDCYDRYLCRMAEMRESTK
NUOD_PARDP       GVMVRGSGLAWDLRRSQPYECYDEFD--FQIPVGRN-----GDCYDRYLCRMAEMRESCK
NUOD_HYPNA       GVMVRGSGLAWDLRRSQPYECYSELD--FKVPVGRH-----GDNYDRYVCRMDEMRESVK
NUOD_PELUB       GVMIRGSGVPWDLRKSQPYDCYEQLE--FKIPVGKN-----GDCFDRYLCRIEEMRESVS
NUOD_RICBR       GPMLRGSGIAWDLRKSNPYDVYAEMD--FEVPIGKN-----GDCYDRYLVRMLEMYESVK
NUOD_RICB8       GPMLRGSGIAWDLRKSNPYDVYAEMD--FEVPIGKN-----GDCYDRYLVRMLEMYESVK
NUOD_RICCN       GPMLRGSGIAWDLRKSNPYDVYDEMD--FKVPIGKN-----GDCYDRYFVRMLEMYESIK
NUOD_RICM5       GPMLRGSGIAWDLRKSNPYDVYDEMD--FKVPIGKN-----GDCYDRYFVRMLEMYESIK
NUOD_RICRO       GPMLRGSGIAWDLRKSNPYDVYDEMD--FKVPIGKN-----GDCYDRYFVRMLEMYESIK
NUOD_RICRS       GPMLRGSGIAWDLRKSNPYDVYDEMD--FKVPIGKN-----GDCYDRYFVRMLEMYESIK
NUOD_RICFE       GPMLRGSGIAWDLRKSNPYDVYDEID--FKVPIGKN-----GDCYDRYFVRMLEMYESIK
NUOD_RICAH       GPMLRGSGIAWDLRKSNPYDVYDEME--FEVPIGKN-----GDCYDRYFVRMLEMYESIK
NUOD_RICCK       GPMLRGSGIAWDLRKSNPYDVYDEID--FEVPIGKN-----GDCYDRYLVRILEMYESIK
NUOD_RICPR       GPMLRGSGIAWDLRKSNPYDVYDEMD--FEVPIGKN-----GDCYDRYLVRILEMYESIK
NUOD_RICTY       GPMLRGSGIAWDLRKSNPYDVYDEMD--FEVPVGKN-----GDCYDRYLVRILEMYESIK
NUOD_ORITB       GVMLRGSGIAWDLRKSQPYDQYANLD--FDVAIGKN-----GDCYDRYLIRIEEMYQSIK
NUOD_ORITI       GVMLRGSGIAWDLRKSQPYDQYANLD--FDVAIGKN-----GDCYDRYLIRIEEMYQSIK
NUOD_ANAMM       GPMLRACGIPWDLRKSQPYEIYETLD--FKVPVGSN-----GDCYDRYLVRMAEMRESIS
NUOD_ANAPZ       GPMLRACGIPWDLRKSQPYEIYDILD--FKVPVGSN-----GDCYDRYLVRMAEIRESLY
NUOD_EHRCJ       GPMLRACGIPWDLRKSQPYEIYEDLE--FEIPVGEN-----GDCYDRYLVRMAEIRQSIK
NUOD_EHRCR       GPMLRACGIPWDLRKSQPYEIYEDLE--FEIPIGKK-----GDCYDRYLVRMAEIRQSIK
NUOD_EHRRG       GPMLRACGIPWDLRKSQPYEIYDELE--FKIPIGEK-----GDCYDRYLVRMAEIRESIS
NUOD_EHRRW       GPMLRACGIPWDLRKSQPYEIYDELE--FKIPIGEK-----GDCYDRYLVRMAEIRESIR
NUOD_WOLPP       GPMLRAAGLAWDLRKSQPYEIYDQLD--FDIPIGQN-----GDCYDRYLVRMAEIRQSVS
NUOD_WOLPM       GPMLRAAGLAWDLRKSQPYEIYDQLD--FDIPIGQN-----GDCYDRYLVRMAEIRQSIS
NUOD_WOLTR       GPMLRAAGLAWDLRKSQPYEIYDQLD--FDIPVGQN-----GDCYDRYLVRMEEIRQSVS
NUOD_NEOSM       GPVLRASGVPWDLRKSQPYEVYESLD--FAIPVGSC-----GDSYDRYLVRMAEMYESVK
NUOD_MAGSA       GPNLRASGIAWDLRKSQPYDVYDQME--FDIPVGKN-----GDGYDRYLVRVLEMRESVK
NUOD_RHORT       GPVLRGCGVPWDLRKSQPYDAYAAMD--FDIPTGAN-----GDCYDRYLVRMAEQRQSIR
NUOD_GLUDA       GPCLRASGVPWDLRRAQPYDNYDKVE--FNIPVARQ-----GDCYDRYLIRVAEMRESVR
NUOD_GRABC       GPCIRASGIPWDLRKSQPYDKYADVD--FEVPVGRN-----GDCYDRYLVRVEEMRQSVR
NUOD_ACICJ       GPNLRASGIAWDLRRAQPYDKYDEVD--FDIPVGRH-----GDSFDRYLVRIREMAESLK
NUOD_ERYLH       GPMIRAAGIPWDLRKSQPYDVYDRME--FDIPVGTN-----SDCYDRFSVRVKEVYESAK
NUOD_NOVAD       GPMIRGSGIPWDLRKSQPYDVYDRME--FDIPVGTS-----GDCYDRFMVRVEEVRQSAR
NUOD_SPHAL       GPMIRGSGIAWDLRKSQPYDAYAAME--FDIPVGTR-----GDCYDRFMVRVEEVYQSAK
NUOD_SPHWW       GPMIRAAGIPWDIRKSQPYDVYDRMD--FEIPVGTK-----GDCYDRVMVRIEEVRQSAR
NUOD_ACIAC       GPMLRGSGIAWDLRKKQPYDAYDRVE--FDIPVGKT-----GDCYDRYLVRVQEMRQSNR
NUOD_ACISJ       GPMLRGSGIAWDLRKKQPYDAYDRVD--FDVPVGVT-----GDSYDRYLVRVQEMRESNR
NUOD_DELAS       GPMLRASGVAWDMRKSQPYEVYDRMD--FDVPVGKT-----GDCYDRYLVRVAEMRQSNR
NUOD_LEPCP       GAMIRGSGIAWDLRKTQPYDVYDRMD--FDIPVGVN-----GDTYDRYLVRVEEMRQSNR
NUOD_METPP       GPMLRGSGIAWDLRKTQPYDVYDRVD--FDIPVGAG-----GDCYDRYLVRVEELRQSNR
NUOD_CHRVO       GPMLRGSGIAWDLRKTQPYDVYDKMD--FDVPVGVG-----GDCYDRYLVRVEEMRQSNR
NUOD_RHOFT       GPMLRGSGVAWDLRKKQPYEIYDRLD--FDIPVGKT-----GDCYDRYLVRMEEMKQSNR
NUOD_AZOSB       GPMIRGSGIAWDLRKKQPYEVYDKVD--FDIPVGKN-----GDCYDRYLCRMEEMRQSNR
NUOD_AROAE       GPMLRGSGVAWDLRKKQPYEVYDRMD--FDIPVGKN-----GDCYDRYLCRMEEMRQSNR
NUOD_METFK       GPMLRGSGVAWDLRKKQPYEVYDRLD--FDIPIGVN-----GDCYDRYLVRIEEFRQSNR
NUOD_BORA1       GPMLRGSGVAWDLRKTQPYEVYDLMD--FDVPVGVN-----GDCYDRYLVRVAELRESNR
NUOD_BORPE       GPMLRGSGVAWDLRKTQPYEVYDLMD--FDVPVGVN-----GDCYDRYLVRVAEMRESNR
NUOD_HYDCU       GPMLRGSGIAWDLRKKQPYEVYDKLD--FDIPVGAT-----GDCYDRYLVRVAEMRESNK
NUOD_ACIF5       GPMLRSSGVAWDLRRTQPYAAYADLD--FDIPVGKT-----GDCYDRYLVRVAEMRQSNR
NUOD_NEIG1       GVMLRGSGVEWDVRKTQPYEVYDKMD--FDIPVGVN-----GDCYDRYLCRMEEMRQSVR
NUOD_NEIG2       GVMLRGSGVEWDVRKTQPYEVYDKMD--FDIPVGVN-----GDCYDRYLCRMEEMRQSVR
NUOD_NEIMA       GVMLRGSGVEWDVRKTQPYEVYDKMD--FDIPVGVN-----GDCYDRYLCRMEEMRQSVR
NUOD_NEIMB       GVMLRGSGVEWDVRKTQPYEVYDKMD--FDIPVGVN-----GDCYDRYLCRMEEMRQSVR
NUOD_NEIM0       GVMLRGSGVEWDVRKKQPYEMYDKMD--FDIPVGVN-----GDCYDRYLCRMEEMRQSVR
NUOD_NEIMF       GVMLRGSGVEWDVRKTQPYEVYDKMD--FDIPVGVN-----GDCYDRYLCRMEEMRQSVR
NUOD_XANOR       GPMLRGSGIEWDLRKKQPYAKYDAVD--FDIPVGTN-----GDCYDRYLVRVAEMRESNR
NUOD_XANOM       GPMLRGSGIEWDLRKKQPYAKYDAVD--FDIPVGTN-----GDCYDRYLVRVAEMRESNR
NUOD_XANOP       GPMLRGSGIEWDLRKKQPYAKYDAVD--FDIPVGTN-----GDCYDRYLVRVAEMRESNR
NUOD1_STRM5      GVMLRGSGVAWDLRKKRPYAKYDAVD--FDIPVGTA-----GDCYDRYLCRVAEMRQSNR
NUOD_MAGMM       GPMLRGSGVAFDLRKAEPYDAYDRVE--FDIPVGKN-----GDSYDRYLVRIEECREGVK
NUOD2_RHIME      GPNLRASGVDWDIRRDEPYEIYDRLD--FDVITREE-----GDCYSRWLCRVDEMRESIR
NUOD2_SINMW      GPNLRASGVDWDIRRDEPYEIYDRLD--FDVITREE-----GDCYARWLCRVDEMRESIR
NUOD2_RHIEC      GPNLRASGVDWDIRRDEPYEIYDRLD--FNVITRDE-----GDCYARWRCRVDEMRESMR
NUOD2_RHIE6      GPNLRASGVDWDIRRDEPYEIYDRLD--FNVITRDE-----GDCYARWRCRVDEMRESIG
NDHH_CAPBU       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_NASOF       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_BARVE       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_ARATH       GPMLRASGIPWDLRKIDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_DRANE       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_ARAHI       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_OLIPU       GPMLRASGIPWDLRKVDRYESYDEFE--WDIQWQKQ-----GDSLARYLVRLNEMTESIK
NDHH_LEPVR       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_CRUWA       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_LOBMA       GPMLRASGIPWDLRKVDRYESYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_AETCO       GPMLRASGIQWDLRKVDRYECYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_AETGR       GPMLRASGIQWDLRKVDRYECYDEFE--WEIQWQKQ-----GDSLARYLVRLSEMTESIK
NDHH_SOYBN       GPMLRASGIQWDLRKVDNYECYEEFD--WEVQWQKE-----GDSLARYLVRIGEMMESIK
NDHH_PHAVU       GPMLRASGIQWDLRKVDNYECYEEFH--WEVQWQKE-----GDSLARYLVRIGEMVESIK
NDHH_LOTJA       GPMLRASGIQWDLRQVDNYECYEEFD--WEVQWQKE-----GDSLARYLVRIGEMMESIK
NDHH_CICAR       GPMLRASGIQWDLRKVDNYECYEEFD--WEVQWQKE-----GDSLARYLVRIGEMMESIK
NDHH_CUCSA       GPMLRASGIPWDLRKVDRYECYDEFD--WEVQWQKE-----GDSLARYLVRLAEMTESVK
NDHH_MORIN       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRIGEMTESIK
NDHH_OENEH       GPMLRASGIEWDLRKVDRYECYGELD--WEIRWQKE-----GDSLARYLVRMSEMTESIK
NDHH_OENBI       GPMLRASGIEWDLRKVDRYECYGELD--WEIRWQKE-----GDSLARYLVRMSEMTESIK
NDHH_OENGL       GPMLRASGIEWDLRKVDRYECYGELD--WEIRWQKE-----GDSLARYLVRMSEMTESIK
NDHH_OENAR       GPMLRASGIEWDLRKVDRYECYGELD--WEIRWQKE-----GDSLARYLVRMSEMTESIK
NDHH_OENPA       GPMLRASGIEWDLRKVDRYECYGELD--WEIRWQKE-----GDSLARYLVRMSEMTESIK
NDHH_EUCGG       GPMLRASGIQWDLRKVDHYECYDELD--WEIFWQKE-----GDSLARYLVRIGEMRESIK
NDHH_GOSBA       GPMLRASGIKWDLRKVDHYECYDEFD--WEIQWQKE-----GDSLARYLVRISEMTESIK
NDHH_GOSHI       GPMLRASGIKWDLRKVDHYECYDEFD--WEIQWQKE-----GDSLARYLVRISEMTESIK
NDHH_CITSI       GPMLRASGIEWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRIGEMTESVK
NDHH_CARPA       GPMLRASGIEWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_IPOPU       GPMLRASGIEWDLRKIDQYECYDEFA--WEVQWQKE-----GDSLARYLVRIGEMEESIK
NDHH_PELHO       GPMLRASGMQWDLRKIDNSECYKKFD--WEVQWQKE-----GDSLARYLVRIGEMRESIK
NDHH_POPAL       GPMLRASGVRWDLRKVDHYECYDEFD--WGVQWQKE-----GDSLARYLVRIGEMTESVK
NDHH_POPTR       GPMLRASGVRWDLRKVDHYECYDEFD--WGVQWQKE-----GDSLARYLVRIGEMTESVK
NDHH_MANES       GPMLRASGVQWDLRKVDHYECYDEFD--WEIQWQKE-----GDSLARYLVRIGEMLESIK
NDHH_SOLLC       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRIGEMTESIK
NDHH_SOLBU       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRIGEMTESIK
NDHH_SOLTU       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRIGEMTESIK
NDHH_TOBAC       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRIGEMTESIK
NDHH_NICSY       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRIGEMTESIK
NDHH_ATRBE       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRIGEMTESIK
NDHH_NICTO       GPMLRASGIEWDLRKVDHYESYDEFD--WQVQWQRE-----GDSLARYLVRISEMTESIK
NDHH_COFAR       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQNE-----GDSLARYLVRIREMTESIK
NDHH_JASNU       GPMLRASGIQWDLRKMDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_SPIOL       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLIRIGEMAESVK
NDHH_VITVI       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLSRYLVRIGEMVASIK
NDHH_DAUCA       GPMLRASGIQWDLRKVDHYESYDEFD--WGVQWQKE-----GDSLARYLVRISEMTESVK
NDHH_PANGI       GPMLRASGIQWDLRKVDHYESYDEFD--WGVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_FAGEA       GPMLRASGIQWDLRKIDHYESYEEFD--WEVQWQKE-----GDSLARYLTRIGEMAESIK
NDHH_GUIAB       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_HELAN       GPMLRASGIEWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_LACSA       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQNE-----GDSLARYLVRISEMTESIK
NDHH_PLAOC       GPMLRASGIQWDLRKVDHYGCYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESVK
NDHH_NANDO       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRINEMTESIK
NDHH_RANMC       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_BUXMI       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_AMBTC       GPMLRASGIPWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMIESVK
NDHH_DIOEL       GPMLRASGIPWDLRKVDHYECYNEFD--WEVQWQKE-----GDSLARYLVRIGEMTESIK
NDHH_ILLOL       GPMLRASGIQWDLRKVDHYECYDELD--WEVQWQKE-----GDSLARYLVRIGEMTESIK
NDHH_CHLSC       GPMLRASGIRWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_CALFG       GPMLRASGIQWDLRKVDHYECYDEFD--WQVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_DRIGR       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMTESIK
NDHH_CERDE       GPMLRASGIPWDLRKVDHYESYDEFD--WEIQWQKE-----GDSLARYLVRINEMIESIK
NDHH_LIRTU       GPMLRASGIQWDLRKIDHYECYDEFD--WEVQWQKE-----GDSLARYLVRISEMAESIK
NDHH_NUPAD       GPMLRASGIQWDLRKVDRYECYDEFD--WEVQWQKE-----GDSLARYLVRIGEMTESIK
NDHH_NYMAL       GPMLRASGIQWDLRKVDRYECYDEFD--WEVQWQKE-----GDSLARYLVRIGEMTESIK
NDHH_PIPCE       GPMLRASGIQWDLRKVDRYECYDEFN--WEVQWQKE-----GDSLSRYLVRIGEMTESIK
NDHH_ACOAM       GPMLRASGIEWDLRKVDNYECYNEFD--WEVQWQKE-----GDSLARYLVRISEMKESIK
NDHH_ACOCL       GPMLRASGIEWDLRKVDNYECYNEFD--WEVQWQKE-----GDSLARYLVRISEMKESIK
NDHH_HORVU       GPMLRASGIQWDLRKVDPYESYNQFD--WKVQWQKE-----GDSLARYLVRVGEMSESIK
NDHH_WHEAT       GPMLRASGIQWDLRKVDPYESYNQFD--WKVQWQKE-----GDSLARYLVRVGEMRESIK
NDHH_BRADI       GPMLRASGIRWDLRKVDLYESYNQFG--WKVQWQKE-----GDSLARYLVRIGEMRESIK
