CLUSTAL format seed alignment for MF_01359

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUOCD_ACICJ      --------MLTEFNSIPATEAEQG---IVSDLVRTLGPISFT-------LQQTA-DRIPT
NUOCD_GLUDA      ---MIVPDLVADAMTAGPPAAKSGDGATMFGQVSDLGPGTVL-------AVETARDGVPT
NUOCD_NITOC      ----------MRSSLQQPTPPMAGFTPIAEILYHQFGEANF--------IRQETHDGVPT
NUOCD_NITMU      ---MSAASSLAPQRYMQDMGGASNASDVLEELKNRFGPPGTDNPGGPMGVVQKTGDDLPT
NUOCD_METCA      ----------------MAAPTTEHAETIVPALCRRFGGETF--------VQQTTADGIST
NUOCD_SHIB3      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SHISS      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOHS      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECO24      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOSM      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOLC      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SHIBS      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SHIDS      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SHIFL      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOL5      ----MTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SHIF8      ----MTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECO57      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOK1      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOL6      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOUT      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECOLI      ----MTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ECODH      MVNNMTDLTAQEPA---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_CITK8      MVNNMTDLTAQDAV---WQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_ENT38      ----MTDLTAQ-AA---CLTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SALDC      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALEP      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALG2      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALHS      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALTI      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALTY      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALCH      ----MTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALA4      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALPA      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALPK      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALPB      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALSV      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALNS      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGIPV
NUOCD_SALAR      MVNNMTDLTAQDAA---WSTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_KLEP7      MVNNMTDLTAHDAAPA-WQTRDHLDDPVIGELRNRFGPDAFTV--------QPTRTGVPV
NUOCD_CROS8      MVNNMTDLTAQDAVLPVWQTRDHLDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_SERP5      ----MTDSTTHDALPA-WQTRDHLDDPVIGELRNRFGPEAFTV--------QPTRTGMPV
NUOCD_ERWT9      ----MTDLTAQELAQPSWQTRDHQDDPVIGELRNRFGPDAFTV--------QATRTGVPV
NUOCD_PECAS      ----MTDLTTHDLAQPGWQTRDHLNDPVVGELCNRFGPDAFTV--------QATRTGIPV
NUOCD_PHOLL      ---MMIDQIAQESARPAWQTHDHLDDPVMGELRNHFGPDAFTV--------QPTRTGIPV
NUOCD_PROMH      ----MTDQIAQNSARPAWETSDHIDDQVVNELRQKFGPDAFTF--------QPTRTGMPV
NUOCD_YERPE      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPP      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPA      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPN      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPS      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPB      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERP3      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPY      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERPG      ----MTDLTTSDSLQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_YERE8      ----MTDLTTSDSTQPAWQTRDHLDDPVIGELSNRFGPEAFVV--------QATRTGMPV
NUOCD_SODGM      ----MTELMTQNSALPVWQSQDHQDDPVIAELRNHFGPDAFSV--------QPTRTGIPV
NUOCD_BUCAI      ---MIDLMPKKNTFLLKKKYKEDSNNSVINNLFDFFGKEFCFH--------QITLTGFPI
NUOCD_BUCAP      ---MIDENKKKNTNLNKNEYEE---KSILKDLFHFFGKDFCVV--------QDTCIDFPV
NUOCD_BUCBP      ---MKKEIKRDDVNVIEKDFGN--NNSIILKLFKKFGEDSFFI--------QTTVTDIIV
NUOCD_BUCCC      ---------------------------MILSLFKLFGKENFFI--------QDSYLESPI
NUOCD_BLOFL      --------MMNDNKYIHIDSCVIEKHKIWDSLITKFGSHDLIL--------QSAYIDSLI
NUOCD_BLOPB      ----MVDIMCNDSTGV---SLVKNIYPILDDLFSVFSSVDFVL--------QPTHTGILI
NUOCD_BAUCH      --------MNKNICLSASHKQNNRDDPIINELINYFGNETFTI--------QSTRIGVPV
NUOCD_AERS4      --MKLTRDFPSNYTMAQWQPSDHQDAQVVGELFSHFGAERFTV--------QSTRTGVPV
NUOCD_SHEON      --MKLTRDFPHNDTMAQWQPSDHKDAKVVGELFAHFGAEHFTV--------QTTRTGVPV
NUOCD_AERHH      --MKLTREFPSNYAMAQWQPSDHKDAQVIGELFAHFGAERFTI--------QNTRTGVPV
NUOCD_PSEAE      ---------MTADSALYIPPYKADDQDIVVELNSRFGAETFTV--------QPTRTGMPV
NUOCD_PSEAB      ---------MTADSALYIPPYKADDQDIVVELNSRFGAETFTV--------QPTRTGMPV
NUOCD_PSEA7      ---------MTADSALYIPPYKADDQDIVVELNSRFGAETFTV--------QPTRTGMPV
NUOCD_PSEP1      ---------MTADNAIFIPPYKADDQDVVVELNNRFGAEAFVA--------QETRTGMPV
NUOCD_PSEPK      ---------MTADNAIFIPPYKADDQDVVVELNNRFGADAFVA--------QETRTGMPV
NUOCD_PSEPG      ---------MTADNAIFIPPYKADDQDVVVELNNRFGAEAFVA--------QETRTGMPV
NUOCD_PSEPW      ---------MTADNAIFIPPYKADDQDVVVELHNRFGAEAFVA--------QETRTGMPV
NUOCD_PSEE4      ---------MTADNAIYIPPYKADDQDVVVELHNRFGADAFVA--------QETRTGMPV
NUOCD_PSEF5      ---------MTTGSALYIPPYKADDQDVVVELNNRFGPEAFTA--------QATRTGMPV
NUOCD_PSEPF      ---------MTTGSALYIPPYKADDQDVVVELNNRFGAEAFTA--------QPTRTGMPV
NUOCD_PSE14      ---------MTADNALYIPPYKADDQDVVVELNTHFGAEAFTA--------QPTRTGMPV
NUOCD_PSEU2      ---------MTADNALYIPPYKADDQDVVVELNNRFGAEAFTA--------QPTRTGMPV
NUOCD_PSESM      ---------MTADNALYIPPYKADDQDVVVELNNRFGAEAFTA--------QPTRTGMPV
NUOCD_PSEMY      ---------MTADTAVSIPPYQVDDQDVIAELRARLGDDGFTL--------QATRTGMPV
NUOCD_ACIBC      ------MAETDIAMPESTPVDSRPAFAIVEELKTKFG-ENFYV--------QATFEEFPT
NUOCD_ACIBT      ------MAETDIAMPESTPVDSRPAFAIVEELKTKFG-ENFYV--------QATFEEFPT
NUOCD_ACIBY      ------MAETDIAMPESTPVDSRPAFAIVEELKTKFG-ENFYV--------QATFEEFPT
NUOCD_ACIBS      ------MAETDIAMPESTPVDSRPAFAIVEELKTKFG-ENFYV--------QATFEEFPT
NUOCD_ACIAD      ------MAETDIAMPESTPVDSRPAFAIVEELKTKFG-ENFYV--------QTTCEEFPT
NUOCD_PSYA2      ------MVT----VVENIDPKIKPVPAVIKELEEKYA-GKFVV--------QHTVDEIPT