NDHH_ORYNI       GPMLRASGIQWDLRKVDLYESYNQFD--WKVQWQKE-----GDSLARYLVRIGEMRESIK
NDHH_ORYSA       GPMLRASGIQWDLRKVDLYESYNQFD--WKVQWQKE-----GDSLARYLVRIGEMRESIK
NDHH_ORYSI       GPMLRASGIQWDLRKVDLYESYNQFD--WKVQWQKE-----GDSLARYLVRIGEMRESIK
NDHH_ORYSJ       GPMLRASGIQWDLRKVDLYESYNQFD--WKVQWQKE-----GDSLARYLVRIGEMRESIK
NDHH_LOLPR       GPMLRASGIQWDLRKVDLYESYNQFD--WKVQWQKE-----GDSLARYLVRISEMRESIK
NDHH_AGRST       GPMLRASGIQWDLRKVDPYECYNQFD--WKVQWQKE-----GDSLARYLVRVSEMRESIK
NDHH_SACHY       GPMLRASGIQWDLRKIDPYESYNQFD--WKVQWQKE-----GDSLARYLVRVGEMRESIK
NDHH_SACOF       GPMLRASGIQWDLRKIDPYESYNQFD--WKVQWQKE-----GDSLARYLVRVGEMRESIK
NDHH_SORBI       GPMLRASGIQWDLRKIDPYESYNQFD--WKVQWQKE-----GDSLARYLVRVGEMRESIK
NDHH_MAIZE       GPMLRASGIQWDLRKIDPYESYNQFD--WKVQWQKE-----GDSLARYLVRVGEMRESIK
NDHH_LEMMI       GPMLRASGISWDLRKVDQYECYNEFD--WEVQWQKE-----GDSLARYLVRMSEMRESIK
NDHH_CRYJA       GPMLRASGIQWDLRKVDHYECYDELD--WEIQWQKE-----GDSLARYLLRIGEMKESIK
NDHH_CYCTA       GPMLRASGIQWDLRKVDHYECYDEFD--WEVQWQKE-----GDSLARYLVRIGEMTESIK
NDHH_ANTAG       GLMLRASGVQWDLRKVDHYECYDELD--WQVQSQTE-----GDSLARYLVRIGEMRESVK
NDHH_ANGEV       GPMLRASGVRWDLRKVDHYECYDELD--WQIQWQKE-----GDSLARYLVRIGEMRESVR
NDHH_MARPO       GPMLRASGVQWDLRKVDHYECYDELD--WKIQWQKE-----GDSLARYLVRIGEMKESVK
NDHH_PHYPA       GPMLRASGVQWDLRKVDHYECYDELD--WQIQWQKE-----GDSLARYLVRIGEMKESIK
NDHH_HUPLU       GPMLRASGVQWDLRKVDHYECYDESD--WQIQRQEE-----GDSLARYSVRIGETKESVK
NDHH_ADICA       GPSLRASGVQWDLRKIDHYECYDKLD--WQIQWQGE-----GDSLARYLVRIDEMKESIN
NDHH_PSINU       GPMLRASGVQWDLRKVDHYECYDEVD--WQIQWQKE-----GDSLARYLVRIGEMRESVK
NDHH_CHAGL       GAMLRGSGVQWDLRKVDHYECYDELD--WSIQWQSD-----GDCLARYLVRMGEMRESIK
NDHH_CHAVU       GPMLRASGMEWDLRKVDHYECYDELD--WSVQWEKR-----GDCLARYIVRVGEMRESVK
NDHH_STAPU       GPMLRASGVQWDLRKVDHYECYDEFD--WQVEWQTE-----GDCLARYLVRIGEMRESTK
NDHH_ZYGCR       GPMLRASGVQWDLRKVDRYECYHELD--WQVEWQSG-----GDCFARYLVRIGEMRESVT
NDHH_MESVI       GPMLRASGVQWDLRKVDNYECYGELD--WNVQWQSD-----GDCLARYLVRLGEMRESTK
NDHH_CHLAT       GPMLRASGVKWDLRKVDNYECYDELD--WSIQWQSD-----GDCLARYQVRIGEMRESIK
NDHH_NEPOL       GPMLRASGVSWDLRKVDRYECYEDFH--WSVESEET-----GDCLARYLVRIREMRTSTK
NDHH1_GLOVI      GPMLRASGVNWDLRKVDHYEIYDELD--WNVAWDTG-----GDTLARYVVRIQEMRESVK
NDHH_NOSS1       GPMLRASGVKWDLRKVDHYECYDDFD--WDVQWETA-----GDCLARYTVRMREMRESVK
NDHH_THEEB       GPMLRASGVKWDLRKVDHYECYDDFD--WDVPVATE-----GDCLARYIVRIQEMRESVK
NDHH_SYNY3       GPMLRGSGVKWDLRKVDHYECYDELD--WEVQYETA-----GDCFARYLVRIREMRESVK
NUOD_AMOA5       GPILRASGLRLDLRRIDGYSIYPELS--FDIPIGEGLMGHVGDCWDRTWVKFQECKESIK
NUOD1_CYTH3      GPMLRASGLKFDLRKVDAYSVYPEID--FDIPVGTGAVGTTGDCWDRTHVRVAECFESVK
NUOD_CHLP8       GPMLRGSGVKWDLRRNDPYSVYPELD--FEVPVPDGKFSDVGDCLSRHLVRALEMEESLK
NUOD_CHLTE       GPMLRGSGVKWDLRRNDPYSVYPELD--FDVPVPDGKFSVVGDCLSRHLVRALEMEESLK
NUOD_CHLL2       GPMLRGSGVQWDLRRNDPYSVYPELD--FNIPVPDGKFSDIGDCLSRHLVRALEMEESLN
NUOD_CHLPD       GPMLRGSGVQWDLRRNDPYSVYPELD--FKVPIPDGKFSDVGDCLSRHLVRALEMDESLS
NUOD_PELLD       GPMLRGSGVQWDLRRNDPYSIYPELD--FAVPVPDGKFSDVGDCLSRHLVRALEIEESLK
NUOD_CHLPM       GPMLRGSGVQWDIRRNDPYSIYPELD--FAVPVPDGKLSVVGDCLSRHLVRALEIEESLK
NUOD_PELPB       GPMLRGSGVKWDLRRNDPYSVYPELD--FSVPVPDGKVSVVGDCLSRHLVRAYEMDESLK
NUOD_CHLCH       GPMLRGSGVEWDLRRNDPYSLYSELD--FNVCVPDGKHSVIGDCLSRHLVRAYEMEESLN
NUOD_CHLPB       GPMLRGSGVEWDLRRVDGYSVYPELD--FKVCVPDGKFSDIGDSLSRHVVRALEIEESLN
NUOD_PROA2       GPMLRGSGVEWDLRKHDPYSIYPELD--FKVCVPDGKHSDIGDSLSRHLVRAYEMVESLS
NUOD2_CHLT3      GPMLRGSGVKWDLRRDDPYSIYPELE--FDVAVPDGKASVIGDCLSRHLVRAIEIDESLK
NUOD2_ANADE      GPNLRGSGVDWDVRRDLPYGAYPNFK--FDVPVGKGFFGTAGDSFDRYYVRCLEMAESSK
NUOD1_ANASK      GPNLRGSGVDWDVRRDLPYGAYPNFK--FDVPVGKGFFGTSGDSFDRYYVRCLEMAESSK
NUOD1_ANADF      GPNLRGSGVDWDIRRDLPYGAYPNFQ--FEVPVGKGWAGTVGDCFDRYYVRCLEMKESSR
NUOD2_SORC5      GPNLRGSGVKWDLRKEDAYSVYPELE--FDVPVGRGRYGTVGDCWDRFYVRVEECRESAK
NUOD_BACAN       GANLRCTGVNWDLRKDEPYSIYDRFD--FDIPVGSV-----GDAWDRYVCRMQEIEESLK
NUOD_BACCR       GANLRCTGVNWDLRKDEPYSIYDRFD--FDIPVGSV-----GDAWDRYVCRMQEIEESLK
NUOD_BACAH       GANLRCTGVNWDLRKDEPYSIYNRFD--FDIPVGSV-----GDAWDRYVCRMQEIEESLK
NUOD_BACCZ       GANLRCTGVNWDLRKDEPYSIYDRFD--FHIPVGSV-----GDAWDRYVCRMQEIEESLK
NUOD_BACHK       GANLRCTGVNWDLRKDEPYSIYDRFD--FHIPVGSV-----GDAWDRYVCRMQEIEESLK
NUOD_BACC1       GANLRCTGVNWDLRKDEPYSIYDRFD--FDIPVGSV-----GDAWDRYVCRMKEIEESLK
NUOD_BACMK       GANLRCTGVHWDLRKDEPYSIYDRFD--FDVPVGST-----GDAWDRYVCRMKEIEESLK
NUOD_BACCN       GANLRCTGVKWDIRKDEPYSIYNQFD--FDVPVGEV-----GDAWDRYMCRMAEIEESLK
NUOD_GEOKA       GVNLRSTGVKWDLRKDEPYSIYDRFD--FDVPVREG-----GDCLARYECRMAEIEQSLR
NUOD_GEOTN       GVNLRSTGVKWDLRKDEPYSVYDRFD--FDVPVREG-----GDCLARYECRMAEIEQSLR
NUOD_DESPS       GPVARGSGINFDVRKNEPYSVYNEFD--FDIPVYHE-----GDSYARYMVRMDEMEQSLR
NUOD2_OPITP      GPVIRGSGVAYDVRRAEPYSVYPKLQ--FKIPTYPE-----CDSMARYLVRMDEMEESLN
NUOD_SYNFM       GPNLRACGIAFDTRKAEPYEVYDQFD--FEIPVGSD-----GDALDRYRVRFEEMEQSLR
NUOD2_SALAI      GPVARASGLDLDLRRDEPYLAYDQLE--VPVVTRTA-----GDCHSRFEVLLDQVYVSLD
NUOD2_SALTO      GPVARASGLDLDLRRDEPYLAYDQLD--VPVVTRTA-----GDCHSRFEVLLDQVYVSLD
NUOD2_STRAW      GPIARGSGVDFDLRRDEPYLAYGELQDTLKVVTRQE-----GDCLARFECLLEQTHNALD
NUOD1_STRCO      GPVARASGVDFDLRRDEPYLAYGELQDTLKVVTRTD-----GDCLARFECLLAQTHNALD
NUOD2_STRGG      GPIARASGVDFDLRRDEPYLAYGELRDTLKVVTRTE-----GDCLARFECLLEQTLNSLD
NUOD_RUBXD       GPPLRCTGVAFDVRRDYPYSVYPELD--FEVVTDTA-----GDVEASYRVRIKEVYESIK
NUOD_DESHY       GPALRASGVQYDVRKAEPYGIYDRFD--FEVPVLYG-----CDTYDRNLIRFMEMNESLK
NUOD_HELMI       GGVLRASGVDYDVRKADPYGIYDRFD--FKVPLGTK-----GDNWDRFMVRMEEMEQSAR
NUOD_CARHZ       GVNLRASGYKFDLRKNRPYSVYDRFE--FDIPTGAN-----GDCWDRFYLRLAEIRQSVK
NUOD2_SYMTH      GAVLRGSGVKWDLRKNLPYAIYDRFE--FDIPVGQN-----GDSFDRWWVRQEEMYQSSR
NUOD_CAMJE       GVMLRGSGIKYDIRKEEPYLLYNEVE--FGVPYATQ-----GDSYARYKVYMQEFRESLK
NUOD2_ROSCS      GPVLRASGIPYDVRRAEPYSVYGDLD--FDIPIGSV-----GDVYDRFLIRIEEMRQSYR
NUOD1_ROSS1      GPVLRASGIPYDVRRAEPYSVYDELD--FDIPIGSV-----GDVYDRFLIRIEEMRQSYR
NUOD2_HERA2      GPVLRGSGVAYDIRKAEPYAVYDRFK--FKVPVGTV-----GDVYDRFLVRIAEMRESYK
NQO4_THET8       GGSLRASGVNYDVRKAYPYSGYETYT--FDVPLGER-----GDVFDRMLVRIREMRESVK
NUOD_THET2       GGSLRASGVNYDVRKAYPYSGYETYT--FDVPLGER-----GDVFDRMLVRIREMRESVK
NUOD_DEIRA       GPNLRASGVPLDNRKDHPYCGFEDYD--FNVISSPD-----GDSLARFNMRLLEFSESIK
NUOD_DEIGD       GPNLRASGVPLDHRKANPYCGYETYD--FEVPVSQA-----GDSLARFQLRLLELRESAK
NUOD2_KORVE      GPTLRGSGIDFDLRRDMPYSGYDKFK--FNVPVKTE-----GDVYARYQCRIAELRESCK
NUOD1_SOLUE      GPMLRAAGLKIDARKDAPYSSYEKFD--FEVPTSTD-----NDVFARYQVRVEEMRQSTK
NUOD1_ROSCS      GPGLRATGVAWDLRKTMPYCGYETYS--FAVPTATH-----GDIYDRYLVRMAEMRESVS
NUOD2_ROSS1      GPGLRATGVAWDLRKTMPYCGYETYS--FAIPTATH-----GDIYDRYLVRMAEMRESVS
NUOD2_CHLAA      GANLRATGVAYDVRKAMPYSGYETYS--FEIPVGKN-----GDIYDRYRVRIAEMRQSVK
NUOD1_HERA2      GANLRASGVDWDLRKTMPYSGYETYQ--FDVPVGQA-----GDIYDRYRCRVQEMRESVK
NUOD_GEOMG       GPALRGSGVDWDLRRDNPYSGYEKYQ--FKVPVGEK-----CDTFDRYKVRLVEMREAVN
NUOD_GEOSL       GPALRGSGVDWDLRRDNPYSGYEKYS--FKVPVGEK-----CDTFDRYKVRLIEMREAVN
NUOD_GEOBB       GPALRGSGVDFDLRRDLPYSGYEKYD--FKVPVGEN-----CDTFDRYKVRLVEMREAVK
NUOD_GEOUR       GPALRGSGVDWDLRRDNPYSGYEKYD--FKVPVGEN-----CDTFDRYKVRLVEMRESVK
NUOD_GEOLS       GPALRGSGVDFDLRRDIPYAGYENYQ--FKVPTGKN-----CDTFDRYQVRLIEMRESCK
NUOD_MYCBP       GPILRSTGLPHDLRKSEPYCGYQHYE--FDVITDDS-----CDAYGRYMIRVKEMWESMK
NUOD_MYCTA       GPILRSTGLPHDLRKSEPYCGYQHYE--FDVITDDS-----CDAYGRYMIRVKEMWESMK
NUOD_MYCTU       GPILRSTGLPHDLRKSEPYCGYQHYE--FDVITDDS-----CDAYGRYMIRVKEMWESMK
NUOD_MYCBO       GPILRSTGLPHDLRKSEPYCGYQHYE--FDVITDDS-----CDAYGRYMIRVKEMWESMK
NUOD_MYCMM       GPILRSTGLPHDLRKSEPYCGYENYE--FDVITADG-----CDAYGRYMIRVKEMWESIK
NUOD_MYCUA       GPILRSTGLPHDLRKSEPYCGYENYE--FDVITADG-----CDAYGRYMIRVKEMWESIK
NUOD_MYCA1       GPILRATGLPHDLRKSEPYCGYENYE--FDVITADT-----CDAYGRYMIRVKEMWESIK
NUOD_MYCPA       GPILRATGLPHDLRKSEPYCGYENYE--FDVITADT-----CDAYGRYMIRVKEMWESIK
NUOD_MYCGI       GPVLRSTGLPHDLRKSQPYCGYQTYD--FDVITDDR-----CDSYGRYLIRVKEMRESLR
NUOD_MYCVP       GPVLRSTGLPHDLRKAQPYCGYETYD--FDVVTDDQ-----CDSYGRYLIRVKEMHQSIR
NUOD_MYCSJ       GPVLRSTGLPHDLRRAQPYCGYEDYE--FDVITDDG-----CDAYGRYLIRVKEMRESLK
NUOD_MYCSK       GPVLRSTGLPHDLRRAQPYCGYEDYE--FDVITDDG-----CDAYGRYLIRVKEMRESLK
NUOD_MYCSS       GPVLRSTGLPHDLRRAQPYCGYEDYE--FDVITDDG-----CDAYGRYLIRVKEMRESLK
NUOD_MYCS2       GPILRSTGLPHDLRKAQPYCGYENYE--FDVITDDR-----CDSYGRYIIRVKEMHESVK
NUOD_MYCA9       GPVLRATGLAHDLRRAQPYCGYENYD--FDVVTHQD-----CDSYGRYLIRVKEMHESIK
NUOD_NOCFA       GPVLRSAGLPHDLRKSQPYCGYETYE--FDVPTTTG-----CDCYGRYLIRVEEMKESLK
NUOD_RHOJR       GPMLRATGLPHDLRKSQPYCGYENYE--FDVSTDTG-----CDAYGRYLIRVDEMKESLK
NUOD1_STRAW      GPILRSAGLPHDLRKSQPYCGYETYD--FDVPTADT-----CDSYGRFLIRLEEMRQSLR
NUOD2_STRCO      GPVLRSTGLPHDLRKTQPYCGYETYD--FDVPTADT-----CDSYGRFLIRLEEMRQSLR
NUOD1_STRGG      GPVLRSAGLPHDLRKSDPYCGYETYD--FEVPTADT-----CDSYGRFLIRLEEMRQSLR
NUOD_NOCSJ       GPVLRSTGYPWDLRKTQPYCGYETYD--FDVQTWDT-----SDSYGRFRIRLNEMWESLR
NUOD_THEFY       GPILRAAGLPWDLRKAKPYCGYENYE--FDIPVSDG-----ADVYARYRVRMAEIEQSLK
NUOD_FRAAA       GPVLRAAGLPWDLRKTMPYCGYETYE--FDVPTALE-----ADSFARYLVRLEEMGESLK
NUOD_FRACC       GPVLRAAGLPWDLRKTMPYCGYETYE--FDVPTALE-----GDSFARYLVRLEEMGESLK
NUOD_FRASN       GPVLRAAGLPWDLRKTMPYCGYETYE--FDVPTALE-----GDSYARYLVRIEEMGESLK
NUOD1_SALAI      GPVLRSAGLAWDLRKTMPYCGYETYE--FDVPTHTD-----GDVWGRYLVRLAEIRESLK
NUOD1_SALTO      GPVLRSAGLAWDLRKTMPYCGYETYE--FDVPTHTD-----GDVWGRYLVRLAEIRESLK
NUOD_ACIC1       GPIMRAAGYPWDLRKVAPYCGYETYD--FEVPTQTD-----GDCFARYLVRMDEMRESLK
NUOD_SACEN       GPVLRSAGLAWDLRKVQPYCGYEDYE--FEVPTSTG-----ADCYARYLLRLEEMHQSLK
NUOD_CUTAK       GPALRATGLPWDLRKTQPYCDYDTYD--FDVATWDT-----CDCYGRFRIRLEEMDQSVR
NUOD1_SYMTH      GRNLRVTGSDYDVRKYYPYLGYENYD--FKVPVYTD-----GDSWSRVAITFDEMFESLK
NUOD_THEM4       GVGLRATGVPYDIRKVDPYLFYDKVD--FEVPFSTD-----GDAFARVYLKFREIFQSIK
NUOD_PARUW       GPVLRASGISYDIRKAYPYLGYENYN--FDIPTHID-----GDSYARYLVRMEEMLQSIS
NUOD_FLAJ1       GPNLRAAGVDYDVRVAHPYSSYEDFD--FIVPVGKS-----GDTYDRFCVRNAEVWESLS
NUOD_FLAPJ       GPNLRAAGIDYDVRVAEPYSSYEDFE--FIIPVGKS-----GDTYDRFCVRNAEVWESLS
NUOD2_CYTH3      GPNLRAAGVDYDVRVTSPYSSYQDFD--FTIPIGIN-----GDTYDRFMVRNKEMWESLS
NUOD_LEPBA       GPNLRAAGVPWDVRKDDPYMFYDKVN--FDIPVGED-----GSALDRTLVRMEEMRQSMK
NUOD_LEPBP       GPNLRAAGVPWDVRKDDPYMFYDKVN--FDIPVGED-----GSALDRTLVRMEEMRQSMK
NUOD_LEPBJ       GPNLRAAGVDWDVRKDKPYMLYDKVD--FDVPIGED-----GSVLHRSLVRMEEMRQSIR
NUOD_LEPBL       GPNLRAAGVDWDVRKDKPYMLYDKVD--FDVPIGED-----GSVLHRSLVRMEEMRQSIR
NUOD_LEPIN       GPNLRAAGVDWDVRKDEPYLFYDKVD--FDIPIGED-----GSVLHRSLVRMEEMRQSIR
NUOD_LEPIC       GPNLRAAGVDWDVRKDEPYLFYDKVD--FDIPIGED-----GSVLHRSLVRMEEMRQSIR
NUOD1_SORC5      GVVLRATGVPYDVRRANPYMVYDRFE--FDVPVGTR-----GDNYDRFMCRQEEIRQAGR
NUOD_METI4       GPNLRGSGVDHDLRKKNPYLGYEKYD--FEVPLGSV-----GDCFDRYMVRIEEMRQSCR
                 *   *  *   * *       :        :           .          :   .  