NUOCD_PSYCK      ------MVT----VVENTDPKIKPVPAVIKELEEKYA-GKFVV--------QHTVDDIPT
NUOCD_PSYWF      ------MVTDNSKATDNSANPNMTQHAVLRELGHKFA-GKFTE--------QFTFDGIPT
NUOCD_CHRSD      ----------MSAAQSPTAQHAHAEDPVVQALFARFGQHVFVA--------QATHTGMPV
NUOCD_SHEWM      --MSIFTQEVSAINGQSGNIKQMLTLEMLPELKSLLS-DSVEQ--------QICIDGILT
NUOCD_RHOS4      ------------------MSLDQAIPEALQALRTRFGAAVRAE--------QATGEAFPV
NUOCD_RHOS1      ------------------MSLDQAIPEALQALRTRFGAAVRAE--------QATGEAFPV
NUOCD_RHOS5      ------------------MSFDQVIADALQALRSRFGADILSE--------QATGEGFPV
NUOCD_RHOPA      ----------------------MSAFELVTELSARFKDAVLGE--------QMTADRFPT
NUOCD_RHOPT      ----------------------MSASELVTELSTRFKDAVLSE--------QMTADRFPT
NUOCD_RHOPS      ----------------------MSGTDLVSELSARFGDAVLGE--------QITRERFPT
NUOCD_RHOP2      ----------------------MSATDLVSELGARFGDAVLGE--------QTTRERFPT
NUOCD_RHOP5      ----------------------MSGAELISDLRARFGQAVLSE--------QSTNDAFPT
NUOCD_RHOPB      ----------------------MSAVELVNELSARFGEAVFGE--------QPTHDAFPT
                                                                    :        

NUOCD_ACICJ      IWIDRDIVHAVLRHLRDGATRRFQMLYDLTAIDERQRVHRDGLP-KSDFTLVYHLVSFE-
NUOCD_GLUDA      AWIAPTSLRAVVGMLREPAAA-LRMLFDLTAIDERQRAHRVGQP-DCAFTLVCHFMALGG
NUOCD_NITOC      FWITKAQVSKILRYLKAELAPPYPMLYDLTAIDERVRTHRPGQP-ASDFTLVYHLLSFI-
NUOCD_NITMU      QWVSRNRVHEVLHYLKLKAERPYRMLYDLTAIDERTRVHREDQP-ASRFTVIYHLLSFE-
NUOCD_METCA      LWLPARILVETIRYLRSEIDRPYALLFDLTAVDERVRKHRDGMP-ASAYTVVYHLVSLE-
NUOCD_SHIB3      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_SHISS      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOHS      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECO24      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOSM      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOLC      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_SHIBS      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_SHIDS      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_SHIFL      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOL5      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_SHIF8      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECO57      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOK1      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOL6      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOUT      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECOLI      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_ECODH      VWIKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHREGLP-AADFSVFYHLISID-
NUOCD_CITK8      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISID-
NUOCD_ENT38      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRHGLP-AADFSVFYHLISID-
NUOCD_SALDC      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALEP      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALG2      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALHS      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALTI      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALTY      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALCH      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALA4      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALPA      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALPK      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALPB      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALSV      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALNS      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_SALAR      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_KLEP7      VWVKREQLLEVGDFLKKLPK-PYVMLFDLHGMDERLRTHRDGLP-AADFSVFYHLISID-
NUOCD_CROS8      VWVKREQLLEVGEFLRKLPK-PYVMLYDLHGMDERLRTHRNGLP-AADFSVFYHLLSID-
NUOCD_SERP5      VWVKPDQLLEVMTFLRKQPK-PYVMLFDLHGVDERLRTHRDGLP-AADFSVFYHLISIE-
NUOCD_ERWT9      VWVKREQLLEIVEFLRKLPK-PYVMLYDLHGMDERLRTHRAGLP-AADFSVFYHFISIE-
NUOCD_PECAS      VWVKREQLLDVVTFLKKQPK-PYVMLFDLHGMDERLRTHREGLP-AADYSVFYHLISIE-
NUOCD_PHOLL      VWVKREQLLEVMTFLKKLPK-PYVMLFDLHGMDERQRTHRQGLP-AADFSVFYHLLSIE-
NUOCD_PROMH      VWVKREQLIEVMQYLKSLPK-PYVMLYDLHGVDERVRTHRQGLP-AADFSVFYHLISLD-
NUOCD_YERPE      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPP      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPA      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPN      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPS      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPB      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERP3      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPY      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-DADFSVFYHLLSIE-
NUOCD_YERPG      VWVKREQLLEVMSFLRKQPK-PYVMLFDLHGVDERLRTHSQGLP-DADFSVFYHLLSIE-
NUOCD_YERE8      VWVKREQLLEVMTFLRKQPK-PYVMLFDLHGVDERLRTHRQGLP-AADFSVFYHLLSIE-
NUOCD_SODGM      VWVKREQILKVLTFLKKLPK-PYVMLYDLHGVDERLRTHRQGLP-AADFTVFYHLISID-
NUOCD_BUCAI      IWIDKTLLIEVGKFLYHLSQ-PYIMLYDLHGVDERIRLHREDLP-KADFSVFYHLISIE-
NUOCD_BUCAP      IWINKSLLLKVGKFLSSSPK-PYNMLFDLHGVDERFRLNRLNLP-EADFSIFYHLISIE-
NUOCD_BUCBP      LWIDGSLLLALAKFLLTINN-PYNMLFDLYGIDERMRLYKHNLP-LSHFSVVYHFISIN-
NUOCD_BUCCC      LWIDSTILIQVIGFLKKNNTCSYEILFDLFGIDERTRKNVKSFP-NADFTVSYYFFSIS-
NUOCD_BLOFL      IWIPKERIIPIMEFLKQILA-PHVMLYDLHGIDERLRMYRKELP-EADFTVFYHIMSMS-
NUOCD_BLOPB      IWIKREMVIPVLTFLKTTSK-PYIMLYDLHGIDERLRIHREGLP-ESDFTVFYHLISIL-
NUOCD_BAUCH      VWVTREQILDFLIFLKKKPN-SYLMLYDLHGVDERLRNNREGLP-AVDFTVFYHLLSIK-
NUOCD_AERS4      IWLARELLLDVVGFLRKLPS-PFVMLYDLSATDERLRSHRDGLP-QSDFTVFYHFISID-
NUOCD_SHEON      VWLPRELLQDVVGFLRKLPA-PFVMLYDLSATDERLRSHRDGLP-QSDFTVFYHLISID-
NUOCD_AERHH      VWLSRELLLDVMGFLRKLPS-PFVMLFDLSATDERMRSHRHDLP-DSDFTVFYHLISID-
NUOCD_PSEAE      LWVPRERLIEVLTFLRQVPK-PYVMLYDLHGVDERLRTHRRGLP-SADFSVFYHLMSLE-
NUOCD_PSEAB      LWVPRERLIEVLTFLRQVPK-PYVMLYDLHGVDERLRTHRRGLP-SADFSVFYHLMSLE-
NUOCD_PSEA7      LWVPRERLIEVLTFLRQVPK-PYVMLYDLHGVDERLRTHRRGLP-NADFSVFYHLMSLE-
NUOCD_PSEP1      LWVKRAQLKEVLSFLRGVAK-PYSMLYDLHGVDERLRTQRRGLP-AADFSVFYHLLSIE-
NUOCD_PSEPK      LWVKRAQLKEVLSFLRGVAK-PYSMLYDLHGVDERLRTQRRGLP-AADFSVFYHLLSIE-
NUOCD_PSEPG      LWVKRAQLKEVLSFLRGVAK-PYSMLYDLHGVDERLRTQRRGLP-AADFSVFYHLLSVE-
NUOCD_PSEPW      LWVKRAQLKEVLSFLRGVSK-PYSMLYDLHGVDERLRTQRRGLP-AADFSVFYHLLSVE-
NUOCD_PSEE4      LWVKRAQLKEVLSFLRGVAK-PYSMLYDLHGVDERLRTQRRGLP-AADFSVFYHLLSVE-