NUOD1_RHIME      IMRQCVDRLLGDAKIGPVSSLDGKIVPPK-----------------RGEMKRSMEALIHH
NUOD1_SINMW      IMRQCVDRLLGDAKVGPVSSLDGKIVPPK-----------------RGEMKRSMEALIHH
NUOD1_RHIEC      IMKQCVNRLLSDARTGPFSSIDGKVVPPK-----------------RGEMKRSMEALIHH
NUOD1_RHIE6      IMKQCVNRLLSDAKTGPFSSIDGKVVPPK-----------------RGEMKRSMEALIHH
NUOD_RHIL3       IMKQCVNRLLSDAKTGPFSSIDGKVVPPK-----------------RGEMKRSMEALIHH
NUOD_AGRFC       IMKQCVDRLSGKHRIGPVSSLDGKVVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUAB       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUA2       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUA1       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUC2       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUSI       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUO2       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRUSU       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKCSMEALIHH
NUOD_BRUME       IMRQCVDLLLGKERVGPVSNTDHKIVPPK-----------------RGEMKRSMEALIHH
NUOD_OCHA4       IMRQCVDLLLGKERVGPVSNADNKIVPPK-----------------RGEMKRSMEALIHH
NUOD_CHESB       IMRQCVERLLGKERVGPVSNMDGKVVPPK-----------------RAAMKRSMESLIHH
NUOD_RHILO       IMRQCVDLLLGKESTGPVSNLDGKVVPPK-----------------RAAMKRSMEALIHH
NUOD_AZOC5       IMLQCVDRLLKEA--GPVASTDRKVSPPK-----------------RGEMKRSMEALIHH
NUOD_XANP2       IMKQCVERLLKEA--GPVSTTDNKIVPPK-----------------RGEMKRSMEALIHH
NUOD_BRASB       IMKQCIQKLRAPDGQGPVVVTDNKIAPPR-----------------RGEMKRSMEALIHH
NUOD_BRASO       IMKQCIAKLRAPDGQGPVLITDNKIAPPR-----------------RGEMKRSMEALIHH
NUOD_BRADU       IMRQCIQKLNAPEGKGPVVVEDNKVAPPR-----------------RGEMKRSMEALIHH
NUOD2_NITHX      IMKQCIAKLRAADGQGPVAVEDNKIFPPR-----------------RAEMKRSMEALIHH
NUOD_NITWN       IMKQCIAKLRAPDGQGPVAVEDNKIFPPR-----------------RGEMKRSMEALIHH
NUOD_RHOP5       IMKQCIAKLRAPDGQGPVALEDHKIVPPR-----------------RGEMKRSMEALIHH
NUOD_RHOPB       IMQQCIAKLRAPDGGGPVAVQDNKIFPPR-----------------RGEMKRSMESLIHH
NUOD_RHOPS       IMKQCIAKLRAPDGQGRVAIDDNKIFPPR-----------------RGEMKRSMESLIHH
NUOD_RHOP2       IMKQCIAKMREPAGQGRVAVDDNKIFPPR-----------------RGEMKRSMESLIHH
NUOD_RHOPA       IMKQCIAKLRAPHGQGPVVVDDHKIFPPR-----------------RGEMKRSMEALIHH
NUOD_RHOPT       IMKQCIAKLRAPDGQGPVVVDDHKIFPPR-----------------RGEMKRSMEALIHH
NUOD_METEP       IMRQCVAKLREPAGQGPIASIDGKFAPPP-----------------RREMKRSMEALIHH
NUOD_METPB       IMRQCCAKLREPSGQGPIASIDGKFAPPP-----------------RREMKRSMEALIHH
NUOD_METRJ       IMKQCVAKLREPAGQGPIASVDGKFAPPP-----------------RREMKRSMEALIHH
NUOD_METS4       IMKQCLAKLRAPDGQGPVTTQDGKVAPPS-----------------RREMKRSMEALIHH
NUOD1_BEII9      IMKQCVEKLSQASGKGPVATPQHKVVPPS-----------------RAEMKRSMEALIHH
NUOD2_BEII9      IMKQCLEKLSSVDGKGPIIEQNHKVTPPR-----------------RSEMKRSMEALIQH
NUOD1_NITHX      IMKQCLEKLRLPEGQGPVATRDHKIVPPS-----------------RAEMKRSMEAMIEH
NUOD_PARL1       IMKQCIELMPG----GPVHVLDGKVVPPS-----------------RSEMKRSMEALIHH
NUOD_BARBK       IMRQCVDRLLSTEKDGPVSSLDRKIVPPK-----------------RSEMKNSMEALIHH
NUOD_BARHE       IMRQCVDRLLSTEKNEPVSSLDRKIVPPK-----------------RCEMKSSMEALIHH
NUOD_BART1       IMRQCVERLLGAEKNGPVSSLDRKIVPPK-----------------RSEMKSSMEALIHH
NUOD_BARQU       IMRQCVDRLLGSEKNGPVSSLNRKVVPPK-----------------RSEMKSSMEALIHH
NUOD_CAUVC       IIRQACEMLRK--THGPVLSEDNKVAPPR-----------------RAEMKRSMEALIHH
NUOD_CAUSK       IILQAIEKLRA--TPGPVMTQDNKVAPPR-----------------RAEMKRSMEALIHH
NUOD_PHEZH       IMKQCCERLLK--TSGPVLVDDHKVSPPR-----------------RGEMKRSMEALIHH
NUOD_MARMM       IMIQCCDWLMKDENAGEVLATDSKFSPPR-----------------RAEMKRSMEALIQH
NUOD_RUEPO       IIRQAIAKLRD--CPGDVLAR-GKLTPPK-----------------RGDMKTSMESLIHH
NUOD_RUEST       IIRQAIAKLRE--ATGDVLAR-GKLTPPK-----------------RGDMKTSMESLIHH
NUOD_ROSDO       IILQAIAKLRAPEGQGDVLAR-GKITPPS-----------------RSDMKTSMESLIHH
NUOD_DINSH       IIQQAIVKLRE--TKGDVLAR-GKLTPPS-----------------RADMKTSMEALIHH
NUOD_RHOS4       IIQQCLAKLRVE--KGDVLAR-GKLTPPP-----------------RGEMKTSMEALIHH
NUOD_RHOS1       IIQQCLAKLRVE--KGDVLAR-GKLTPPP-----------------RGEMKTSMEALIHH
NUOD_RHOS5       IIQQCLAKLRVE--KGDVLAR-GKITPPP-----------------RAEMKTSMEALIHH
NUOD_JANSC       IIHQACEKLRNE--PGEIMSR-GKMSPPS-----------------RGDMKTSMEALIHH
NUOD_PARDP       IMQQAVQKLRAE-PAGDVLAR-GKLTPPR-----------------RAEMKRDMESLIHH
NUOD_HYPNA       IILQCIDLMAKDGPGPVLLAG-SKLSPPR-----------------RADMKNSMEALIHH
NUOD_PELUB       IIKQCLSKMEK----GPIKSLDGKISPPP-----------------KKDIKQSMEALIHH
NUOD_RICBR       IIKQCIEKMPQ----GPVKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICB8       IIKQCIEKMPQ----GPVKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICCN       IIKQCIEKMPK----GAIKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICM5       IIKQCIEKMPK----GAVKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICRO       IIKQCIEKMPK----GAIKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICRS       IIKQCIEKMPK----GAIKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICFE       IIKQCIEKMPK----GAVKTDDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICAH       IIKQCIEKMPK----GAVKTNDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICCK       IIKQCIEKMPK----GAVKTNDPKLTPPT-----------------RAKMKESMEAMIHH
NUOD_RICPR       IIKQCIVKMPK----GQVKTDDPKLTPPT-----------------RGKMKESMEAMIHH
NUOD_RICTY       IIKQCIAKMPK----GQVKTDNPKLTPPT-----------------REKMKESMEAMIHH
NUOD_ORITB       IIKQCIQKMPV----GEIKTQDPSISPPK-----------------RSEIKKSMEALINH
NUOD_ORITI       IIKQCIQKMPA----GEIRTQDPSISPPK-----------------RSEIKKSMEALINH
NUOD_ANAMM       IIRQCLNGIPE----GPVKTDDRKIAPPR-----------------REELKYSMEALIHH
NUOD_ANAPZ       ILEQCLRDIPS----GPVKTDDRKIAPPK-----------------REELKYSMEALIHH
NUOD_EHRCJ       LLEQCLDRLPD----GPVKTDDRKIAPPK-----------------RSEMKESMEALIHH
NUOD_EHRCR       LLEQCLNRLPN----GPIKTDDRKIAPPK-----------------RSEMKESMEALIHH
NUOD_EHRRG       LVEQCLNRIPD----GPVKTDDRKIAPPK-----------------RSEMKKSMEALIHH
NUOD_EHRRW       LVEQCLNRIPD----GPVKTDDRKIAPPK-----------------RSEMKKSMEALIHH
NUOD_WOLPP       LVKQCIEKMPE----GPIKTEDRKISPPP-----------------RAEMKESMEAMIHH
NUOD_WOLPM       LVKQCIEKMPE----GQIKTEDRKISPPS-----------------RAEMKKSMEALIHH
NUOD_WOLTR       LVKQCIEKIPE----GPVKTEDRKISPPP-----------------RTEMKRSMEALIHH
NUOD_NEOSM       IIKQCIDKLPE----GPVVVDDRKVAPPS-----------------RAEMKTSMEALIHH
NUOD_MAGSA       IMKQCIAKMPG----GPVRVEDNKITPPK-----------------RSEMKTSMESLIHH
NUOD_RHORT       IMRQCIEKMPD----GPVKAVDHKVTPPS-----------------RGEMKSSMEALIHH
NUOD_GLUDA       IVEQCLAQMKP----GPIKIQDHKITPPP-----------------RREMKRSMEALIHH
NUOD_GRABC       IVKQCLGKIRP----GPIKVQDHKITPPP-----------------RAEMKRSMEALIHH
NUOD_ACICJ       IIRQALKAMPE----GPIKVQDHKITPPK-----------------RAEMKRSMEALIHH
NUOD_ERYLH       IIKQCLAQMPQ----GPIASTDGKVSPPS-----------------RGRMKQSMEALIHH
NUOD_NOVAD       IMKQCIEQMPD----GPVASTDRKVVPPK-----------------RAEMKQSMEALIHH
NUOD_SPHAL       IIKQCLRDMPT----GPIASLDRKVVPPK-----------------RGEMKQSMESLIHH
NUOD_SPHWW       IMKQCLSEMPE----GPIASLDRKVVPPK-----------------RGEMKRSMEALIHH
NUOD_ACIAC       IIKQCVDWLKAN--PGPVITDNHKVAPPS-----------------RESMKSNMEELIHH
NUOD_ACISJ       IIKQCVDWLRAN--PGPVITDNHKIAPPS-----------------REAMKSNMEELIHH
NUOD_DELAS       IIKQCVDWLRAN--PGPVIVDNHKIAPPP-----------------REGMKSNMEELIHH
NUOD_LEPCP       IIEQCSAWLRAN--PGPVITDNHKVAPPS-----------------RVEMKTSMEELIHH
NUOD_METPP       IIQQCAAWLRAN--PGPVITDNHKVAAPG-----------------RVDMKSNMEELIHH
NUOD_CHRVO       IIQQCVAWLRAN--PGPVITDNHKVAPPS-----------------REGMKSNMEDLIHH
NUOD_RHOFT       IIKQCVDWLRVN--PGPVITDNHKIAPPN-----------------RESMKSNMEELIHH
NUOD_AZOSB       IIRQCIDWLRKN--PGPVITDNHKVAPPS-----------------REQMKSNMEELIHH
NUOD_AROAE       IVKQCIDWLRKN--PGPVIADNYKVAPPP-----------------RERMKGNMEELIHH
NUOD_METFK       IIKQCIDWLRKN--PGPVISDNTKVAPPP-----------------REEMKHDMEALIHH
NUOD_BORA1       IIRQCVEWLRNN--PGPVMIENHKIAPPK-----------------REAMKSNMEELIHH
NUOD_BORPE       IIRQCVEWLRNN--PGPVMIENHKIAPPS-----------------RTAMKSNMEELIHH
NUOD_HYDCU       IIKQCVKWLKEN--PGPVISDDHKVTPPS-----------------REDAKSNMEALIHH
NUOD_ACIF5       IIVQCVDWLRKN--PGPVITDDFKIAAPS-----------------REEMKTSMEALIHH
NUOD_NEIG1       IIKQCADWLRVN--PGPVITANHKFAPPK-----------------RTEMKTGMEDLIHH
NUOD_NEIG2       IIKQCADWLRVN--PGPVITANHKFAPPK-----------------RTEMKTGMEDLIHH
NUOD_NEIMA       IIKQCSEWLRVN--PGPVITTNHKFAPPK-----------------RTEMKTGMEDLIHH
NUOD_NEIMB       IIKQCSEWLRVN--PGPVITTNHKFAPPK-----------------RTEMKTGMEDLIHH
NUOD_NEIM0       IIKQCSEWLRVN--PGPVITTNHKFAPPK-----------------RTEMKTGMEDLIHH
NUOD_NEIMF       IIKQCSEWLRVN--PGPVITTNHKFAPPK-----------------RTEMKTGMEDLIHH
NUOD_XANOR       IIKQCVKWLKAN--PGPVMVTNFKVAPPS-----------------REGMKDDMEALIHH
NUOD_XANOM       IIKQCVKWLKAN--PGPVMVTNFKVAPPS-----------------REGMKDDMEALIHH
NUOD_XANOP       IIKQCVKWLKAN--PGPVMVTNFKVAPPS-----------------REGMKDDMEALIHH
NUOD1_STRM5      IIRQCVDWLRAN--PGPVMLHNFKVAPPS-----------------RQEMKSDMEALIHH
NUOD_MAGMM       IIQQCLDQMQ----PGPVRNDNFKISMPY-----------------RQDMQQDMESMIHH
NUOD2_RHIME      LIEQCMEQMPE----GPFQVDIPTIAFPVD----------------KERVHCSMEALIQH
NUOD2_SINMW      LIEQCMEQMPE----GPFQVDIPTIAFPVD----------------KERVHCSMEALIQH
NUOD2_RHIEC      IIEQCIDQMPE----GPFQIDMPTIAFPLD----------------KDRVHCSMEALIQH
NUOD2_RHIE6      IIKQCIDQMPE----GPFQIDMPTIAFPLD----------------KDRVHCSMEALIQH
NDHH_CAPBU       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_NASOF       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_BARVE       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_ARATH       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_DRANE       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_ARAHI       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_OLIPU       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_LEPVR       IIQQALEGLPGGPYENLESRSFD--RKRNPE--------------------WNDFDYRFI
NDHH_CRUWA       IIQQALEGLPGGPYENLESRGFE--RKRNPE--------------------WNDFEYRFI
NDHH_LOBMA       IIQQALEGLPGGPYENLESRGFD--RKRNPE--------------------WNDFEYRFI
NDHH_AETCO       IIQQALEGLPGGPYENLERRGFD--RKMNSEMNSEMN------------SEWNNFDYRFI
NDHH_AETGR       IIQQALEGLPGGPYENLERRDFD--KKLNSEMNSE----------------WNNFDYRFI
NDHH_SOYBN       IIQQALEGIPGGPYENLEIRCFD--REKEPE--------------------WNEFEYRFI
NDHH_PHAVU       IIQQALEGLPGGPYENLEIRCFD--REKEPE--------------------WNEFEYRFI
NDHH_LOTJA       IIQQALEGIPGGPYENLEIRCFG--REKEPE--------------------WNDFEYRFI
NDHH_CICAR       IIQQALEGIPGGPYENLEIRSFD--REKEPE--------------------WNDFEYRFI
NDHH_CUCSA       IIQQALEGIPGGPYENLEIRSFD--RARSPE--------------------WNDFDYRFI
NDHH_MORIN       IIQQALEGIPGGPYENLEIRYFD--RERNPE--------------------WNDFDYRFI
NDHH_OENEH       IIQQALEGIPGGPYENLEIRCFD--REKDPE--------------------WDGFEYRFI
NDHH_OENBI       IIQQALEGIPGGPYENLEIRCFD--REKDPE--------------------WDGFEYRFI
NDHH_OENGL       IIQQALEGIPGGPYENLEIRCFD--REKDPE--------------------WDGFEYRFI
NDHH_OENAR       IIQQALEGIPGGPYENLEIRCFD--IEKDPE--------------------WDGFEYRFI
NDHH_OENPA       IIQQALEGIPGGPYENLEIRCFD--IEKDPE--------------------WDGFEYRFI
NDHH_EUCGG       IIQQALEGIPGGPYENLETRCFA--RERDPE--------------------WNDFEYRFI