NUOCD_PSEF5      LWVTRSKLVEVLTFLRNLPK-PYVMLYDLHGVDERLRTKRQGLP-GADFSVFYHLLSIE-
NUOCD_PSEPF      LWVARAKLVEVLTFLRNLPK-PYVMLYDLHGVDERLRTKRQGLPSGADFTVFYHLMSLE-
NUOCD_PSE14      LWVERARLFEILTFLRNVPK-PYSMLYDLHGVDERLRTNRRGLP-GADFTVFYHLLSIE-
NUOCD_PSEU2      LWVERARLFEILTFLRNVPK-PYSMLYDLHGVDERLRTNRRGLP-GADFTVFYHLLSIE-
NUOCD_PSESM      LWVERARLFEILTFLRNVPK-PYSMLYDLHGVDERLRTNRRGLP-GADFTVFYHLLSIE-
NUOCD_PSEMY      LWVSRERLLEVLKCLRHLPR-PYVMLYDLHGVDERLRTQRRGLP-DADFTVFYHLMSLE-
NUOCD_ACIBC      VWVERARVQEVLMFLRKVER-PYVMLFDLSAMDERLRQHRDGLP-ASDFTVFYHLLSLE-
NUOCD_ACIBT      VWVERARVQEVLMFLRKVER-PYVMLFDLSAMDERLRQHRDGLP-ASDFTVFYHLLSLE-
NUOCD_ACIBY      VWVERARVQEVLMFLRKVER-PYVMLFDLSAMDERLRQHRDGLP-ASDFTVFYHLLSLE-
NUOCD_ACIBS      VWVERARVQEVLMFLRKVER-PYVMLFDLSAMDERLRQHRDGLP-ASDFTVFYHLLSLE-
NUOCD_ACIAD      VWVERSRVQEVLMFLRKVDR-PYVMLFDLSAMDERLRVHRDGLP-ASDFTVFYHLLSLE-
NUOCD_PSYA2      VWVARADLLDVLLFLRKLPK-PYVMLFDLSAIDERLRQHRQGLP-ESDFTVFYHLMSLE-
NUOCD_PSYCK      VWVARADLLDVLLFLRKLPK-PYVMLFDLSAIDERLRQHRQGLP-DSDFTVFYHLMSLE-
NUOCD_PSYWF      IWVSRQDLLDVLMYLRTLPK-PYVMLLDLSAMDERLRQHRDGLP-ASDFTVFYHLMSLE-
NUOCD_CHRSD      LWLDREYLLEVLNFLRDMPE-PFEMLFDLHGIDERLRSHREDLP-PADFTVFYQLMSIS-
NUOCD_SHEWM      LWIDKTQLIPALRLLKTLPQ-PFDLLLDLFGVDERLRLDKDKLP-AQDFTLVYQLCSIN-
NUOCD_RHOS4      LWLDASVWEAAHRFLREEIAAPFPLLADLWAIDESLRQHRTGQP-ASRITLCSHLVSLV-
NUOCD_RHOS1      LWLDASVWEAAHRFLREEIAAPFPLLADLWAIDESLRQHRTGQP-ASRITLCSHLVSLV-
NUOCD_RHOS5      LWLAAPAWEAAHRFLREEISAPFPLLADLWAIDESQRQHRAGQP-ASRLTLCSHLVSLE-
NUOCD_RHOPA      VWIRPDATIDVHRFLRQEIDRPFKMLVDLWAIDETARKHRDGLP-PSGITIASHLMSHE-
NUOCD_RHOPT      VWIRPDATIDVHRFLRQEIDRPFRMLVDLWAIDETARKHRDGLP-PSGITIASHLMSHE-
NUOCD_RHOPS      VWIRPEASAAVHRFLKHEVDRPFRMLVDLWAIDETARKHREGQP-PSGITIASHLMSHE-
NUOCD_RHOP2      VWIRPEASAAVHRYLKHEVERPFRMLVDLWAIDETARKHREGQP-PSGITIASHLMSHE-
NUOCD_RHOP5      LWIAPDAAPAVHRYLKHDVAKPFALLADLWAIDETARKHREGQP-PSGITIASHLISLG-
NUOCD_RHOPB      LWIKPEAMPALHRYLKHEIERPFPLLVDLWAIDETARHHREGQP-PSGVTIASHLMSLE-
                  *:           *         :* ** . **  *      *     ::   : :   

NUOCD_ACICJ      RNDDVRVKVPLAEGALEVQSIADIWPNANWYEREVWDMFGIGFAGHPTLFRILTPPTWTG
NUOCD_GLUDA      AGDALRLKVPLPAEAPRVPSIADFWPNANWYEREVWDLFGITFEGHPFLRRILTPPTWTG
NUOCD_NITOC      RNEDLRLKVPLQGESPSLPTITPIWPAANWYEREVWDLFGINFEGHPHLSRILLPPTWQG
NUOCD_NITMU      RNADVCLKVALTDTDLRMPTITDIWPAANWYEREIWDMFGIVFDGHPHLRRILLPPWWQG
NUOCD_METCA      RNADVRLKIALPETDPALPSIVAVCPAANWYEREVWDMFGIRFDGHPNLRRLIMPPTWQG
NUOCD_SHIB3      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_SHISS      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOHS      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECO24      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOSM      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOLC      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_SHIBS      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_SHIDS      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_SHIFL      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOL5      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_SHIF8      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECO57      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOK1      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOL6      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOUT      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECOLI      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_ECODH      RNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKG
NUOCD_CITK8      RNRDIMLKVALSENDLHVPTFTKLFPNANWYERETWEMFGITFDGHPHLTRLLMPPTWEG
NUOCD_ENT38      RNRDIMLKVALSENDMRLPTFTKLFPNANWYERETWEMFGMTFDGHPHLTRLLMPPTWTG
NUOCD_SALDC      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALEP      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALG2      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALHS      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALTI      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALTY      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALCH      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALA4      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALPA      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALPK      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALPB      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALSV      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALNS      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_SALAR      RNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEG
NUOCD_KLEP7      RNRDIMLKVALSENDLHLPTFTKLFPNANWYERETWEMFGITFDGHPNLRRIMMPPTWEG
NUOCD_CROS8      RNRDIMLKVALSENDLNVPTFTRLFPNANWYERETWEMFGITFTGHPNLRRIMMPPTWEG
NUOCD_SERP5      RNRDIMLKVALSEKDLHVPTATKVFPNANWYERETWEMFGITFDGHPHLSRIMMPQTWEG
NUOCD_ERWT9      RNRDIMLKVALSENDLHVPTLTKIFPNANWYERETWEMFGIDVVGHPHLTRIMMPQTWEG
NUOCD_PECAS      RNRDIMLKVALAENDMHLPTVTKLFPNANWYERETWEMFGMAFDGHPNLTRIMMPKTWEG
NUOCD_PHOLL      RNRDIMLKVALSEKELNLPTATPLFPNANWYERETWEMFGVVFNGHPNLRRIMLPPTWEG
NUOCD_PROMH      RNKDIMLKVALSEKDLNLPTLTSIFPNSNWYEREVWDMFGIVFNGHPNLRRIMMLPNWEG
NUOCD_YERPE      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPP      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPA      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPN      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPS      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPB      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERP3      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPY      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERPG      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEG
NUOCD_YERE8      RNRDIMLKVALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQTWEG
NUOCD_SODGM      RNRDIMLKVALSENDLHLPTCTRIFPNANWYERETWEMFGMTFDGHTHLTRIMMPKSWEG
NUOCD_BUCAI      RNSDIMIKVPLLENDLILPTFTGLFPNANWYERETWDMFGIIFNNHPNLTRIIMPSTWKG
NUOCD_BUCAP      RNSDILIKVPLLKDDLNVSTFISLFPNANWYERETWEMFGIIFDQHPNLTHIIMPNEWKG
NUOCD_BUCBP      RNSDIILKIALLEEKLSLPTLTKLYPNANWYEREIWDMFGISFENHPNLIRILMPKTWVG
NUOCD_BUCCC      NNSDLILKVALLKEHLQLPTISSIFLNANWYEREIWDMFGIVFNNHPYLTRILMPKNWVG
NUOCD_BLOFL      RNYDVILKVPLLENAMNVTTITSVFMNANWYERETWEMFGIHFDYHPNLTRIIMPKCWKG
NUOCD_BLOPB      RNDDIIIKVPLLEQSLYIDTVVSVFANANWYERETWEMFGIHFNKHPNLTRIIMPKNWNG
NUOCD_BAUCH      SNSDIILKVPLLEGDISLPTATNIFSNANWYERETWDMFGIIFHGHPHLTRIIMPPSWVG
NUOCD_AERS4      RNADVMLKVPLAESDLHLPTLTGHFPNANWYEREVWDLLGITFDGHPHLTRIMMPKSWQG
NUOCD_SHEON      RNADVMLKVALAESDLHLPTITNHFPNANWYEREVWDLMGITFDGHPHLTRIMMPKSWQG
NUOCD_AERHH      RNADLMLKVPLKEGDLTLPTVSRHFPNANWYEREVWDLMGINFDGHPHLTRIMMPKSWQG
NUOCD_PSEAE      RNSDVMIKVALSERDLNLPTATRIWPNANWYEREVWDMYGITFTGHPHLTRMLMPPTWQG
NUOCD_PSEAB      RNSDVMIKVALSERDLNLPTATRIWPNANWYEREVWDMYGITFTGHPHLTRMLMPPTWQG
NUOCD_PSEA7      RNSDVMIKVALSERDLNLPTATRIWPNANWYEREVWDMYGITFTGHPHLTRMLMPPTWQG
NUOCD_PSEP1      RNSDVMIKVSLSEGDLNLPTVTGIWPNANWYEREVWDMFGIDFAGHPHLSRIMMPPTWEG
NUOCD_PSEPK      RNSDVMIKVSLSEGDLNLPTVTGIWPNANWYEREVWDMFGIDFAGHPHLSRIMMPPTWEG
NUOCD_PSEPG      RNSDVMIKVSLSEGDLNLPTVTGIWPNANWYEREVWDMFGIDFAGHPHLSRIMMPPTWEG
NUOCD_PSEPW      RNSDVMIKVSLSEGDLNLPTVTGIWPNANWYEREVWDMFGIDFAGHPHLSRIMMPPTWEG
NUOCD_PSEE4      RNSDVMIKVSLSEGDLNLPTVTGIWPNANWYEREVWDMFGIDFAGHPHLSRIMMPPTWEG
NUOCD_PSEF5      RNSDVMIKVALSEGDLSLPTVTGIWPNANWYEREVWDMFGIDFAGHPHLSRIMMPPTWEG
NUOCD_PSEPF      RNSDVMIKVALSESDLSLPTVTSIWPNANWYEREVWDMYGIDFKGHPHLSRIMMPPTWEG
NUOCD_PSE14      RNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGIDFPGHPHLSRIMMPPTWEG
NUOCD_PSEU2      RNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGIDFPGHPHLSRIMMPPTWEG
NUOCD_PSESM      RNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGIDFPGHPHLSRIMMPPTWEG
NUOCD_PSEMY      RNSDLMVKVALSERDLNLPTATGIWPNANWYEREVWDLYGITFQGHPHLTRIMMPPTWEG
NUOCD_ACIBC      RNSDIRIKVALNENDLNLPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYWEG
NUOCD_ACIBT      RNSDIRIKVALNENDLNLPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYWEG
NUOCD_ACIBY      RNSDIRIKVALNENDLNLPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYWEG
NUOCD_ACIBS      RNSDIRIKVALNENDLNLPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYWEG
NUOCD_ACIAD      RNSDIRIKVALNESDLNIPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYWEG
NUOCD_PSYA2      RNSDVRIKVALSEEDLNVPSATQIWPNANWYEREVWDMFGIVFTGHPHLTRILLPKYWEG
NUOCD_PSYCK      RNSDVRIKVALSEEDLNVPSATQIWPNANWYEREVWDMFGIVFTGHPHLTRILLPKYWEG
NUOCD_PSYWF      RNSDIRVKVALSEDDLKVPTATKIWPNANWYEREVWDMFGIVFDGHPHLTRILLPKYWEG
NUOCD_CHRSD      RNRDIMLKVALSERDLEVPSVAGVYPNANWYEREVWDMFGIDFRGHPHLTRLLMPPTWNG
NUOCD_SHEWM      RNQDIRLKVALANDQAEIPSITAFWPSANWYEREAWDMFGIIFSDHPNLYRLLLPPTFKG
NUOCD_RHOS4      RNADLRLKLATDG---RAPSIAGVYANADWYEREAHDMFGLDFG--RETRRILMPPTWEG
NUOCD_RHOS1      RNADLRLKLATDG---RAPSIAGVYANADWYEREAHDMFGLDFG--RETRRILMPPTWEG
NUOCD_RHOS5      RNADLRLKLATDG---RAPSVAGVYANADWYEREAHDMFGLDFG--RETRRLLMPPTWEG
NUOCD_RHOPA      RNADIRIKIALDAEYPRAKSIGSVFPNAPWYEREAYDMFGVEFEAQPHSLRILLPPGWEG
NUOCD_RHOPT      RNADIRIKIALDAEYPRAKSIGSVFPNAPWYEREAYDMFGVEFEAQPHSLRILLPPGWEG
NUOCD_RHOPS      RNADIRLKIALDAEYPSTKSIAGVFPNAAWYEREAYDMFGVEFELQPHSQRILLPPGWEG
NUOCD_RHOP2      RNADIRLKVGLDAEYPSAKSIAGVYPNAAWYEREAYDMFGVEFEAQPHSLRILLPPGWEG
NUOCD_RHOP5      RNADIVLKCPLDAKAPRATSIASVYPNADWYEREAFDLFGVHFDGRHDHRRILLPPLWEG
NUOCD_RHOPB      RNADIRLKCALPADDPRAHTIAEIYPNADWYEREAFDMFGVHFEGRRDHRRILMPPLWDG
                  .  : :*           :       : *****  :: *: .       :::    : *

NUOCD_ACICJ      HPLRKDYIARATEMGP-YILTEEKERAEQEALRFNPEAWGMKRHS-ENSDFMFLNLGPNH
NUOCD_GLUDA      HPLRKDHYARATEMPP-YSLTEDQEMAEQQALRFDPGAWGMARHS-AHSDFMFLNLGPNH
NUOCD_NITOC      HPLRKDHPARATEVDP-FTLSEEKQAREQEALRFRPEDWGMRRAS-GSTDFMFLNLGPNH
NUOCD_NITMU      HALRKDHPARATEMEP-FHLSTEKEEAEQETLRFHPEEWGMRRTH-DGTDFMFLNLGPNH
NUOCD_METCA      HPLRKDHPARATEMEP-FSLPDDVQQQEQEALRFVPEEWGMQRQS-EDTDFLFLNLGPNH
NUOCD_SHIB3      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_SHISS      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOHS      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECO24      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOSM      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOLC      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_SHIBS      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_SHIDS      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_SHIFL      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOL5      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_SHIF8      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECO57      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOK1      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOL6      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOUT      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECOLI      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ECODH      HPLRKDYPARATEFSP-FELTKAKQDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_CITK8      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMQRGT-ENEDFMFLNLGPNH
NUOCD_ENT38      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRST-ENEDFMFLNLGPNH
NUOCD_SALDC      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALEP      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALG2      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALHS      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALTI      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALTY      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALCH      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALA4      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALPA      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALPK      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALPB      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALSV      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALNS      HPLRKDYPARATEFDP-FELTKAKQDLEMEVLTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_SALAR      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEDWGMKRGT-DNEDFMFLNLGPNH
NUOCD_KLEP7      HPLRKDYPARATEFDP-FELTKAKQDLEMEALTFKPEEWGMKRGT-DNEDFMFLNLGPNH
NUOCD_CROS8      HPLRKDYPARATEFDP-FTLTKQKEELEMEALTFKPEEWGMKRGN-DTEDFMFLNLGPNH
NUOCD_SERP5      HPLRKDYPARATEFDP-FVLTKQKEDLEMEALTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_ERWT9      HPLRKDYPARATEFDP-FELTKQKEDLEMESLTFKPEDWGMKRST-ANEDFMFLNLGPNH