NDHH_GOSBA       IIQQALEGIPGGPYENLEIRCFD--RERDPE--------------------WNDFEYRFI
NDHH_GOSHI       IIQQALEGIPGGPYENLEIRCFD--RERDPE--------------------WNDFEYRFI
NDHH_CITSI       IIQQALEGIPGGPYENLEIRCFD--RESDPE--------------------RNDFENRFI
NDHH_CARPA       IIQQALEGIPGGPYENLEIRCFD--RKKDPE--------------------WNDFDYRFI
NDHH_IPOPU       MIQQALEGIPGGPYENLEIRRFD--RVKHPQ--------------------WNDFEYRFI
NDHH_PELHO       MIQQALEGIPGGPYENLEIRCFD--RERYPE--------------------WGGFEYRFI
NDHH_POPAL       IIQQALEGIPGGPYENLETRSFD--RERNRE--------------------WNDFEYRFI
NDHH_POPTR       IIQQALEGIPGGPYENLETRSFD--RERNRE--------------------WNDFEYRFI
NDHH_MANES       IIQQALEGIPGGPYENLETRRFD--RERDSE--------------------WNDFEYRFI
NDHH_SOLLC       IIQQALEGIPGGPYENLEMRRFD--RLKDPE--------------------WNDFEYRFI
NDHH_SOLBU       IIQQALEGIPGGPYENLEMRRFD--RLKDPE--------------------WNDFEYRFI
NDHH_SOLTU       IIQQALEGIPGGPYENLEMRRFD--RLKDPE--------------------WNDFEYRFI
NDHH_TOBAC       IIQQALEGIPGGPYENLEIRRFD--RLKDPE--------------------WNDFEYRFI
NDHH_NICSY       IIQQALEGIPGGPYENLEIRRFD--RLKDPE--------------------WNDFEYRFI
NDHH_ATRBE       IIQQALEGIPGGPYENLEIRRFD--RLKDPE--------------------WNDFEYRFI
NDHH_NICTO       IIQQALEGIPGGPYENLEIRRFD--RLKDPE--------------------WNAFEYRFI
NDHH_COFAR       IIQQALEGIPGGPYENLEIRRFDIDRVKDPE--------------------WNDFEYRFI
NDHH_JASNU       IIQQALERIPGGPFENLEIRRFD--RIKDTE--------------------WNDFEYRFI
NDHH_SPIOL       IIQQALEGIPGGPYENLEIRRFN--RIKYPE--------------------WNDFEYRFI
NDHH_VITVI       IIQQALEGIPGGPYENLEIRCFD--RARDPE--------------------LNDFEYRFI
NDHH_DAUCA       IIQQALEGITGGPYENLEIRRFD--KVWDPE--------------------WNDFDYRFI
NDHH_PANGI       IIQQALEGIPGGPYENLEIRRFD--KVRDPE--------------------WNDFDYRFI
NDHH_FAGEA       IIQQALEGIPGGPYENLEIRRCN--KVRDPE--------------------WNNFEYRFI
NDHH_GUIAB       IIQQALEGIPGGPYENLEIRRFD--RVKDTV--------------------WNEFDYRFI
NDHH_HELAN       IIQQALEGIPGGPYENLEIRRFD--RVKDTV--------------------WNEFDYRFI
NDHH_LACSA       IIQQALEGIPGGPYENLEIRRFD--RVKDTV--------------------WNEFDYRFI
NDHH_PLAOC       IIQQALEGIPGGPYENLEVRRFD--RARDSE--------------------WNDFEYRFI
NDHH_NANDO       IIQQALERIPGGPYENLEVRRFD--RTRDSE--------------------WNDFDYRFI
NDHH_RANMC       ILQQALEGIPGGPYENLEVRRFD--RAKDSE--------------------WNDFDYRFI
NDHH_BUXMI       IIQQALEGIPGGPYENLEVRRLD--RTKDSE--------------------WNDFEYRFI
NDHH_AMBTC       IIQQALEGIPGGPYENLEARRFD--RVRNIE--------------------WNDFEYRFI
NDHH_DIOEL       IIQQAIEGIPGGPYENLEVRRFDFDGATNSE--------------------WNDLEYGFI
NDHH_ILLOL       IIQQALEGIPGGPYENLEVRRFD--RARDSE--------------------WNYFEYRFI
NDHH_CHLSC       IIQQALEGIPGGPYENLEVRRFD--RARDAE--------------------WNDFDYRFI
NDHH_CALFG       ILQQALEGIPGGPYENLEGRRFD--RESDSE--------------------WNDFDYRFI
NDHH_DRIGR       ILQQALEGIPGGPYENLEVRRFD--RAKDSE--------------------WNDFEYRFI
NDHH_CERDE       IIQQVLEGIPGGPYENLEVRRFA--RPKDSE--------------------WNDFEYRFI
NDHH_LIRTU       IIQQVLEGIPGGPYENLEVRRFD--KARDSE--------------------WNDFEYRFI
NDHH_NUPAD       IIQQALEGIPGGPYENLEFRRFA--GTKDSE--------------------LNDFEYRFI
NDHH_NYMAL       IIQQALEGIPGGPYENLEFRRFA--GTKDSE--------------------LNDFEYRFI
NDHH_PIPCE       IIQQALEGIPGGPYENLEVRRFD--KTKDSE--------------------WNDFEYRFI
NDHH_ACOAM       IIQQALEGIPGGPYENLEVRRFD--KVKDSE--------------------WNDFEYRFI
NDHH_ACOCL       IIQQALEGIPGGPYENLEVRRFD--KVKDSE--------------------WNDFEYRFI
NDHH_HORVU       IIQQAIEKIPGGPYENLEVRRFK--KEKNSE--------------------WNDFEYKFL
NDHH_WHEAT       IIQQAVEKIPGGPYENLEVRRFK--KEKNSE--------------------WNDFEYKFL
NDHH_BRADI       IIQQAVEKIPGGPYENLEVRRFK--KEKNSE--------------------WNDFEYRFL
NDHH_ORYNI       IIQQAVEKIPGGPYENLEVRRFK--KAKNSE--------------------WNDFEYRFL
NDHH_ORYSA       IIQQAVEKIPGGPYENLEVRRFK--KAKNSE--------------------WNDFEYRFL
NDHH_ORYSI       IIQQAVEKIPGGPYENLEVRRFK--KAKNSE--------------------WNDFEYRFL
NDHH_ORYSJ       IIQQAVEKIPGGPYENLEVRRFK--KAKNSE--------------------WNDFEYRFL
NDHH_LOLPR       IIQQAIEKIPGGPYENLEVRRFK--KAKTSE--------------------WNDFEYKFL
NDHH_AGRST       IIQQAVEKIPGGPYENLEVRRFK--KAKNSE--------------------WNDFEYRFL
NDHH_SACHY       IIQQAVEKIPGGPYENLEARRFK--KAKNPE--------------------WNDFEYRFL
NDHH_SACOF       IIQQAVEKIPGGPYENLEARRFK--KAKNPE--------------------WNDFEYRFL
NDHH_SORBI       IIQQAVEKIPGGPYENLEARRFK--KAKNPE--------------------WNDFEYRFL
NDHH_MAIZE       IIQQAVEKIPGGPYENLEARRFK--KAKNPE--------------------WNDFEYRFL
NDHH_LEMMI       IIQQALEGIPGGPYENLEVRRFD--KTKDSE--------------------WNDFEYRFI
NDHH_CRYJA       IIRQALEVIPGGPYENLEVRRLN--KGKDSQ--------------------WNDFESRFI
NDHH_CYCTA       IIRQALKIIPGGPYENLEARRLD--KGKDSE--------------------WNDFEFRFI
NDHH_ANTAG       IIQQALKVIPGGPYENLEARRLN--QGKDSE--------------------WNDFEYQFI
NDHH_ANGEV       IIQQALKVIPGGPYENLEARRLN--QQKDSE--------------------WNDFDYQFI
NDHH_MARPO       IIQQALKAIPGGPFENLEARRLN--QGKNSE--------------------WNLFEYQFI
NDHH_PHYPA       IIQQALKSIPGGPYENLEARRLQ--RGKKSE--------------------WNNFEYQFI
NDHH_HUPLU       IVQQALKVIPGGPYENLEARRLN--RGKNSE--------------------WNDFEYQFI
NDHH_ADICA       ILRQALKLLPGGPYENLEGRRLV---QKKDK------------------IDWNGFNYQFV
NDHH_PSINU       ILQQALRIIPGGPYENLEARRLH---QSQN-------------------LEWNDFDYQFM
NDHH_CHAGL       IIQQALKAIPGGPYENLEARRLNE--GPKSE--------------------WNDFEYQFI
NDHH_CHAVU       IIQQALKAIPGGPYENLEARKLNT--KKSTQ--------------------WNDFEYQFI
NDHH_STAPU       IIQQALKSIPGGPYENLEARRIGLIGTDSAQ--------------------WNDFEYQFI
NDHH_ZYGCR       IIQQALKAIPGGPYENLEARRMASMAQKNSQ--------------------WNDFEYQFV
NDHH_MESVI       IIQQALKAIPGGPYENLEARRLS--KGRKSE--------------------WNNFEYQFV
NDHH_CHLAT       IIQQALKAIPGGPYENLEARRLS--KGRKSE--------------------WNNFEYQFI
NDHH_NEPOL       IVQQALKSIPGGPTENLEARQLS--QGRTSP--------------------WNEFDYQFL
NDHH1_GLOVI      MIRQALDQLPGGPYENLEAQRLS--GGPKSE--------------------WNGFDYQFI
NDHH_NOSS1       IIKQAIKGLPGGPYENLEAKRLA--AGKKSE--------------------WDAFDYQYI
NDHH_THEEB       IIRQALDGLPGGPYENLEAKRML--EGAKSE--------------------WNGFDYQYI
NDHH_SYNY3       IIRQALKAMPGGPYENLEAKRLQ--EGKKSE--------------------WNDFQYQYI
NUOD_AMOA5       ITEQCLVRLTSDLKRTAD---------------------------------------FNP
NUOD1_CYTH3      IIEQCLEKLLGEHKRTRE---------------------------------------FDP
NUOD_CHLP8       IIEQCLDKMPE----EQG---------------------------------------FDP
NUOD_CHLTE       IIEQCLDKMPE----EPN---------------------------------------FNS
NUOD_CHLL2       IIEQCISKMPG----SDG---------------------------------------FNP
NUOD_CHLPD       IIEQCIDKMPG----SEG---------------------------------------FNP
NUOD_PELLD       IIEQCIEKMPS----AEG---------------------------------------FDP
NUOD_CHLPM       IIEQCIDKMPG----TQG---------------------------------------FDP
NUOD_PELPB       IIEQCIDKMPT----AEG---------------------------------------FNP
NUOD_CHLCH       IIEQCIDKMPS----SDG---------------------------------------FNS
NUOD_CHLPB       IIEQCLDKMPE----EEG---------------------------------------FDP
NUOD_PROA2       MIEQCLDKMPD----ANG---------------------------------------FDP
NUOD2_CHLT3      MIEQCIDMMPK----DPN---------------------------------------FDP
NUOD2_ANADE      IVRQALDSLPE----------------------------------------------GEI
NUOD1_ANASK      IVRQALDSLPE----------------------------------------------GEI
NUOD1_ANADF      IVRQALETIGQT----P----------------------------------------EDI
NUOD2_SORC5      ILRQALDKIDEH----PE---------------------------------------DDI
NUOD_BACAN       IVEQAVQQFPKEG---------------------------------------------AV
NUOD_BACCR       IVEQAVQQFPKDG---------------------------------------------AV
NUOD_BACAH       IVEQAVQQFPKEG---------------------------------------------AV
NUOD_BACCZ       IVEQAVQQFPKEG---------------------------------------------AV
NUOD_BACHK       IVEQAVQQFPKEG---------------------------------------------AV
NUOD_BACC1       IVEQAVQQFPKEG---------------------------------------------AV
NUOD_BACMK       IIEQAVEQFPKDG---------------------------------------------AV
NUOD_BACCN       IIEQAAEQFPKEG---------------------------------------------SV
NUOD_GEOKA       IIEQACEQFPPEG---------------------------------------------PI
NUOD_GEOTN       IIEQACEQFPADG---------------------------------------------PI
NUOD_DESPS       IIEQAMDKLPGGP---------------------------------------------II
NUOD2_OPITP      IIEQCLDLIQPGP---------------------------------------------FM
NUOD_SYNFM       IIEQALDRLPGGP---------------------------------------------FM
NUOD2_SALAI      LAEQCLDQVDRLT--------------------------------------------GPV
NUOD2_SALTO      LAEQCLDRVDRLT--------------------------------------------GPI
NUOD2_STRAW      LADACLDRLAELPP-------------------------------------------GPI
NUOD1_STRCO      LADACLDRLAELAP-------------------------------------------GPV
NUOD2_STRGG      LADACLDRMAHLAP-------------------------------------------GPI
NUOD_RUBXD       IIRQCLEKMPEGE----------------------------------------------V
NUOD_DESHY       IIRQAVRDIPE--G-------------------------------------------PIM
NUOD_HELMI       IIEQALDQLPE--G-------------------------------------------PIM
NUOD_CARHZ       IIEQALEMIPE--G-------------------------------------------PIM
NUOD2_SYMTH      IVKQCLEWLAENPG-------------------------------------------PVM
NUOD_CAMJE       ILRQCAMLYKDTSPEILATHPEYVSASKEQIL-------------------TQNYSLMQH
NUOD2_ROSCS      ILQQVIERLPDTTGGHINPAMAN-------------------------------------
NUOD1_ROSS1      ILQQVIERLPDTTGGHINPAMAN-------------------------------------
NUOD2_HERA2      ILEQAIEQLPDATGGFINPKV---------------------------------------
NQO4_THET8       IIKQALERLEP---GPVRDPNPQITPPPRHLLET------------------SMEAVIYH
NUOD_THET2       IIKQALERLEP---GPVRDPNPQITPPPRHLLET------------------SMEAVIYH
NUOD_DEIRA       IIRQGLQKLRP---GPIKDPNRKISLPPRHELET------------------SMEAVIHH
NUOD_DEIGD       IIRQALKRLTP---GPIKDPNRKISLPPRSELET------------------SMEAVIHH
NUOD2_KORVE      IVQQALAGMPE---GSIKADAPKVVLPDREKMKT------------------QMESLIYH
NUOD1_SOLUE      IVRQAMEGMPA---GAWKADAPHVVLPDREKMKT------------------QMEALIFH
NUOD1_ROSCS      ICRQALQRLRDIGPGPYMTLDRKIAPPPKSEITQ------------------SMEALIHH
NUOD2_ROSS1      ICRQALQRLRDIGPGPYMTSDRKIAPPPKSEITQ------------------SMEALIHH
NUOD2_CHLAA      IVQQATERLRELGPGPVVTSNRKVAPPPKREITE------------------SMESLIHH
NUOD1_HERA2      IARQAIERVKQMHGQPYVTENRKVAPPPKSEITY------------------SMESLIHH
NUOD_GEOMG       IIRQALDSLKP---GPVLADAPQVTYPPKENVYN------------------TIEGLIHH
NUOD_GEOSL       IIRQALDSLKP---GPVLADNPQVTYPPKENVYN------------------SIEGLIHH
NUOD_GEOBB       IIDQAMKRLKP---GPILADAPQVCYPPKESVYN------------------SIEGLIHH
NUOD_GEOUR       IIRQALDSLKP---GPVLADEPQICYPPKENVYN------------------SIEGLIHH
NUOD_GEOLS       IVNQALERLKP---GPVLADAPQVCYPPKDSVYN------------------SIEGLIHH
NUOD_MYCBP       IVEQCLDKLRPG---PTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGS--SMEALIHH
NUOD_MYCTA       IVEQCLDKLRPG---PTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGS--SMEALIHH
NUOD_MYCTU       IVEQCLDKLRPG---PTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGS--SMEALIHH
NUOD_MYCBO       IVEQCLDKLRPG---PTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGS--SMEALIHH
NUOD_MYCMM       IVEQCLDRLRPG---PTMIEDRKLAWPADLKVGPDGMGNSPEHIAKIMGS--SMEALIHH
NUOD_MYCUA       IVEQCLDRLRPG---PTMIEDRKLAWPADLKVGPDGMGNSPEHIAKIMGS--SMEALIHH
NUOD_MYCA1       IVEQCLDKLQPG---PIMVENGKIAWPADLKVGPDGLGNSPEHIAKIMGG--SMEALIHH
NUOD_MYCPA       IVEQCLDKLQPG---PIMVENGKIAWPADLKVGPDGLGNSPEHIAKIMGG--SMEALIHH
NUOD_MYCGI       IVEQCVERLERSTGEPVMITDRKLAWPADLKVGPDGLGNSPEHIAKIMGH--SMEGLIHH
NUOD_MYCVP       IVEQCVQRLERSVGAPVMITDKKLAWPADLKVGPDGLGNSPEHIAKIMGH--SMEGLIHH
NUOD_MYCSJ       IVEQCVDRLKPG---PVMIADKKLAWPADLELGPDGLGNSPAHIARIMGQ--SMEGLIHH
NUOD_MYCSK       IVEQCVDRLKPG---PVMIADKKLAWPADLELGPDGLGNSPAHIARIMGQ--SMEGLIHH
NUOD_MYCSS       IVEQCVDRLKPG---PVMIADKKLAWPADLELGPDGLGNSPAHIARIMGQ--SMEGLIHH
NUOD_MYCS2       IVEQCLARLKPG---PVMISDKKLAWPADLKLGPDGLGNSPEHIAKIMGR--SMEGLIHH
NUOD_MYCA9       IAQQCVDRLRPG---PVMVDDKKIAWPADLASGPDGLGNSPKHIAKIMGT--SMEGLIHH
NUOD_NOCFA       IVEQCLDRLRPG---PVMIEDKKLAWPADLKLGADGLGNSPAHIGRIMGS--SMEGLIHH
NUOD_RHOJR       IVEQCLDKLRPG---PIMAEDKKIAWPADLTLGPDGLGNSPGHVREIMDS--SMESLIHH
NUOD1_STRAW      IVEQCLDRLAPG---PVMVADKKIAWPAQLALGPDGLGNSLDHIKKIMGT--SMEALIHH
NUOD2_STRCO      IVEQCLDRLQPG---PVMVADKKIAWPAQLALGPDGLGNSLDHIKKIMGT--SMEALIHH
NUOD1_STRGG      IIEQCIDRLEPG---PVMVADKKIAWPAQLALGPDGLGNSLDHIRNIMGT--SMEALIHH
NUOD_NOCSJ       IIEQAADRLAGLDGAPVMIEDKKIGWPSQLAIGSDGMGNSLDHIRHIMGE--SMEALIHH
NUOD_THEFY       IIEQCLDKLKPG---PVMIEDPKIGWPAQLALGPDGMGNAPSHIAHIMGKGGSMEALIHH
NUOD_FRAAA       IIEQCLDRLRPG---PVMVADKKIAWPAQLSIGADGMGNSLAHIRNIMGT--SMEALIHH
NUOD_FRACC       IVDQCLDRLRPG---PVMVADKKIAWPSQLSVGSDGTGNSLAYIRKIMGT--SMEALIHH
NUOD_FRASN       IIEQCLDRLRPG---PVMVADKKIAWPSQLAIGSDGMGNSLEYIRKIMGT--SMEALIHH
NUOD1_SALAI      LVEQAVDRLRPG---PVMVADRKIAWPAQLAIGVDGMGNSLEHVAKIMGQ--SMESLIHH
NUOD1_SALTO      LVEQAVDRLRPG---PVMVADRKIAWPAQLAIGVDGMGNSLEHVAKIMGQ--SMESLIHH
NUOD_ACIC1       IIEQCLDRLRPG---PVMVEDKKIAWPAKLALGPDGMGNSLDHIRHIMAT--SMEALIHH
NUOD_SACEN       IIRQCLDKMEPG---PVMVSDAKIAWPAKLTIGPDGMGNSLEHVRKIMGQ--SMESLIHH
NUOD_CUTAK       ILKQCLKRLEDTQGDRHMVEDPHIAWPAELALGPDGQGNSNEHIRHIMGE--SMEALIHH
NUOD1_SYMTH      IIRQALDNLPWD--------DRYIIDDRKLVLPPKQEVKH------------SMEALIHH
NUOD_THEM4       IVKQALEKMPVG--------KVNTPISEGSAL----------------------------
NUOD_PARUW       IIEQAIARLKPG---VVLTNDRKVALPPRKELAR------------------SMEAVIHQ
NUOD_FLAJ1       IIRQALEKMPA--GNEYHAEVPDYYLPPKED------------------VYNSMESLIYH
NUOD_FLAPJ       IIRQALAKMPE--GNVYHAEVPDYYLPPKED------------------VYHNMESLIYH
NUOD2_CYTH3      IIRQAMEKIKALPKGVFHAEVPDFYLPPKED------------------VYSQMEALIYH
NUOD_LEPBA       IIEQLIDGIPE---GPYHADVPHSFLPPKDR------------------VYHNMEELIYH
NUOD_LEPBP       IIEQLIDGIPE---GPYHADVPHSFLPPKDR------------------VYHNMEELIYH
NUOD_LEPBJ       IIEQLVDGIPS---GAWHADLPHAYLPEKNK------------------VYNNMEELIYH
NUOD_LEPBL       IIEQLVDGIPS---GAWHADLPHAYLPEKNK------------------VYNNMEELIYH
NUOD_LEPIN       IIEQLVDGIPS---GPWHADLPHAYLPEKHK------------------VYNNMEELIYH
NUOD_LEPIC       IIEQLVDGIPS---GPWHADLPHAYLPEKHK------------------VYNNMEELIYH
NUOD1_SORC5      IIEQALEQMPD--EGPINIDDPRIVLPPKEE------------------VYTTIEATIQH
NUOD_METI4       ILDQALADIPP---GPIAVDEPRGYLPKKSA------------------VLTKMEELIQH
                 :                                                           

NUOD1_RHIME      FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGYAHLQ-AMDFLC
NUOD1_SINMW      FKLYTEGYHVPAGDVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGYAHLQ-AMDFLC
NUOD1_RHIEC      FKLYTEGYHVPAGEVYTAVEAPKGEFGVYLVSDG-SNKPYRCKIRAPGYAHLQ-AMDFMC
NUOD1_RHIE6      FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRCKIRAPGYAHLQ-AMDFMC
NUOD_RHIL3       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGYAHLQ-AMDFMC
NUOD_AGRFC       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADG-SNKPYRCKIRAPGYAHLQ-AMDFLC
NUOD_BRUAB       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRFKLRAPGFAHLQ-AMDFLC
NUOD_BRUA2       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRFKLRAPGFAHLQ-AMDFLC
NUOD_BRUA1       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRFKLRAPGFAHLQ-AMDFLC
NUOD_BRUC2       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_BRUSI       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_BRUO2       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_BRUSU       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_BRUME       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-SNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_OCHA4       FKLYTEGYHVPAGEVYAAVEAPKGEFGVFLVSDG-SNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_CHESB       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVADG-TNKPYRCKLRAPGFAHLQ-AMDFMC
NUOD_RHILO       FKLYTEGYRVPAGEVYAAVEAPKGEFGVYLVSDG-TNKPYRCKLRAPGFAHLQ-AMDFLC
NUOD_AZOC5       FKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVGDG-TNKPYRCKIRAPGFAHLQ-SMDFLC
NUOD_XANP2       FKLYTEGFHVPAGDVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGFAHLQ-AMDFLC
NUOD_BRASB       FKLYTEGVHVPAGEIYAAVEAPKGEFGVYLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFLC
NUOD_BRASO       FKLYTEGVHVPAGEIYAAVEAPKGEFGVYLVADG-TNKPYKCKIRAPGFAHLQ-AMDFLC
NUOD_BRADU       FKLYTEGVHVPAGEVYAAVEAPKGEFGVYLVADG-TNKPYKCKIRAPGFAHLQ-AMDHIC
NUOD2_NITHX      FKLYTEGFRVPAGEVYAAVEAPKGEFGVFLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFIC
NUOD_NITWN       FKLYTEGFHVPAGEIYAAVEAPKGEFGVYLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFIC
NUOD_RHOP5       FKLYTEGFRVPAGEVYVAVEAPKGEFGVFLVSDG-TNKPYKCKIRAPGFAHLQ-AMDFVT
NUOD_RHOPB       FKLYTEGFRVPAGEVYVAVEAPKGEFGVFLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFIS
NUOD_RHOPS       FKLYTEGFRVPEGEVYVAVEAPKGEFGVYLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFIC
NUOD_RHOP2       FKLYTEGFRVPAGEVYVAVEAPKGEFGVYLVSDG-TNKPYKCKVRAPGFAHLQ-AMDFIC
NUOD_RHOPA       FKLYTEGFHVPAGEVYVAVEAPKGEFGVYLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFLS
NUOD_RHOPT       FKLYTEGFHVPAGEVYVAVEAPKGEFGVYLVSDG-SNKPYKCKIRAPGFAHLQ-AMDFLS
NUOD_METEP       FKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGFAHLQ-AMDWMC
NUOD_METPB       FKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGFAHLQ-AMDWMC
NUOD_METRJ       FKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVSDG-TNKPYRCKIRAPGFAHLQ-AMDWMC
NUOD_METS4       FKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADG-TNKPYRCKIRAPGFAHLQ-AMDWMC
NUOD1_BEII9      FKLYTEGFHVPAGEVYCGVEAPKGEFGVYLVSDG-TDKPYRCKIRAPGFAHLS-AMDFLC
NUOD2_BEII9      FKLYTEGHHVPAGEVYAAVEAPKGEFGVYLISDG-SNIPYRCKIRAPSFAHLQ-AIDFLS
NUOD1_NITHX      FKLYTEGHRVPAGEVYVAVEAPKGEFGVYLVSDG-TNQPYKCKIRAPSFAHLS-AMDFLT
NUOD_PARL1       FKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDG-GNKPYKCKIRAPGYAHLQ-AMDHLC
NUOD_BARBK       FKLYTEGFHTPPGEVYVAVEAPKGEFGVYLVSDG-TNKPYRVKLRAPGFAHLQ-AMDFLT
NUOD_BARHE       FKLYTEGFRTPPGEVYVAVEAPKGEFGVYLVSDG-TNKPYRVKLRAPGFAHLQ-AMDFLT
NUOD_BART1       FKLYTEGFHTPPGEVYVAVEAPKGEFGVYLVSDG-TNKPYRVKLRAPGFAHLQ-AMDFLT
NUOD_BARQU       FKLYTEGFHTPPGEVYVAVEAPKGEFGVYLISDG-TNKPYRVKLRAPGFAHLQ-AMDFLT
NUOD_CAUVC       FKLYTEGFKTPAGEVYACVEAPKGEFGVFVVSDG-TNKPYRCKIRAPGFPHLA-AMDWMN
NUOD_CAUSK       FKLYTEGFRTPEGEVYACVEAPKGEFGVFLVSNG-TNKPYRCKIKAPGFSHLA-AMDWMN
NUOD_PHEZH       FKLYTEGYRTPPGDVYACVEAPKGEFGVYLVSNG-TNKPYRCKIRAPGYPHLQ-AMDWMN
NUOD_MARMM       FKLYTEGVHVEEGETYVAVEAPKGEFGVYLVSDG-SNKPYRLKIRAPGFAHLA-AMDYMS
NUOD_RUEPO       FKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADG-TNKPYRSKIRAPGYLHLQ-AMDHVA
NUOD_RUEST       FKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVADG-SNKPYRAKLRAPGFLHLQ-AMDYVA
NUOD_ROSDO       FKLYTEGFHVPAGEVYACVEAPKGEFGVYLVADG-TNKPYRAKIRAPGFLHLQ-AMDHMS
NUOD_DINSH       FKLYTEGFHVPAGEVYAAVEAPKGEFGVFLKSDG-TNRPYRAKIRAPGYLHLQ-SMDHVA
NUOD_RHOS4       FKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADG-TNRPYRAKIRAPGFLHLQ-AIDYIA
NUOD_RHOS1       FKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADG-TNRPYRAKIRAPGFLHLQ-AIDYIA
NUOD_RHOS5       FKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADG-TNRPYRAKIRAPGFLHLQ-AIDYIA
NUOD_JANSC       FKLYTEGFHVPEGEIYACVEAPKGEFGVFLVADG-TNKPYRAKLRAPGFAHLQ-AMDYLC
NUOD_PARDP       FKLYTEGFKVPAGEVYAAVEAPKGEFGVYLVADG-TNKPWRAKLRAPGFAHLQ-SIDWMS
NUOD_HYPNA       FKLYTEGFHVPEGECYAAVEAPKGEFGVYLVADG-TNRPYRAKIRAPGYPHLQ-AMDYLC
NUOD_PELUB       FKLFTEGYRVDKDEIYTAVEAPKGEFGVYLISDG-TSKPYKCKIRAPGFSHLQ-AMDYLI
NUOD_RICBR       FKLYTEGYDVPAGEIYKAVEAPKGEFGVYLYSTG-GNRPYRCRIKAPGFAHLQ-GLDFMS
NUOD_RICB8       FKLYTEGYDVPAGEIYKAVEAPKGEFGVYLYSTG-GNRPYRCRIKAPGFAHLQ-GLDFMS
NUOD_RICCN       FKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQG-GNRPYRCRIKAPGFAHLQ-GLDFMS
NUOD_RICM5       FKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQG-GNRPYRCRIKAPGFAHLQ-GLDFMS
NUOD_RICRO       FKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSRG-GNRPYRCRIKAPGFAHLQ-GLDFMS
NUOD_RICRS       FKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSRG-GNRPYRCRIKAPGFAHLQ-GLDFMS
NUOD_RICFE       FKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQG-GNRPYRCRIKAPGFAHLQ-GLDFIS
NUOD_RICAH       FKLYTAGYDVPAGETYKAVEAPKGEFGVYLYSQG-VNIPYRCRIKSPGFAHLQ-GLDFMS
NUOD_RICCK       FKLYTEGYEVPAGETYKAVEAPKGEFGVYLYSIG-NNQPYRCRIKTPGFAHLQ-GLNFMS
NUOD_RICPR       FKLYTEGYDVPIGETYKAVEAPKGEFGVYLYSQG-GNKPYRCRIKAPGFAHLQ-GLNFMS
NUOD_RICTY       FKLYTEGYDVPIGETYKAVEAPKGEFGVYLYSQG-GNKPYRCRIKAPGFAHLQ-GLNFMS
NUOD_ORITB       FKLYSEGYNVPAGEVYAAVEAPKGEFGVYLYSDG-TNRPYRCRIKAPGFAHLQ-GLDFMA
NUOD_ORITI       FKLYSEGYNVPAGEVYAAVEAPKGEFGVYLYSDG-TNRPYRCRIKAPGFAHLQ-GLDFMA
NUOD_ANAMM       FKLFSEGYKVPEGEAYVAVEAPKGEFGVYIVSDG-TNRPYRCRIRAPGFAHLQ-AIDAMA
NUOD_ANAPZ       FKLFSEGYKVPEGEAYAAVEAPKGEFGVYIVSDG-TNKPYRCRIRSPGFAHLQ-AIDAMA
NUOD_EHRCJ       FKLYSEGYSVPVGETYMAVEAPKGEFGVYIVSDG-TNKPYRCRIRAPGFAHLQ-AIDIIA
NUOD_EHRCR       FKLYSEGYSVPIGETYMAVEAPKGEFGVYIVSDG-TNKPYRCRIRAPGFAHLQ-AIDMMA
NUOD_EHRRG       FKLYSEGYIVPAGETYMAVEAPKGEFGVYIVSDG-TNKPYRCRIRAPGFAHLQ-AIDMMA
NUOD_EHRRW       FKLYSEGYSVPAGETYMAVEAPKGEFGVYIVSDG-TNKPYRCRIRAPGFAHLQ-AIDMMA
NUOD_WOLPP       FKLYSEGYHVPEGEAYVAVEAPKGEFGVYIVSDG-TNRPYRCRIRAPGFAHLQ-ALDFMA
NUOD_WOLPM       FKLYSEGYHVPEGEAYAVVEAPKGEFGVYIVSDG-TNRPYRCRIRAPGFAHLQ-ALDFMA
NUOD_WOLTR       FKLYSEGYHVPEGEAYAAVEAPKGEFGVYIVSDG-TNRPYRCRIRAPGFAHLQ-ALDFMA
NUOD_NEOSM       FKLYSEGYHVPEGETYFAVESPKGEFGVYIVSDG-TNKPYRCRIRAPGFVHLQ-ALDTLS
NUOD_MAGSA       FKLFTEGFKVPAGEVYGAIEAPKGEFAVYLVSDG-TGKPYRCKIRPPGYVHLQ-ALDMMS
NUOD_RHORT       FKLFTEGFKVPEGETYTAVEAATGEFGVYLVSDG-TNRPYRCKIRSPGYVHLQ-GLDLMS
NUOD_GLUDA       FKLFTEGYHVPPGATYTAVESPKGEFGVYLVADG-SNRPYRCKIRPTGFAHLQ-AIDEMS
NUOD_GRABC       FKLYTEGYHVPEGATYTAVESPKGEFGVYLVSDG-SNRPYRCKIRPTGFAHLQ-AIDVMA
NUOD_ACICJ       FKLYTEGYHVPAGTTYTAVEAPKGEFGVYLVADG-SNRPYRCKIRATGFSHLQ-AMNLMS
NUOD_ERYLH       FKLYTEGFHVPAGEVYVATESPKGEFGVYLVADG-TNKPYRCKIRPTAFSHLQ-AMDFMS
NUOD_NOVAD       FKLYTEGFHVPAGEVYVATESPKGEFGVYLVSDG-SNKPYRCKIRPTAFSHLQ-AMDFMC
NUOD_SPHAL       FKLYTEGFHVPAGEVYVATESPKGEFGVYLVSDG-TNKPYRCKIRPTAFSHLQ-AMDMMS
NUOD_SPHWW       FKLYTEGFHVPAGDVYVATESPKGEFGVYLVSDG-SNKPYRCKIRPTAFSHLQ-AMDFMM
NUOD_ACIAC       FKLFTEGFRVPEGEAYAAVEHPKGEFGIYLVSDG-ANKPYRLKIRAPGFAHLA-TLDEMA
NUOD_ACISJ       FKLFTEGFRVPAGEAYAAVEHPKGEFGIYMVSDG-ANKPYRLKIRAPGFAHLA-TLDEMA