NUOCD_PECAS      HPLRKDYPARATEFDP-FELTKQKEDLEMESLTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_PHOLL      HPLRKDYPARATEFDP-FELTRQKEDLEMEALTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_PROMH      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEEWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPE      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPP      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPA      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPN      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPS      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPB      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERP3      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPY      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERPG      HPLRKDYPARATEFDP-YVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_YERE8      HPLRKDYPARATEFDP-FVLTKQKEDLEMESLTFKPEDWGMKRGT-ENEDFMFLNLGPNH
NUOCD_SODGM      HPLRKDYPARATEFDP-FVLTKQKEDLEMEGLTFKPEEWGMKRGK-DNEDFMFLNLGPNH
NUOCD_BUCAI      HPLRKNYSARATEYEP-FFLNEQKEDLEMEGLKFKPELWGMKRKN-DNVEFMFLNLGPNH
NUOCD_BUCAP      FPLRKDYPARATEHES-FFLDEQKEDLEMENLRFKPELWGMKRKN-DNVDFMFLNLGPNH
NUOCD_BUCBP      HPLRKDHPARATEFDP-YVLNKYKEDIEMEALKFKPEEWGMKKN--KQSKYMFLNLGPNH
NUOCD_BUCCC      HPLRKDYSSHATEFDE-FYFTKQKEDLAMESLKFCPKSWGLENNDSNNSEYMFLNFGPNH
NUOCD_BLOFL      FPLRKEYPARATEFYPAFTLTRKKEDLAMDDLLFKPEEWGMHRNN-KHEDFMFLNLGPNH
NUOCD_BLOPB      YPLRKEYPARATEFNP-FILTKQKEDLAMEGLLFKPEEWGMHKHS-KHENFMFLNLGPNH
NUOCD_BAUCH      HPLRKDYPARATEFNP-FVLTKEKEELEMDSLTFKPEKWGIKHSN-HKDDFMFLNFGPNH
NUOCD_AERS4      HPLRKDYPARATEFDP-FMLDAAKQDMEQENLLFKPEEWGMARGN-ENEDYMFLNLGPNH
NUOCD_SHEON      HPLRKDYPARATEFDP-FMLDAAKQDMEQENLLFKPEEWGLARGN-ENEDYMFLNLGPNH
NUOCD_AERHH      HPLRKDYPARATEFDP-FMLDAVKQDQEQDNLLFKPEEWGMARGN-ENEDYMFLNLGPNH
NUOCD_PSEAE      HPLRKDYPARATEFDP-YSLSAAKQDLEQEALRFKPEDWGMKRHG-ENEDYMFLNLGPNH
NUOCD_PSEAB      HPLRKDYPARATEFDP-YSLSAAKQDLEQEALRFKPEDWGMKRHG-ENEDYMFLNLGPNH
NUOCD_PSEA7      HPLRKDYPARATEFDP-YSLSAAKQDLEQEALRFKPEDWGMKRHG-ENEDYMFLNLGPNH
NUOCD_PSEP1      HPLRKDYPARATEFDP-YSLTLAKQQLEEESARFNPEAWGMKRQG-ANEDYMFLNLGPNH
NUOCD_PSEPK      HPLRKDYPARATEFDP-YSLTLAKQQLEEESARFNPEAWGMKRQG-ANEDYMFLNLGPNH
NUOCD_PSEPG      HPLRKDYPARATEFDP-YSLTLAKQQLEEESARFNPEAWGMKRQG-ANEDYMFLNLGPNH
NUOCD_PSEPW      HPLRKDYPARATEFDP-YSLTLAKQQLEEESARFNPEAWGMKRQG-ANEDYMFLNLGPNH
NUOCD_PSEE4      HPLRKDYPARATEFDP-YSLTLAKQQLEEESARFNPEAWGMKRHG-ANEDYMFLNLGPNH
NUOCD_PSEF5      HPLRKDFPARATEFDP-FSLNLAKQQLEEEAARFRPEDWGMKRSG-ANEDYMFLNLGPNH
NUOCD_PSEPF      HPLRKDFPARATEFDP-FSLNLAKQQLEEEAARFRPEDWGMKRSG-ANEDYMFLNLGPNH
NUOCD_PSE14      HPLRKDFPARATELDP-YSLTLAKQQLEEEAARFRPEDWGMKRSG-ANEDYMFLNLGPNH
NUOCD_PSEU2      HPLRKDFPARATEFDP-YSLTLAKQQLEEEAARFRPEDWGMKRSG-ANEDYMFLNLGPNH
NUOCD_PSESM      HPLRKDFPARATEFDP-YSLTLAKQQLEEEAARFRPEDWGMKRSG-QNEDYMFLNLGPNH
NUOCD_PSEMY      HPLRKDYPARATEFDP-FSLTLAKQQLEEEAARFRPEDWGMKRGG-EHEDYMFLNLGPNH
NUOCD_ACIBC      HPLRKEYSARATEYTP-YMQDKAKQDFEQEHLRFVPEDWGLKRGN-ADEDFMFLNLGPNH
NUOCD_ACIBT      HPLRKEYSARATEYTP-YMQDKAKQDFEQEHLRFVPEDWGLKRGN-ADEDFMFLNLGPNH
NUOCD_ACIBY      HPLRKEYSARATEYTP-YMQDKAKQDFEQEHLRFVPEDWGLKRGN-ADEDFMFLNLGPNH
NUOCD_ACIBS      HPLRKEYSARATEYTP-YMQDKAKQDFEQEHLRFVPEDWGLKRGN-ADEDFMFLNLGPNH
NUOCD_ACIAD      HPLRKEYSARATEYTP-YMQNQAKQDFEQEHLRFVPEDWGLKRGN-ADEDFMFLNLGPNH
NUOCD_PSYA2      HPLRKEYHARATEFTP-YFLNTAKQQYEQENLRFVPEEWGMKRSG-RDEDFMFLNIGPNH
NUOCD_PSYCK      HPLRKEYHARATEFTP-YFLNTAKQQYEQENLRFVPEEWGMKRSG-RDEDFMFLNIGPNH
NUOCD_PSYWF      HPLRKEYHARATEFTP-YFLNNAKQQFEQENLRFVPEEWGMKRSG-RDEDFMFLNLGPNH
NUOCD_CHRSD      HPLRKDYPARATEFDP-YTLTVEGQSTEQEALRFDPEAWGMQRQS-ENTDYMFLNLGPNH
NUOCD_SHEWM      HPLRKEFPCRATETEA-FSLDDERLAIEQEALKFDPKRWGMEQSN-KDNDYLFLNLGPNH
NUOCD_RHOS4      HPLLKTHYARATEKPP-FVLTDRLFEAEERATITDPDLLGLPKLR-DGEELMVLNFGPHH
NUOCD_RHOS1      HPLLKTHYARATEKPP-FVLTDRLFEAEERATITDPDLLGLPKLR-DGEELMVLNFGPHH
NUOCD_RHOS5      HPLLKTHYARATEKPP-FVLTDRLFEAEERATITDPDLLGLPGLR-DGEELMVLNFGPHH
NUOCD_RHOPA      HPMRKTQPGRATERPL-FNMTASLFDAKEHALAADPEKFGLPTHR-DGVELMILNYGPHS
NUOCD_RHOPT      HPMRKTQPGRATERPL-FNMTASLFDAKEHALAADPEKFGLPTHR-DGVELMILNYGPHS
NUOCD_RHOPS      HPMRKTQPGRATERPL-FNMTAALFDAKEHALAADPEKFGLPTHR-DGVELMILNYGPHS
NUOCD_RHOP2      HPMRKTQPGRATERPL-FNMTAALFDAKEHALAADPEKFGLPTHR-DGVELMILNYGPHS
NUOCD_RHOP5      HPLRKDQPARATEKPP-FVMTAARFDAEEKALMIDPEALGLPTER-DGVELMILNYGPHS
NUOCD_RHOPB      HPMRKDQPARATERPP-FVMTAARFDAEEQALAVDPEALGLPTQR-DGVELMILNYGPHS
                 ..: *    :***    :                 *   *:        . :.** **: 

NUOCD_ACICJ      PSVHGVFRIILQLEGEEIVDAVPEIGFHHRGAEKMAERQSWHTYIPYTDRIDYLGGVMNN
NUOCD_GLUDA      PSVHGVFRIVLQLEGERIVDAVPDIGFHHRGAEKMGERQSWHSFIPYTDRVDYLGGVMNN
NUOCD_NITOC      PSVHGVFRIVLQLDGEEIVDAVPDIGYHHRGAEKMGERQSWHTYIPYTDRIDYLGGVMNN
NUOCD_NITMU      PSVHGVFRIVLQLDGEEIIDAVPEIGFHHRGAEKMGERQSWHTYIPYTDRIDYLGGVMNN
NUOCD_METCA      PSVHGVFRVALQLDGEEIVDAVPDIGYHHRGAEKMGERQSWHSYIPYTDRIDYLGGSMNN
NUOCD_SHIB3      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SHISS      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOHS      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECO24      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOSM      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOLC      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SHIBS      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SHIDS      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SHIFL      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOL5      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SHIF8      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECO57      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOK1      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOL6      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOUT      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECOLI      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ECODH      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_CITK8      PSSHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ENT38      PSSHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALDC      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALEP      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALG2      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALHS      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALTI      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALTY      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALCH      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALA4      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALPA      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALPK      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALPB      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALSV      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALNS      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SALAR      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_KLEP7      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_CROS8      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEYLGGCVNE
NUOCD_SERP5      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_ERWT9      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_PECAS      PSSHGAFRIILQLDGEEIVDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_PHOLL      PSSHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_PROMH      PSSHGAFRIILQLDGEEIVNCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPE      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPP      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPA      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPN      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPS      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPB      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERP3      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPY      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERPG      PSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_YERE8      PSSHGAFRIVLQLDGEEIVDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_SODGM      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEYLGGCVNE
NUOCD_BUCAI      PSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_BUCAP      PSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEYLGGCVNE
NUOCD_BUCBP      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQTWHNYIPYTDRVEYLGGCINE
NUOCD_BUCCC      PSSHGAFRIVLQLHGEKIINCIPDIGYHHRGAEKIAERQTWHSYIPYTDRIEYLGGCVNE
NUOCD_BLOFL      PSVHGVFRIILQLSGEEIIDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEYLGGCINE
NUOCD_BLOPB      PSVHGVFRIILQLNGEEIIDCVPDIGYHHRGAEKMGERQTWHSYIPYTDRIEYLGGCVNE
NUOCD_BAUCH      PSAHGAFRIVLQLDGEEIVDCIPDIGYHHRGVEKMSERQSWHSYIPYTDRVEYLGGCVNE
NUOCD_AERS4      PSAHGAFRLVLQLDGEEIRNCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEYLGGVMNN
NUOCD_SHEON      PSAHGAFRLVLQLDGEEVRNCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEYLGGVMNN
NUOCD_AERHH      PSAHGAFRLVLQLDGEEIRDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEYLGGVMNN
NUOCD_PSEAE      PSAHGAFRIILQLDGEEIIDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEAB      PSAHGAFRIILQLDGEEIIDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEA7      PSAHGAFRIILQLDGEEIIDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEP1      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEPK      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEPG      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEPW      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEE4      PSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEF5      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEPF      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSE14      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEU2      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSESM      PSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_PSEMY      PSAHGAFRIILQLDGEEIVDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDYLGGVMNN
NUOCD_ACIBC      PSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGGCAQN
NUOCD_ACIBT      PSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGGCAQN
NUOCD_ACIBY      PSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGGCAQN
NUOCD_ACIBS      PSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGGCAQN
NUOCD_ACIAD      PSAHGAFRVVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGGCAQN
NUOCD_PSYA2      PSAHGAFRLVLQLDGEEVVDCIPDIGYHHRGAEKMAERQTWHSFIPYTDRIDYLGGVMNE
NUOCD_PSYCK      PSAHGAFRLVLQLDGEEVVDCIPDIGYHHRGAEKMAERQTWHSFIPYTDRIDYLGGVMNE
NUOCD_PSYWF      PSAHGAFRLVLQLDGEEVIDCIPDIGYHHRGAEKMAERQTWHSYIPYTDRIDYLGGVMNE
NUOCD_CHRSD      PSAHGAFRIALQLDGEVVVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIDYTGGVMNN
NUOCD_SHEWM      PSVHGVFRIALQLDGEHIINSVPDIGYHHRGAEKIAERQTWHGFIPYTDRIDYLGGVMNN
NUOCD_RHOS4      PSTHGVLRILLGLDGEEVVWAWPDIGYHHRGAEKMAERQTWHGFIPYCDRIDYLGGVISE
NUOCD_RHOS1      PSTHGVFRILLGLDGEEVVWAWPDIGYHHRGAEKMAERQTWHGFIPYCDRIDYLGGVISE
NUOCD_RHOS5      PSTHGVFRILLGLDGEEVVWAWPDIGYHHRGVEKMAERQTWHGFIPYCDRVDYLGGVISE
NUOCD_RHOPA      MATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHNFLPYTDRVDYLGGVMGE
NUOCD_RHOPT      MATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHNFLPYTDRVDYLGGVMGE
NUOCD_RHOPS      MATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHSFLPYTDRVDYLGGVMGE
NUOCD_RHOP2      MATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHNFLPYTDRVDYLGGVMGE
NUOCD_RHOP5      MATHGVFRVVLALDGEEIVAARPDIGFHHRGAEKMGERQSWHQFIPYTDRIDYLGGVISE
NUOCD_RHOPB      MATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMGERQSWHQYIPYTDRIDYLGGVMGE
                  : **.:*: * * ** :  . *::*:****.**:.***:** ::** **::* **   :

NUOCD_ACICJ      FPYVMAVERLAGIEVPSRAQMIRIMLAELFRIASHLVFYGTMSQDVGQLSPVFYMFSDRE
NUOCD_GLUDA      FPYVMAVEKLAGITVPPRAQMIRVMLAELFRVASHLVFYGTMTQDVGQLSPVFYMFSDRE
NUOCD_NITOC      LPYVLAVEQLAGIQVPERVKVIRVMLAELFRIASHLVFYGTFAQDVGQLSPVFYMFTDRE
NUOCD_NITMU      LPYVLAVEKLAGIEVPDRVKVMRVMMAEFFRIASHLVFYGTFTQDLGALSPVFFMFTDRE
NUOCD_METCA      LPYVMAVEKLAGIEVPERARVIRVMISEFYRIASHLLFYGTFAQDVGQMSPIFYMFIDRE