NUOD_DELAS       FKLFTEGFRVPEGEAYAAIEHPKGEFGIYIVSDG-ANKPYRLKIRPPGFANLS-AMDELC
NUOD_LEPCP       FKLFTEGFHVPEGEAYAAVEHPKGEFGIYAISDG-ANKPYRLKIRAPGFAHLA-ALDEMS
NUOD_METPP       FKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDG-ANKPYRLKIRAPGFAHLA-AMDEMS
NUOD_CHRVO       FKLFTEGMHVPEGEAYAAVEHPKGEFGIYLVSDG-ANKPYRLKIRAPGYAHLA-ALDEMA
NUOD_RHOFT       FKLFSEGFSVPEGEAYATIEHPKGEFGIYMVSDG-ANKPYRMKIRPPAFVHLA-ALGEMG
NUOD_AZOSB       FKLFTEGMHVPKGEAYAAVEHPKGEFGVYAVSDG-ANKPYRLKLRAPGFAHLA-AMDEIS
NUOD_AROAE       FKLFTEGMHVPSGEVYAAIEHPKGEFGVYAVSDG-ANKPYRLKLRAPGFAHLA-AMDEIA
NUOD_METFK       FKLFTEGFHVPAGEAYAAVEHPKGEFGIYLISDG-ANKPYRLKIRAPGFAHLA-ALDEMT
NUOD_BORA1       FKLFTEGFHVPPGEAYAAVEHPKGEFGIYLVSDG-ANKPYRLKIRAPGFAHLQ-SLDEMS
NUOD_BORPE       FKLFSEGFHVPPGEAYAAVEHPKGEFGIYLVADG-ANKPYRLKIRAPGFAHLQ-SLDEMA
NUOD_HYDCU       FKLFTEGYSVPEGESYTAVEHPKGEFGIYMVSDG-ANKPYRLKVRAPGFAHLA-SLDEMA
NUOD_ACIF5       FKLFSEGMAVPAGEVYAAVEAPKGEFGIYMISDG-ANKPYRMKIRAPGFPHLA-AMDEMA
NUOD_NEIG1       FKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDG-ANKPYRLKIRAPGFAHLQ-GMDEMA
NUOD_NEIG2       FKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDG-ANKPYRLKIRAPGFAHLQ-GMDEMA
NUOD_NEIMA       FKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDG-ANKPYRLKIRAPGFAHLQ-GMDEMA
NUOD_NEIMB       FKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDG-ANKPYRLKIRAPGFAHLQ-GMDEMA
NUOD_NEIM0       FKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDG-ANKPYRLKIRAPGFAHLQ-GMDEMA
NUOD_NEIMF       FKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDG-ANKPYRLKIRAPGFAHLQ-GMDEMA
NUOD_XANOR       FKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDG-ANKPFRVHLRAPGFAHLS-SMDAVV
NUOD_XANOM       FKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDG-ANKPFRVHLRAPGFAHLS-SMDAVV
NUOD_XANOP       FKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDG-ANKPFRVHLRAPGFAHLS-SMDAVV
NUOD1_STRM5      FKLFSEGYQVPAGETYAAVEAPKGEFGCYLISDG-ANKPFRVHLRAPGFAHLS-SLDEIV
NUOD_MAGMM       FKLCTEGFNLPAGEVYAAVETPKGELGVYLVSDG-GNKPYRARIRAAGFNHLQ-AVKEMA
NUOD2_RHIME      FDLSAYGFDVPAGEVYSVIEAPKGELGFYIISDG-SPKPFRMKVRAPSFVNLQ-ALFGVT
NUOD2_SINMW      FDLSAYGFDVPAGEVYSVIEAPKGELGFYIISDG-SPKPFRMKVRAPSFVNLQ-ALFGVT
NUOD2_RHIEC      FDLSAYGFKVPKGEVYSAIEAPKGELGFYIISDG-SPKPFRMKVRAPSFVNLQ-ALFGVT
NUOD2_RHIE6      FDLSAYGFKVPKGEVYSAIEAPKGELGFYIISDG-SPKPFRMKVRAPSFVNLQ-ALFGVT
NDHH_CAPBU       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_NASOF       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_BARVE       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_ARATH       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_DRANE       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_ARAHI       SKKPSPTFELSKQELYVRVEAPKGELGIFIIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_OLIPU       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_LEPVR       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_CRUWA       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_LOBMA       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_AETCO       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_AETGR       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SGVPWRWKIRPPGFINLQ-ILPELV
NDHH_SOYBN       SKKPSPTFELPKQELYVRIEAPKGELGIFLIGDQ-NGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_PHAVU       SKKSSPSFELPKQELYVRIEAPKGELGIFIIGDQ-NGFPWRWKIHPPGFINLQ-ILPQLV
NDHH_LOTJA       GKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-NGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CICAR       GKKSSPTFELPKQELYVRVEAPKGELGIFLIGDQ-NGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CUCSA       SKKPSPTFELAKQELYVRVEAPKGELGIFLIGDQ-GGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_MORIN       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_OENEH       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_OENBI       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_OENGL       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_OENAR       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_OENPA       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_EUCGG       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_GOSBA       SIKPSPTFELPRQELYARMEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_GOSHI       SKKPSPTFELPRQELYARMEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CITSI       SKKPSPTFELTKQELYARVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CARPA       SKKPSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPQLV
NDHH_IPOPU       AKKTSPIFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGLINLQ-ILPQVV
NDHH_PELHO       SKKPSPTFELPKQELYVRVEAPKGELGVFLIGDR-SSFPWRWKIRPPGFMNLQ-ILPQLV
NDHH_POPAL       SKKTSPAFELPKQELYVRVEAPKGELGIFLIGDQ-SSFPWRWKIRPPGFINLQ-ILPQLI
NDHH_POPTR       SKKTSPAFELPKQELYVRVEAPKGELGIFLIGDQ-SSFPWRWKIRPPGFINLQ-ILPQLI
NDHH_MANES       SKKTSPTFELPKQELYVRVEAPKGELGIFLIGDQ-SGFPWRWKIRPPGFINLQ-ILPELV
NDHH_SOLLC       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_SOLBU       SKKPSPTFELSKQELYVRVEAPKGELGIFMIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_SOLTU       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_TOBAC       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_NICSY       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ATRBE       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_NICTO       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_COFAR       SKKPSPTFELSKQELYVRVEAPKGELGIFLVGDR-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_JASNU       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILSQLV
NDHH_SPIOL       SKKPSPAFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_VITVI       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-NVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_DAUCA       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDK-GIFPWRWKIRPPGFINLQ-ILPQLV
NDHH_PANGI       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDR-GVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_FAGEA       SKRPSPTFELSQQELYVRVEAPKGELGIFLIGDR-SAFPWRWKIRPPGFINLQ-ILPQLV
NDHH_GUIAB       SKKPSPTFELSKQELYARVEAPKGELGIFLIGDK-GVFPWRYKIRPPGFINLQ-ILPQLV
NDHH_HELAN       SKKPSPTFELSKQELYARVEAPKGELGIFLIGDK-GVFPWRYKIRPPGFINLQ-ILPQLV
NDHH_LACSA       SKKPSPTFELSKQELYARVEAPKGELGIFLIGDK-GVFPWRYKIRPPGFINLQ-ILPQLV
NDHH_PLAOC       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_NANDO       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_RANMC       SKKPSPTFELSKQELYVRVEAPKGELGIFLVGDK-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_BUXMI       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQ-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_AMBTC       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGLINLQ-ILPQLV
NDHH_DIOEL       SKKPSPNFELSKQELYMRVEAPKGELGIYMIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ILLOL       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRSPGFINLQ-ILPQLV
NDHH_CHLSC       SKKPSPTFELSKQELYARVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CALFG       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPHLV
NDHH_DRIGR       SKKPSPTFELLKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CERDE       SKKPSPSFELSKQELYVRVEAPKGELGVFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_LIRTU       SKKPSPTFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_NUPAD       SKKPSPSFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_NYMAL       SKKPSPSFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_PIPCE       SKKPSPSFELSKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ACOAM       SKKPSPTFELAKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ACOCL       SKKPSPTFELAKQELYVRVEAPKGELGIFLIGDN-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_HORVU       GKKPSPNFELSRQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_WHEAT       GKKPSPNFELSRQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_BRADI       GKKPSPNFELSKQELYVRIEAPKGELGIYLVGDD-GLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ORYNI       GKKPSPNFELSKQELYARVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ORYSA       GKKPSPNFELSKQELYARVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ORYSI       GKKPSPNFELSKQELYARVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ORYSJ       GKKPSPNFELSKQELYARVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_LOLPR       GKKPSPNFELSKQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_AGRST       GKKPSPNFELSKQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_SACHY       GKKPSPNFELSKQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_SACOF       GKKPSPNFELSKQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_SORBI       GKKPSPNFELSKQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_MAIZE       GKKPSPNFELSKQELYVRVEAPKGELGIYLVGDD-SLFPWRWKIRPPGFINLQ-ILPQLV
NDHH_LEMMI       SKKPSPNFELSKQELYVRVEAPKGELGIFLIGDQ-NVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CRYJA       SKKPSPTFELSKQEHYVRVEAPKGELGIFFIGDD-NIFPWRWKIRPPGFINLQ-IPPQLV
NDHH_CYCTA       SKKPSPTFESPKQEHYVRVEAPKGELGIFLMGDD-SIFPWRWKIRPPGFINLQ-IPPQLV
NDHH_ANTAG       SKKPSPTFKLPKQEHYIRVEAPKGELGIYLIGDD-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ANGEV       SKKSSPTFKLPKQEHYVRIEAPKGELGIFLIGDD-NVSPWRWKIRPPGFINLQ-ILPQLV
NDHH_MARPO       SKKPSPTFKLPKQEHYVRVEAPKGELGIFLIGDD-SVFPWRLKIRSPGFINLQ-ILPQLV
NDHH_PHYPA       SKKPSPTFKLPKQEHYIRVEAPKGELGVFLIGDD-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_HUPLU       SRKPSPTFKLPKQEHYVRVEAPKGELGIFLMGDD-SAFPWRWKIRPPGFINLQ-ILPQLV
NDHH_ADICA       GKKSSPTLKLPKQEHYVRVEAPKGELGIFLIGDD-SVFPWRLKIRPPGFINLQ-IVPQLI
NDHH_PSINU       GKKSSPTFKLLKQEHYVRIEAPKGELGIFLIGND-SVFPWRWKIRPPGFINLQ-ILPQLV
NDHH_CHAGL       SKKSSPTFKLPKNEHYVRVEAPKGELGIYLIGDD-TVFPWRCKIRPPGFVNLQ-ILPQLV
NDHH_CHAVU       SKKSSPTFKIPKQEHYVRLEASKGELGIFLIGDD-NIFPWRWKIRPPGFINLQ-VLPPLV
NDHH_STAPU       SKKPSPTFKLPKQEHYVRVEAPKGELGIYLIGDD-SIFPWRWKIRPPGFINLQ-ILPQLL
NDHH_ZYGCR       SKKPSPTFKLPKQEHYVRVEAPKGELGVFLIGDD-SMFPWRWKIRPPGFINLQ-ILPQLL
NDHH_MESVI       GKKPSPTFKIPKQEHYVRVEAPKGELGVFLMGDD-NVFPWRWKIRSPGFINVQ-ILPELV
NDHH_CHLAT       GKKPSPTFKMPKQEHYVRVEAPKGELGVFLIGDD-NVFPWRWKIRAPGFINVQ-ILPQLV
NDHH_NEPOL       GKKASPTFKMPRQEHYVRVEAPKGELGVFLIGDD-HVFPWRWKIRPPGFINVQ-ILPNLV
NDHH1_GLOVI      GKKSSPTFKMPRGEHYVRVEAPKGELGVYLIGDD-STFPWRWKIRPPGFINLA-VLPKLV
NDHH_NOSS1       GKKVSPTFKMPKGEIYARVESGKGELGIYLIGDD-NVFPWRWKIRPADFNNLQ-ILPHLL
NDHH_THEEB       GKKLSPTFKIPKGEHYVRVESGKGELGIYLIGDD-NVFPWRWKIRPPDFNNLQ-VLPQLL
NDHH_SYNY3       AKKVAPTFKIPAGEHYVRLESGKGELGIFIQGND-DVFPWRWKIRSADFNNLQ-ILPHIL
NUOD_AMOA5       QKMVPKKVRTKAQDCYIRAENPRGELGFFFRASDNGDKPIRCKARSSSFSNLS-VISSIA
NUOD1_CYTH3      QAIVPKKIRPKVMDFYVRAENPKGELGFFFRTTGNTDIPFRCKVRAPSFVNLS-VLQAIS
NUOD_CHLP8       RALIPKKIRPKAGEVYGRAENPRGELGYYIVSDGKSTKPVRCKARSSCFVNLA-AMKDLS
NUOD_CHLTE       RALIPKKIRPKAGEVYGRAENPRGELGYYIVSDGKSTSPVRCKARSSCFVNLS-AMKDLS
NUOD_CHLL2       RSAVPKRVRPKAGEVYARAENPRGELGFYIQSDGKSTKPLRCKARSSCFVNLS-AMKDLS
NUOD_CHLPD       RAAVPKRVRAKAGEVYCRAENPRGELGFYIQSDGKSTKPLRCKARSSCFVNLS-AMKDLS
NUOD_PELLD       RAAVPKRIRPKAGEVYARAENPRGELGFYILSDGKSTSPVRCKARSSCFVNLS-AMKDLS
NUOD_CHLPM       RSAVPKRVRPKAGEVYGRAENPRGELGFYIQSDGKSTSPLRCKARSSCFVNLS-AMKDLS
NUOD_PELPB       RSAIPKRIRPKAGEVYARAENPRGELGFYIMSDGKSTKPLRCKARSSCFVNLS-AMKDLS
NUOD_CHLCH       RAAIPKKIRPKAGEVYGRAENPRGELGFYIQSDGKSTKPLRCKARSSCFVNLS-AMKDLS
NUOD_CHLPB       RSAIPKRIRPKAGEVYGRAENPRGELGFYIISDGKSTKPLRCKARSSCFVNLS-AMKELS
NUOD_PROA2       RSAIAKRIRPKAGEVYGRAENPRGELGFYIVSDGKSTKPVRCKARSSCFVNLS-AMKELS
NUOD2_CHLT3      HAAVPKRVKPKAGEVYARGEAPRGELGFYIISDGKGTTPFRCKARSSCFVNLS-LLPEMA
NUOD2_ANADE      TAKVPRNIKPEAGEALGRVESARGELAYYVISDG-TNKAYRVRARTGSFTAMC-IIEDIS
NUOD1_ANASK      TAKVPRNIKPEAGEAIGRVESARGELAYYVISDG-TNKAYRVRARTGSFTAMC-IIEDIS
NUOD1_ANADF      MAKVPRNVKPEAGEVLSRVESARGEMAYYVVSDG-TNKAYRLRSRTGSFTAMS-IIEDIS
NUOD2_SORC5      LGKLPKKMRPD-GEAYARIESARGDMGCYVIGRG-AEEAYRARFRTGSFTAMA-MIEAKS
NUOD_BACAN       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACCR       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACAH       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACCZ       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACHK       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACC1       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACMK       LAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_BACCN       MAKVPRIIKVPKGEAFVRIESPRGEIGCYIASEG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_GEOKA       MGKVPRIIKAPPGETFVRIEAPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_GEOTN       MGKLPRIIKAPPGETFVRIEAPRGEIGCYIASDG-KKEPYRLKFRRPSFYNLQ-ILPKLL
NUOD_DESPS       PEKKPKIIKLPEGDYYSTVEAARGSFGIRLVSDG-GKNAYRLKLRSPTFSNMH-LFDEVC
NUOD2_OPITP      APKVPRVIRLPAGDYTYAVEAARGRFMVRVVSDG-KENPYRARLRTPSFGNLS-LFEETS
NUOD_SYNFM       NDSVPTRLKPPKGEVYFAFESARGQAAYYLVSDG-TPSPYRCHIRVPSFGNLH-VLTEVL
NUOD2_SALAI      NTRLPKVLKAPEGHTYAWTENPLGINGYYLVSRG-EKTPWRLKLRTASYANVQ-ALATLL
NUOD2_SALTO      NTRLPKVLKAPEGHTYAWTENPLGINGYYLVSRG-EKTPWRLKLRTASYANVQ-ALATLL
NUOD2_STRAW      NQRLPKVLKAPEGHTYAWTENPLGINGYYLVSKG-EKTPYRLKLRSASFNNIQ-ALTELL
NUOD1_STRCO      NQRLPKVLKAPEGHTYAWTENPLGINGYYLVSKG-EKTPYRLKLRSASYNNIQ-ALAELL
NUOD2_STRGG      NQRLPKVLKAPEGHTYAWTENPLGVNGYYLVSKG-EKTPYRLKLRSASFNNIQ-ALTELL
NUOD_RUBXD       MGDVGRRVRPPEGEGFGRVEGPRGEFAVHVVSDG-SDTPYRVHYRDPSFVNMQ-LLQEKM
NUOD_DESHY       A-KVPKIIKPPAGEVYHRVENPKGELGFYIVSNG-TPKPERVKIRAGAFVNLQ-CLNEIG
NUOD_HELMI       A-KMPKAIKPPVGEVYHRIENAKGEIGFYVVSDG-SLKPYRWHARRAAMINLQ-LLDELC
NUOD_CARHZ       A-KVPKVIKPPVGEVYHEVEAPKGILGYYVVSDG-STKPYRMHVRRPSFINIG-MLKELL
NUOD2_SYMTH      APKMPRVLKPPKGEVYHRIEGARGEVACYVVSDG-STNPYKVKWRSPAFTHLQ-LMPLLC
NUOD_CAMJE       FVLITQGLKPPKGEVYVPTESPKGELGFFIHSDG-TGRPYRLKARTPSYWHCA-FFEEML
NUOD2_ROSCS      -IGKQKALRPPPGDAYARIESPKGELGFYLVSDG-SERPYRYKVRAPSFINLT-PLGDMC
NUOD1_ROSS1      -IGKQKALRPPPGDAYARIESPKGELGFYLVSDG-SERPYRYKVRAPSFINLT-PLGDMC
NUOD2_HERA2      ---KQQSLKAPAGEAYARVESPKGELGFYLVSDG-SGSAYRYKVRAPSFINLS-SLADMC
NQO4_THET8       FKHYTEGFHPPKGEVYVPTESARGELGYYIVSDG-GSMPYRVKVRAPSFVNLQ-SLPYAC
NUOD_THET2       FKHYTEGFHPPKGEVYVPTESARGELGYYIVSDG-GSMPYRVKVRAPSFVNLQ-SLPYAC
NUOD_DEIRA       FKLVTEGFHPPLGEAYVPIESARGEVGYYVISDG-GSMPYRVKIRAPSFVNLQ-ALEYAC
NUOD_DEIGD       FKLVTEGFHPPKGEVYVPTESARGEVGYYIVSDG-GSMPYRVKIRAPSFVNLQ-ALEYAC
NUOD2_KORVE      FKIVTEGFTVPPGEVYSAIESPRGEMGYYIVSDG-TAKPYRVHMRSPSFANLQ-MLPSMC
NUOD1_SOLUE      FKIVTEGFRVPEGEVYQVIESPRGELGYYVVSDG-TTKPYRVHMRTPSFGNLQ-AVPKMV
NUOD1_ROSCS      FKLWTEGFKPPRGDALAAVESPRGELATYIVSDG-SAKPYRVHFRAPSFVNLQ-SLPHMA
NUOD2_ROSS1      FKLWTEGFKPPRGDALAAVESPRGELATYIVSDG-SAKPYRVHFRAPSFVNLQ-SLPHMA
NUOD2_CHLAA      FKLWTEGFKPPRGDAYVSIESPRGILGCYVVSDG-SPKPWRVHFRAPSFINLQ-SLAHMA
NUOD1_HERA2      FKLWTEGFRPPRGSAYAAIESPRGEIGCYVVSDG-TPKPWRVHFRAPSFINLQ-ALPHIA
NUOD_GEOMG       FKIASEGFPVPEGEVYQGVENPKGELGYYIVSDG-GNKPYRMRIRPPSFVNLG-AIEKMA
NUOD_GEOSL       FKIASEGFPVPEGEVYQSVEAPKGELGYYIVSDG-GPKPYRMRIRPPSFVNLG-AIEKMA
NUOD_GEOBB       FKIASEGFPVPEGEVYQGVENPKGELGYYMVSDG-GSKPYRMRVRPPSFVNLG-AIEKMA
NUOD_GEOUR       FKIASEGFSTPEGEVYQSVEAPKGELGYYLVSDG-STKPYRMRIRPPSFVNLQ-AIEKMA
NUOD_GEOLS       FKIASEGYPVPEGEVYMGVEAPKGELGFYLVSDG-SSKPYRMRVRPPSFVNLQ-AIEKMA
NUOD_MYCBP       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-SVAAMC
NUOD_MYCTA       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-SVAAMC
NUOD_MYCTU       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-SVAAMC
NUOD_MYCBO       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-SVAAMC
NUOD_MYCMM       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMS
NUOD_MYCUA       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMS
NUOD_MYCA1       FKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-SVAAMC
NUOD_MYCPA       FKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-SVAAMC
NUOD_MYCGI       FKLVTEGIRVPPGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMC
NUOD_MYCVP       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMC
NUOD_MYCSJ       FKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMC
NUOD_MYCSK       FKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMC
NUOD_MYCSS       FKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMC
NUOD_MYCS2       FKLVTEGIRVPPGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAATC
NUOD_MYCA9       FKLVTEGVRVPAGQVYVAIESPRGELGVHMVSDG-GTRPYRVHFRDPSFTNLQ-SVAAMC
NUOD_NOCFA       FKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDG-GTRPYRVHYRDPSFTNLQ-AVAAMC
NUOD_RHOJR       FKLVTEGFRVPPGQVYVAVESPRGELGVHMVSDG-GTRPFRVHFRDPSFTNLQ-SVAATC
NUOD1_STRAW      FKLVTEGFRVPPGQTYSAVESPKGELGVHAVSDG-GTRPYRVHFRDPSFTNLQ-AMAAMC
NUOD2_STRCO      FKLVTEGFRVPPAQVYTAVESPKGELGVHVVSDG-GTRPFRVHFRDPSFTNLQ-AMAAMC
NUOD1_STRGG      FKLVTEGFRVPPGQVYTAVESPKGELGVHVVSDG-GTRPYRVHFRDPSFTNLQ-AMAAMC
NUOD_NOCSJ       FKLVTEGFRVPPGQAYVPVESPRGELGAHVVSDG-GTRPFRAHFRDPSFTNLQ-ATSVMA
NUOD_THEFY       FKLVTEGFRVPPGQAYAAVESPKGELGCFAVSDG-GPRPYRVHFRDPSFTNLQ-AVAAMC
NUOD_FRAAA       FKLVTEGFRVPPGQVYTQIESPRGELGYHVVSDG-GTRPFRVHVRDPSFVNLQ-AVPALT
NUOD_FRACC       FKLVTEGFRVPAGQVYTQIESPRGELGYHVVSDG-GTRPFRVHVRDPSFVNLQ-AVPALT
NUOD_FRASN       FKLVTEGFRVPAGQVYTQIESPRGELGYHVVSDG-GTRPFRVHVRDPSFVNLQ-AVPALT
NUOD1_SALAI      FKLVTEGFRVPPGQVYVALEAPRGELGVHAVSDG-GTRPYRVHYREPSFVNLQ-ALPAMA
NUOD1_SALTO      FKLVTEGFRVPPGQVYVGIEAPRGELGVHAVSDG-GTRPYRVHYREPSFVNLQ-ALPAMA
NUOD_ACIC1       FKLVTEGFHVPPGQVYVPVESPRGELGVHLVSDG-GTKPYRVHLREPSFVNLQ-TVAAVC
NUOD_SACEN       FKLVTEGFDVPPGQVYVPVESPRGELGYHVVSDG-GTRPMRVHVREPSFVNLQ-ALPAMV
NUOD_CUTAK       FKIVTEGFRVPAGQVYQAIEGAGGELGCHLVSDG-GVRPYRSHLRDPGFVNVQ-SLPAMC
NUOD1_SYMTH      FKLVHHGFDVPAGEVYVSIESPRGEIGFYVVSDG-GNKPMRVRVRPPSFYAVY-SLPVLL
NUOD_THEM4       ------RFRVPKGQAYVHIESTRGEYGYYMVSDG-GEKPYRVVVRGASYPQTFIGVEKYL
NUOD_PARUW       FKLISEGLHPPVGSVYNCVESARGELGHYVISDG-TPKPYRLRVRSPSFSHVE-VLKKVL
NUOD_FLAJ1       FKIVMGEVPVPVSEIYHAVEGGNGELGFYLATDG-SRTPYRLHFRRPCFIYYQ-AFPEMI
NUOD_FLAPJ       FKIVMGEVPVPVAEIYHAVEGGNGELGFYLTTDG-SRTPYRLHFRRPCFIYYQ-AYPEMI
NUOD2_CYTH3      FKIVMGETEIPKGEVYHSIEGANGELGYYLVSDG-GRTPYRLHFRRPCFIYYQ-AYPEMI
NUOD_LEPBA       FKIIMHGVKVPPGEYYHATEAANGELGFYVVSEG-DKSPWRVHVRRPCFWYYQ-AFPEMV
NUOD_LEPBP       FKIIMHGVKVPPGEYYHATEAANGELGFYVVSEG-DKSPWRVHVRRPCFWYYQ-AFPEMV
NUOD_LEPBJ       FKIIMHGVKVPPGEHYMATEAANGELGFYIVSEG-EKSPWRVHVRRPCFWYYQ-SFAELV
NUOD_LEPBL       FKIIMHGVKVPPGEHYMATEAANGELGFYIISEG-EKSPWRVHVRRPCFWYYQ-SFAELV
NUOD_LEPIN       FKIIMHGVKVPPGEYYMATEAANGELGFYIVSEG-EKSPWRVHVRRPCFWYYQ-SFAELV
NUOD_LEPIC       FKIIMHGVKVPPGEYYMATEAANGELGFYIVSEG-EKSPWRVHVRRPCFWYYQ-SFAELV
NUOD1_SORC5      FKIVMEGIKVPAGECYSYTEAGNGELGFYLVSDG-SGTPYRVRIRPPCFATTQ-GLSQLI
NUOD_METI4       FIVVTQGVDVPPGEVYFGGENPKGELGFYIVSKG-GGVPYRLKIRSPSFVNLS-ILPKIL
                                    *   *              . :   :               

NUOD1_RHIME      RGHQLADVSAVLGSLDIVFGEVDR
NUOD1_SINMW      RGHQLADVSAVLGSLDIVFGEVDR
NUOD1_RHIEC      RGHQLADVAAVLGSLDIVFGEVDR
NUOD1_RHIE6      RGHQLADVAAVLGSLDIVFGEVDR
NUOD_RHIL3       RGHQLADVAAVLGSLDIVFGEVDR
NUOD_AGRFC       KGHQLADVTAVLGSLDIVFGEVDR
NUOD_BRUAB       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUA2       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUA1       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUC2       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUSI       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUO2       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUSU       RGHMLADVSAILGSLDIVFGEVDR
NUOD_BRUME       RGHMLADVSAILGSLDIVFGEVDR
NUOD_OCHA4       RGHMLADVSAILGSLDIVFGEVDR
NUOD_CHESB       RGHLLADVTAVLGSLDIVFGEVDR
NUOD_RHILO       RGHLLADVTAVLGSLDIVFGEVDR
NUOD_AZOC5       RGHMLADVSAVLGSLDIVFGEVDR
NUOD_XANP2       RGHMLADVSAVLGSLDIVFGEVDR
NUOD_BRASB       RGHLLADVSAILGSLDIVFGEVDR
NUOD_BRASO       RGHLLADVSAILGSLDIVFGEVDR
NUOD_BRADU       RGHLLADVSAILGSLDIVFGEVDR
NUOD2_NITHX      RGHLLADVSAILGSLDIVFGEVDR
NUOD_NITWN       RGHLLADVSAILGSLDIVFGEVDR
NUOD_RHOP5       RGHLLADVSAILGSLDIVFGEVDR
NUOD_RHOPB       RGHLLADVSAILGSLDIVFGEVDR
NUOD_RHOPS       RGHLLADVSAILGSLDIVFGEVDR
NUOD_RHOP2       RGHLLADVSAILGSLDIVFGEVDR
NUOD_RHOPA       RGHLLADVSAILGSLDIVFGEVDR
NUOD_RHOPT       RGHLLADVSAILGSLDIVFGEVDR
NUOD_METEP       RGHLLADVSCVLGTLDIVFGEVDR
NUOD_METPB       RGHLLADVSCVLGTLDIVFGEVDR
NUOD_METRJ       RGHLLADVSCVLGTLDIVFGEVDR
NUOD_METS4       RGHMLADVSCILGTLDIVFGEVDR
NUOD1_BEII9      RKSMLADVSAILGSLDIVFGEVDR
NUOD2_BEII9      HKHMLADVSAIIGSLDIVFGEIDR
NUOD1_NITHX      RGHMLADVSAIIGSLDIVFGEIDR
NUOD_PARL1       KGHMLADVSAILGSIDIVFGEVDR
NUOD_BARBK       RGHMLADATAILGSIDIVFGEVDR
NUOD_BARHE       RGHMLADATAILGSIDIVFGEVDR
NUOD_BART1       RGHMLADATAILGSIDIVFGEVDR
NUOD_BARQU       RGHMLADATAILGSIDIVFGEVDR
NUOD_CAUVC       RGHQLADVSAILGSLDIVFGEIDR
NUOD_CAUSK       RGHQLADVSAILGSLDIVFGEVDR
NUOD_PHEZH       RGHMLADVSAILGSLDIVFGEIDR
NUOD_MARMM       KGHMLADVSAIIGSLDVVFGEIDR
NUOD_RUEPO       RGHQLADVAAIIGTMDIVFGEIDR
NUOD_RUEST       KGHQLADVAAIIGTMDIVFGEIDR
NUOD_ROSDO       RGHQLADVAAIIGTMDVVFGEIDR
NUOD_DINSH       KGHQLADVAAIIGTMDVVFGEIDR
NUOD_RHOS4       KGHLLADVSAIIGTLDVVFGEIDR
NUOD_RHOS1       KGHLLADVSAIIGTLDVVFGEIDR
NUOD_RHOS5       KGHLLADVSAIIGTLDVVFGEIDR
NUOD_JANSC       KGHQLADVSAVLGSLDIVFGEVDR
NUOD_PARDP       RGHMLADVPAIIATLDIVFGEVDR
NUOD_HYPNA       KGHQLADVSAVLGTLDIVFGEIDR
NUOD_PELUB       KGHMLADVPAVLGSLDIVFGEVDR
NUOD_RICBR       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICB8       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICCN       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICM5       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICRO       QGHLMADVITIIATLDIVFGEIDR
NUOD_RICRS       QGHLMADVITIIATLDIVFGEIDR
NUOD_RICFE       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICAH       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICCK       KGHLMADVITIIATLDIVFGEIDR
NUOD_RICPR       KGHLIADVITIIATLDIVFGEIDR
NUOD_RICTY       KGHLISDVITIIATLDIVFGEIDR
NUOD_ORITB       RGHSLSDIITIIATLDIVFGEIDR
NUOD_ORITI       RGHSLSDIITIIATLDIVFGEIDR
NUOD_ANAMM       RGHMLADLTAIIGSLDIVFGEIDR
NUOD_ANAPZ       RGHMLADLPVIIGSLDIVFGEIDR
NUOD_EHRCJ       KGHMLADLTAIIGSLDIVFGEIDR
NUOD_EHRCR       KGHMLADLTAIIGSLDIVFGEIDR
NUOD_EHRRG       KGHMLADLTAIIGSLDIVFGEIDR
NUOD_EHRRW       KGHMLADLTAIIGSLDIVFGEIDR
NUOD_WOLPP       KGHMLADIAAIIGSLDIVFGEIDR
NUOD_WOLPM       KGHMLADVAAIIGSLDIVFGEIDR
NUOD_WOLTR       KGHMLADVAAIIGSLDIVFGEIDR
NUOD_NEOSM       RKHLLADVPAILGSLDIVFGEVDR
NUOD_MAGSA       KGHMLADVVANIGSIDIVFGEIDR
NUOD_RHORT       RGHMLADVVANIGSIDVVFGEIDR
NUOD_GLUDA       RRHMLADAVAIIGSLDLVFGEIDR
NUOD_GRABC       HRHMLADAVVIIGSLDLVFGEVDR
NUOD_ACICJ       KGHLLADAIAVLGSIDIVFGEVDR
NUOD_ERYLH       KGHMLPDATAILGAIDVVFGECDR
NUOD_NOVAD       KGHMLPDATAILGAIDVVFGECDR
NUOD_SPHAL       KGHMLADTTAIIGAIDVVFGECDR
NUOD_SPHWW       KGHMLADTTAILSAIDVVFGECDR
NUOD_ACIAC       RGHMIADAVAIIGTMDIVFGEIDR
NUOD_ACISJ       RGHMLADAVAIIGTMDIVFGEIDR
NUOD_DELAS       RGHMLADAVMVLSTLDIVFGDVDR
NUOD_LEPCP       RGHMIADAVAIIGTMDIVFGEIDR
NUOD_METPP       RGHMIADAVAVIGTMDIVFGEIDR
NUOD_CHRVO       TGHMIADVVAIIGTQDIVFGEIDR
NUOD_RHOFT       RGHMIGDAVAIIGSLDIVFGEVDR
NUOD_AZOSB       RGHMIADVVAIIGTMDVVFGEIDR
NUOD_AROAE       RGHMIADVVAIIGTMDVVFGEIDR
NUOD_METFK       RGHMIADLVAIIGTQDIVFGEIDR
NUOD_BORA1       RGHMIADAVTIIGTQDIVFGEIDR
NUOD_BORPE       RGHMIADAVTIIGTQDIVFGEIDR
NUOD_HYDCU       KGHMIADVVAIIGTQDIVFGEVDR
NUOD_ACIF5       RGHMIADVVAILSTMDIVFGEIDR
NUOD_NEIG1       KGHMLADVVAIIGTQDIVFGEVDR
NUOD_NEIG2       KGHMLADVVAIIGTQDIVFGEVDR
NUOD_NEIMA       KGHMLADVVAIIGTQDIVFGEVDR
NUOD_NEIMB       KGHMLADVVAIIGTQDIVFGEVDR
NUOD_NEIM0       KGHMLADVVAIIGTQDIVFGEVDR
NUOD_NEIMF       KGHMLADVVAIIGTQDIVFGEVDR
NUOD_XANOR       RGYLLADVVAMIGTYDLVFGEVDR
NUOD_XANOM       RGYLLADVVAMIGTYDLVFGEVDR
NUOD_XANOP       RGYLLADVVAMIGTYDLVFGEVDR
NUOD1_STRM5      RGHMLADVVAMIGTYDIVFGEVDR
NUOD_MAGMM       RGHMIADVTTIIGSIDIVFGEIDR
NUOD2_RHIME      NARYLADMIAVLGSLDPVMAEVDK
NUOD2_SINMW      NARYLADMIAVLGSLDPVMAEVDK
NUOD2_RHIEC      NARYLADMIAVLGSLDPVMAEVDK
NUOD2_RHIE6      NARYLADMIAVLGSLDPVMAEVDK
NDHH_CAPBU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_NASOF       KRMKLADIMTILGSIDIIMGEVDR
NDHH_BARVE       KRMKLADIMTILGSIDIIMGEVDR
NDHH_ARATH       KRMKLADIMTILGSIDIIMGEVDR
NDHH_DRANE       KRMKLADIMTILGSIDIIMGEVDR
NDHH_ARAHI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_OLIPU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_LEPVR       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CRUWA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_LOBMA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_AETCO       KRMKLADIMTILGSIDIIMGEVDR
NDHH_AETGR       KRMKLADIMTILGSIDIIMGEVDR
NDHH_SOYBN       KRMKLADIMTILGSIDIIMGEVDR
NDHH_PHAVU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_LOTJA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CICAR       KRMKLADIMTILGSIDIIMGEIDR
NDHH_CUCSA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_MORIN       KRMKLADIMTILGSIDIIMGEVDR
NDHH_OENEH       KRMKLADIMTILGSIDIIMGEVDR
NDHH_OENBI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_OENGL       KRMKLADIMTILGSIDIIMGEVDR
NDHH_OENAR       KRMKLADIMTILGSIDIIMGEVDR
NDHH_OENPA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_EUCGG       KRMKLADIMTILGSIDIIMGEVDR
NDHH_GOSBA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_GOSHI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CITSI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CARPA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_IPOPU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_PELHO       KRMKLADIMTILGSIDIIMGEVDR
NDHH_POPAL       KRMKLADIMTILGSIDIIMGEVDR
NDHH_POPTR       KRMKLADIMTILGSIDIIMGEVDR
NDHH_MANES       KRMKLADIMTILGSIDIIMGEVDR
NDHH_SOLLC       KRMKLADIMTILGSIDIIMGEVDR
NDHH_SOLBU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_SOLTU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_TOBAC       KRMKLADIMTILGSIDIIMGEVDR
NDHH_NICSY       KRMKLADIMTILGSIDIIMGEVDR
NDHH_ATRBE       KRMKLADIMTILGSIDIIMGEVDR
NDHH_NICTO       KRMKLADIMTILGSIDIIMGEVDR
NDHH_COFAR       KRMKLADIMTILGSIDIIMGEVDR
NDHH_JASNU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_SPIOL       KKMKLADIMTILGSIDIIMGEVDR
NDHH_VITVI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_DAUCA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_PANGI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_FAGEA       KRMKLADIMTILGSIDIIMGEIDR
NDHH_GUIAB       KRMKLADIMTILGSIDIIMGEVDR
NDHH_HELAN       KRMKLADIMTILGSIDIIMGEVDR
NDHH_LACSA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_PLAOC       KRMKLADIMTILGSIDIIMGEVDR
NDHH_NANDO       KRMKLADIMTILGSIDIIMGEVDR
NDHH_RANMC       KRMKLADIMTILGSIDIIMGEVDR
NDHH_BUXMI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_AMBTC       KRMKLADIMTILGSIDIIMGEVDR
NDHH_DIOEL       KRMKLADIMTILGSIDIIMGEVDR
NDHH_ILLOL       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CHLSC       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CALFG       KRMKLADIMTILGSIDIIMGEVDR
NDHH_DRIGR       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CERDE       KRMKLADIMTILGSIDIIMGEVDR
NDHH_LIRTU       KRMKLADIMTILGSIDIIMGEVDR
NDHH_NUPAD       KRMKLADIMTILGSIDIIMGEVDR
NDHH_NYMAL       KRMKLADIMTILGSIDIIMGEVDR
NDHH_PIPCE       KRMKLADIMTILGSIDIIMGEVDR
NDHH_ACOAM       KRMKLADIMTILGSIDIIMGEVDR
NDHH_ACOCL       KRMKLADIMTILGSIDIIMGEVDR
NDHH_HORVU       KKMKLADIMTILGSIDIIMGEVDR
NDHH_WHEAT       KKMKLADIMTILGSIDIIMGEVDR
NDHH_BRADI       KKMKLADIMTILGSIDIIMGEVDR
NDHH_ORYNI       KKMKLADIMTILGSIDIIMGEVDR
NDHH_ORYSA       KKMKLADIMTILGSIDIIMGEVDR
NDHH_ORYSI       KKMKLADIMTILGSIDIIMGEVDR
NDHH_ORYSJ       KKMKLADIMTILGSIDIIMGEVDR
NDHH_LOLPR       KKMKLADIMTILGSIDIIMGEVDR
NDHH_AGRST       KKMKLADIMTILGSIDIIMGEVDR
NDHH_SACHY       KKMKLADIMTILGSIDIIMGEVDR
NDHH_SACOF       KKMKLADIMTILGSIDIIMGEVDR
NDHH_SORBI       KKMKLADIMTILGSIDIIMGEVDR
NDHH_MAIZE       KKMKLADIMTILGSIDIIMGEVDR
NDHH_LEMMI       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CRYJA       KRMKLADIMTILGSIDIIMGEVDR
NDHH_CYCTA       KSMKLADIMTILGSIDIIMGEVDR
NDHH_ANTAG       KGMKLADIMTILGSIDIIMGEVDR
NDHH_ANGEV       KGMKLADIMTILGSIDIIMGEVDR
NDHH_MARPO       KGMKLADIMTILGSIDIIMGEVDR
NDHH_PHYPA       KGMKLADIMTILGSIDIIMGEVDR
NDHH_HUPLU       EGVKLADIMTILGSIDITMGEVDR
NDHH_ADICA       RGMKLADIVTILGSIDIIMGEVDR
NDHH_PSINU       RGMKLADIMPILGSIDIIMGEIDR
NDHH_CHAGL       KGMKLADIMTILGSIDIIMGEVDR
NDHH_CHAVU       NGMKLADIMTILGSIDIIMGEVDR
NDHH_STAPU       RGVKLADIMTILGSIDIIMGEVDR
NDHH_ZYGCR       IGMKLADIMTILGSIDIIMGEVDR
NDHH_MESVI       RGMKLADIMTILGSIDIIMGEVDR
NDHH_CHLAT       QGMKLADIMTILGSIDIIMGEVDR
NDHH_NEPOL       QGMKLADIMTILGSIDIIMGEVDR
NDHH1_GLOVI      QGTKLADLMAILGSVDIIMGEVDR
NDHH_NOSS1       RGMKVADVVVILGSIDVIMGSVDR
NDHH_THEEB       KGMKVADIVAILGSIDVIMGSVDR
NDHH_SYNY3       KGVKVADIMAILGSIDIIMGSVDR
NUOD_AMOA5       KGQVLADLIAIIGSIDIVLGEIDR
NUOD1_CYTH3      KNVMIADLVAILGSFDIVMGEIDR
NUOD_CHLP8       KGQLLPDLVAIIGSIDIVLGEVDR
NUOD_CHLTE       KGQLIPDLVAIIGSIDIVLGEVDR
NUOD_CHLL2       KGQLIPDLVAIIGSIDIVLGEVDR
NUOD_CHLPD       KGQLIPDLVAIIGSIDIVLGEVDR
NUOD_PELLD       KGQLIPDLVAIIGSIDIVLGEVDR
NUOD_CHLPM       RGQLIPDLVAIIGSLDIVLGEVDR
NUOD_PELPB       KGQLIPDLVAIIGSIDIVLGEVDR
NUOD_CHLCH       KGQLIPDLVAIIGSIDIVLGEVDR
NUOD_CHLPB       LGQLIPDLVAIIGSIDIVLGEVDR
NUOD_PROA2       MGQLIPDLVAIIGSIDIVLGEVDR
NUOD2_CHLT3      KGQYIADVVAIIGSVDIVLGEVDR
NUOD2_ANADE      RGLMVADLVALISSLDVVAPEIDR
NUOD1_ANASK      RGLMVADLVALISSLDVVAPEIDR
NUOD1_ANADF      GGLMVADLVALISSLDVVAPEIDR
NUOD2_SORC5      PGLFLADLVALIASFDVVAPEIDR
NUOD_BACAN       KGENIANLITILGGVDIVLGEVDG
NUOD_BACCR       KGENIANLITILGGVDIVLGEVDG
NUOD_BACAH       KGENIANLITILGGVDIVLGEVDG
NUOD_BACCZ       KGENIANLITILGGVDIVLGEVDG
NUOD_BACHK       KGENIANLITILGGVDIVLGEVDG
NUOD_BACC1       KGENIANLITILGGVDIVLGEVDG
NUOD_BACMK       KGENIANLITILGGVDIVLGEVDG
NUOD_BACCN       KGENIANLITILGGVDIVLGEVDG
NUOD_GEOKA       KGENLANVIAILGSIDIVLGEVDG
NUOD_GEOTN       KGENLANVIAILGSIDIVLGEVDG
NUOD_DESPS       QGMLIADALALMGSLDLVIPEIDR
NUOD2_OPITP      RGMLLPDALAMMGSLDLVIPDIDR
NUOD_SYNFM       RGTLVADAISILGSVDLVIPEIDR
NUOD2_SALAI      PGCLVPDLIAILGSMFFVVGDIDK
NUOD2_SALTO      PGCLVPDLVAILGSMFFVVGDIDK
NUOD2_STRAW      PGTLVADMVAILGSLFFVVGDIDK
NUOD1_STRCO      PGTLVADMVAILGSLFFVVGDIDK
NUOD2_STRGG      PGTLVADMVAILGSLFFVVGDIDK
NUOD_RUBXD       PGHYLPDIMPIMGLVDPVSGGWDK
NUOD_DESHY       VGTYIQDLIASFASLDAVLGEVDK
NUOD_HELMI       RGFKIGDVVAILGTLDPVLGEVDC
NUOD_CARHZ       IGTKLADFITIFASIDVVLGDVDC
NUOD2_SYMTH      PGHKIADIIAILGSIDVVLGEVDR
NUOD_CAMJE       VGTYLADVVAIMGNVNIVLGEIDR
NUOD2_ROSCS      RGHKVADVVVILGSIDIVMGEVDR
NUOD1_ROSS1      RGHKVADVVVILGSIDIVMGEVDK
NUOD2_HERA2      KGYSIADVVVILGSIDIVMGEVDR
NQO4_THET8       KGEQVPDMVAIIASLDPVMGDVDR
NUOD_THET2       KGEQVPDMVAIIASLDPVMGDVDR
NUOD_DEIRA       VGVQFADLITILATIDPVLGDVDR
NUOD_DEIGD       VGGQFADLITILASIDPVLGDVDR
NUOD2_KORVE      TGQLLADVVAAIGSIDIVLGDCDR
NUOD1_SOLUE      EGSLIADVIASIGSMDFVLGDTDR
NUOD1_ROSCS      RGHLVADLVALIASLDPVLGEVDR
NUOD2_ROSS1      RGHLVADLVALIASLDPVLGEVDR
NUOD2_CHLAA      KGRMVADLVALIASLDPVLGEVDR
NUOD1_HERA2      KGKLMADLVALIASIDPVLGEVDR
NUOD_GEOMG       KGSMIADLVAVIGTLDIVLGEIDR
NUOD_GEOSL       KGSMIADLVAVIGTLDIVLGEIDR
NUOD_GEOBB       KGSMIADLVAVIGTLDIVLGEIDR
NUOD_GEOUR       KGAMIADLVAVIGTLDIVLGEIDR
NUOD_GEOLS       KGAMLADLVAIIGTLDIVLGEIDR
NUOD_MYCBP       EGGMVADLIAAVASIDPVMGGVDR
NUOD_MYCTA       EGGMVADLIAAVASIDPVMGGVDR
NUOD_MYCTU       EGGMVADLIAAVASIDPVMGGVDR
NUOD_MYCBO       EGGMVADLIAAVASIDPVMGGVDR
NUOD_MYCMM       EGGMVADLITAVASIDPVMGGVDR
NUOD_MYCUA       EGGMVADLITAVASIDPVMGGVDR
NUOD_MYCA1       EGGMVADLITAVASIDPVMGGVDR
NUOD_MYCPA       EGGMVADLITAVASIDPVMGGVDR
NUOD_MYCGI       EGGMVADAITAVASIDPVMGGVDR
NUOD_MYCVP       EGGMVADAITAVASIDPVMGGVDR
NUOD_MYCSJ       EGGMVADAISAVASIDPVMGGVDR
NUOD_MYCSK       EGGMVADAISAVASIDPVMGGVDR
NUOD_MYCSS       EGGMVADAISAVASIDPVMGGVDR
NUOD_MYCS2       EGGMVADAIAAVASIDPVMGGVDR
NUOD_MYCA9       EGAMVADLIAAVASIDPVMGGVDR
NUOD_NOCFA       EGGMVADVIAAVASIDPVMGGVDR
NUOD_RHOJR       EGGMVADVIAAVASIDPVMGGVDR
NUOD1_STRAW      EGGQVADVIVAVASIDPVMGGVDR
NUOD2_STRCO      EGGQVADVIVAVASIDPVMGGVDR
NUOD1_STRGG      EGGQVADVIVAVASIDPVMGGVDR
NUOD_NOCSJ       EGGMVADVIVAIASIDPVMGGVDR
NUOD_THEFY       EGGTVADVIAAVASIDPVMGGVDR
NUOD_FRAAA       EGGQVADVIVGVASVDPVLGGVDR
NUOD_FRACC       EGGQVADVIVGVASVDPVLGGVDR
NUOD_FRASN       EGGQVADVIVGVASVDPVLGGVDR
NUOD1_SALAI      EGGLIADVIAGGASLDPVMGGCDR
NUOD1_SALTO      EGGLIADVIAGGASLDPVMGGCDR
NUOD_ACIC1       EGGMVADVIAAVASIDPVMGGCDR
NUOD_SACEN       EGGLMADAIASLASLDPVMGGVDR
NUOD_CUTAK       EGGMLSDVVPSLASLDPVMGGVDR
NUOD1_SYMTH      EGHLLSDMVGAIATIDPVFGEVDR
NUOD_THEM4       PGTRIEDVPIWLSTMDVCAPEVDR
NUOD_PARUW       RGHVISDVVVAIASVDPILGDVDR
NUOD_FLAJ1       KGALLSDAIIILSSLNVIAGELDA
NUOD_FLAPJ       KGALLSDAIVILSSLNVIAGELDA
NUOD2_CYTH3      KGQLISDAVVTMSSLNLIAGEMDA
NUOD_LEPBA       KGGLLADTIATMSSLNVIAGELDC
NUOD_LEPBP       KGGLLADTIATMSSLNVIAGELDC
NUOD_LEPBJ       RGGLLADSVATMSSLNVIAGELDC
NUOD_LEPBL       RGGLLADSVATMSSLNVIAGELDC
NUOD_LEPIN       RGGLLADSVATMSSLNVIAGELDC
NUOD_LEPIC       RGGLLADSVATMSSLNVIAGELDC
NUOD1_SORC5      TGLMIPDVVPTFGSLNMIGGECDH
NUOD_METI4       PGHLLSDVVAILGSLDFVMGECDR
                     . :     .         *