NUOCD_SHIB3      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SHISS      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOHS      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECO24      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOSM      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOLC      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SHIBS      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SHIDS      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SHIFL      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOL5      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SHIF8      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECO57      MPYVLAVEKLAGITVPARVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOK1      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOL6      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOUT      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECOLI      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ECODH      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_CITK8      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ENT38      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALDC      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALEP      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALG2      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALHS      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALTI      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALTY      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALCH      MPYVLAVEKLAGITVSDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALA4      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALPA      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALPK      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALPB      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALSV      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALNS      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SALAR      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_KLEP7      MPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_CROS8      MPYVLAVEKLAGIQVPERVEVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SERP5      MPYVLAVEKLAGIKVPDRVDTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_ERWT9      MPYVLAVEKLAGIKVPERVEVIRVMLSELFRINSHLLYISTFIQDVGAMSPVFFAFTDRQ
NUOCD_PECAS      MPYVLAVEKLAGIEVPDRVKTIRVMLSELFRINSHLLYISTYIQDVGAMTPVFFAFTDRQ
NUOCD_PHOLL      MPYVLAVEKLAGIEVPDRVKTIRVMLSELFRINSHLLYISTFIQDVGGMTPVFFAFTDRQ
NUOCD_PROMH      MPYVLAVEKLAGIEVPERVKVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPE      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPP      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPA      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPN      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPS      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPB      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERP3      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPY      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERPG      MPYVLAVEKLAGIVVPDRVNTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_YERE8      MPYVLAVEKLAGIEVPDRVKTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQ
NUOCD_SODGM      MPYVLAVEKLAGIVVPDRVNVIRVMLSELFRINSHLLYISTYIQDVGGMTPVFLAFTDRQ
NUOCD_BUCAI      LPYVLAVEKLANISVPEKAEVIRVMMSELFRINSHLLYISTFIQDVGCMTPVFFAFTDRQ
NUOCD_BUCAP      MPYVLAVEKLANISVPEKVEVIRVMLSELFRINSHLLYISTFIQDVGCMTPVFLAFTDRQ
NUOCD_BUCBP      MPYVLAVERLAGIEVSQRIEVIRIMLSELFRINSHLLFISTFIQDVGAMTPVFLAFTDRQ
NUOCD_BUCCC      MPYILAVEKLAGIVVPEKVQVIRILLSELFRINSHLLFLSTFIQDIGSMSTVFLAFTDRQ
NUOCD_BLOFL      MPYVLAVEKLAGIVVPDRAKIIRIMLSELFRINSHLLYVSTYLQDVGVMTPVFLAFTDRQ
NUOCD_BLOPB      MPYILAVEKLAGITVPDRVKVIRIMLSELFRINSHLLYISTYLQDVGAMSPVFLAFTDRQ
NUOCD_BAUCH      MPYVLAVEKLAGIVVPDRVNVIRIMLSELFRINSHLLYISTYIQDVGGMTPIFLAFTDRQ
NUOCD_AERS4      LPYVLAVEKLAGIKVPNRVDVIRVMMAELFRIQSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_SHEON      LPYVLAVEKLAGIKVPQRVDMIRVMMAELFRIQSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_AERHH      LPYVLAVEKLAGIKVPQRVDMIRVMLAELFRIQSHLLFIGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEAE      LPYVLSVEKLAGIKVPQRVDVIRIMMAEFFRILNHLLYLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEAB      LPYVLSVEKLAGIKVPQRVDVIRIMMAEFFRILNHLLYLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEA7      LPYVLSVEKLAGIKVPQRVDVIRIMMAEFFRILNHLLYLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEP1      LPYVLAVEKLAGIKVPQKVDVIRIMLAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEPK      LPYVLAVEKLAGIKVPQKVDVIRIMLAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEPG      LPYVLAVEKLAGIKVPQKVDVIRIMLAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEPW      LPYVLAVEKLAGIQVPQKVDVIRIMLAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEE4      LPYVLAVEKLAGIQVPQKVDVIRIMLAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEF5      LPYVLSVEKLAGIKVPEKVDVIRIMMAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEPF      LPYVLSVEKLAGIKVPEKVDVIRIMMAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSE14      LPYVLSVEKLAGIKVPEKVDVIRIMMAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEU2      LPYVLSVEKLAGIKVPEKVDVIRIMMAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSESM      LPYVLSVEKLAGIKVPEKVDVIRIMMAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_PSEMY      LPYVLAVEKLAGIKVPDRVDFIRVMLAEFFRITSHLLFLGTYIQDVGAMTPVFFTFTDRQ
NUOCD_ACIBC      MPYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLYCGTAIQDAGGMTPVFYMFADRQ
NUOCD_ACIBT      MPYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLYCGTAIQDAGGMTPVFYMFADRQ
NUOCD_ACIBY      MPYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLYCGTAIQDAGGMTPVFYMFADRQ
NUOCD_ACIBS      MPYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLYCGTAIQDAGGMTPVFYMFADRQ
NUOCD_ACIAD      MPYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLFCGTAIQDAGGMTPVFYMFADRQ
NUOCD_PSYA2      LPYIMSVEKLAGITIPPRAETIRVMMSEFFRITNNLLFVGTFIQDAGGMTPVFYMFTDRQ
NUOCD_PSYCK      LPYIMSVEKLAGITIPPRAETIRVMMSEFFRITNNLLFVGTFIQDAGGMTPVFYMFTDRQ
NUOCD_PSYWF      LPYVMAVEQLAGITVPERAQTIRVMMSEFFRITNNLLYFGTFIQDAGGMTPVFYMFTDRQ
NUOCD_CHRSD      LPYVMAVEKLAGIEVTDRAKTIRVMMAEMFRINSHLLFLGTYLQDLGAMTPVFFTFTDRQ
NUOCD_SHEWM      FPYILAIEQLANIQVSERVKCIRVMLAECFRILSHMLFFGTFAQDVGQLSPIFYLFIDRE
NUOCD_RHOS4      LPYLLAVERLCGIAVPPRAQMIRVMLCEFYRIMNHLLFYGTMAQDVGAMSPVFYMFTDRE
NUOCD_RHOS1      LPYLLAVERLCGIAVPPRAQMIRVMLCEFYRIMNHLLFYGTMAQDVGAMSPVFYMFTDRE
NUOCD_RHOS5      LPYLLAVERLCGIAVPPRAQMIRVMLCEFYRIMNHLLFYGTMAQDVGAMSPVFYMFTDRE
NUOCD_RHOPA      MPYLQAVEKACGIKVPDRALTVRIMLSEMFRIMNHLLFYGTMAQDTGAMSPVFYMFTDRE
NUOCD_RHOPT      MPYLQAVEKACGIKVPDRALTVRIMLSEMFRIMNHLLFYGTMAQDTGAMSPVFYMFTDRE
NUOCD_RHOPS      MPYLQAVEKACGITVPDRALMVRVMLSEIFRIMNHLLFYGTMAQDTGAMSPVFYMFVDRE
NUOCD_RHOP2      MPYLQAVEKACGITVPDRALTVRVMLSEMFRIMNHLLFYGTMAQDTGAMSPVFYMFVDRE
NUOCD_RHOP5      MPYLQAVERLCGITVPDRAKTIRIMLSEIYRIMNHLLLYGTMAQDCGAMSPVFYMFTDRE
NUOCD_RHOPB      MPYLQAVERLCGIAVPERAQTVRIMLCEIFRIMNHLLFYGTLAQDTGAMSPVFYMFTDRE
                 :**: ::*: ..* :. :   :*::: * :*: .:::  .*  ** * ::.:*  * **:

NUOCD_ACICJ      RVFQIIEAICGFRMHPAWFRIGGVAADLPQGWDRMIRD-YLGYQSKRLDEYDKLVMRNRL
NUOCD_GLUDA      RVFEIIEAICGFRMHPAWFRIGGVAMDLPRGWDGLIRD-FLDYLPPRLDEYEKMVMRNPI
NUOCD_NITOC      RVFDIIEAICGGRMHPEWFRIGGVAQDLPRGWDDLIRD-FLRYLPPRLAKYDKIAMNNRI
NUOCD_NITMU      RVFDVVEAICGGRMHPSWYRIGGVAQDLPNGWDRMVRD-FLDYMPARLDEYDKIAVGNRI
NUOCD_METCA      RVFEIIESFTGARMHSSFFRIGGVAMDLPEGWDRLIRE-FIAYFPRRLAEYDKAVMANKL
NUOCD_SHIB3      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_SHISS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOHS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECO24      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOSM      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOLC      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_SHIBS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_SHIDS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_SHIFL      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOL5      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_SHIF8      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECO57      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOK1      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOL6      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOUT      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECOLI      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_ECODH      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLDWMPKRLASYEKAALQNTI
NUOCD_CITK8      KIYDVVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRD-FLDWMPKRLDSYEKAALRNTI
NUOCD_ENT38      KIYDVVEAITGFRMHPAWFRIGGVAHDLPRGWDKLLRD-FLDWMPKRLDSYEKAALRNTI
NUOCD_SALDC      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALEP      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALG2      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALHS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALTI      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALTY      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALCH      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALA4      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALPA      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALPK      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALPB      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALSV      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALNS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_SALAR      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWERLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_KLEP7      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYEKAALRNTI
NUOCD_CROS8      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLKE-FLEWMPKRLDSYVKAALKNTI
NUOCD_SERP5      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRE-FLEWMPKRLDSYVKAALKNSI
NUOCD_ERWT9      KIYDVVEAITGFRMHPAWFRIGGVAHDLPKGWERLLRE-FLDWMPKRLKAYEQTALKNSV
NUOCD_PECAS      KIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWERLLRE-FLDWMPARLDTYVKSALQNTI
NUOCD_PHOLL      KVYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRD-FLNWMPKRLDSYVKAALKNSI
NUOCD_PROMH      KVYDIVEAITGFRMHPAWFRIGGVAHDLPKGWERLLRE-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPE      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPP      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPA      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPN      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPS      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPB      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERP3      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPY      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERPG      KVYDVIEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_YERE8      KVYDLVEAITGFRMHPAWFRIGGVAHDLPRGWERLLRD-FLDWMPKRLDSYVKAALQNSI
NUOCD_SODGM      KIYDVVEAITGFRMHPAWFRIGGVAHDLPRGWEGLLRE-FLDWLPKRLDSYVKVALRNSV
NUOCD_BUCAI      KIYDLIEAITGARMHPAWFRIGGVANDLPQGWNILLKE-FLDWMPKRLKYYINTALKNSI
NUOCD_BUCAP      KIYDLIEAITGARMHPAWFRIGGVAHDLPKGWNVLLKE-FLEWMPKRLKYYVQLALENPI
NUOCD_BUCBP      KIYDLIELITGSRMHPAWFRIGGLAHDLPKGWNALLKE-FLLWMPKRLLKYINVALKNSI
NUOCD_BUCCC      KIYDLIESITGARMHPAWFRIGGVAKDLPKNWNSLLKK-FLIWMPKRLDYYVNIAIKNKI
NUOCD_BLOFL      KIYDVIESITGARMHPAWFRIGGVADDLPLNWSDLLKQ-CLDWLPKRIAFYIDIALKNSI
NUOCD_BLOPB      KIYDVIESITGSRMHPAWFRIGGVAHDLPRGWECLLRK-CLDWIPHRVSFYVKSTLENSI
NUOCD_BAUCH      KIYNVVEAITGARMHPAWFRIGGVAHDLPHGWNMLLKE-LLDWLPNRLEHYVKVALENSI
NUOCD_AERS4      KIYTIIEAITGARMHPAWFRIGGVAHDLPKGWQRLVQDNLLSWLPKRLMDYEKAAMRNSI
NUOCD_SHEON      HIYTIIEAITGARMHPAWFRIGGVAHDLPKGWQRLVQDNLLSWLPKRLMDYEKAAMRNSI
NUOCD_AERHH      RIYTIIEAITGARMHPAWFRIGGVAHDLPVGWQRLVQDNLLSWLPKRLMDYEKAAMRNSI
NUOCD_PSEAE      RAYKVVEAITGFRLHPAWYRIGGVAHDLPRGWDKLVRE-FLDWMPKRLDEYETAALKNSI
NUOCD_PSEAB      RAYKVVEAITGFRLHPAWYRIGGVAHDLPRGWDKLVRE-FLDWMPKRLDEYETAALKNSI
NUOCD_PSEA7      RAYKVVEAITGFRLHPAWYRIGGVAHDLPRGWDKLVRE-FLDWMPKRLDEYETAALKNSI
NUOCD_PSEP1      RAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWDKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSEPK      RAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWDKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSEPG      RAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWDKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSEPW      RAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWEKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSEE4      RAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWDKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSEF5      RAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWEKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSEPF      KAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWEKLVKD-FVEWLPKRLDEYTKAALQNSI
NUOCD_PSE14      KAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWEKLVKD-FVDWLPKRLDEYTKAALQNSI
NUOCD_PSEU2      KAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWEKLVKD-FVDWLPKRLDEYTKAALQNSI
NUOCD_PSESM      KAYTVIEAITGFRLHPAWYRIGGVAHDLPRGWEKLVKD-FVDWLPKRLDEYTKAALQNSI
NUOCD_PSEMY      RAYKVIEAITGFRLHPAWYRIGGVAHDLPRGWDKLVKE-FVDWLPRRLDEYEKAALKNSI
NUOCD_ACIBC      KVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWQKLVKE-LLDWMPKRLNEYYTAAFKNSV
NUOCD_ACIBT      KVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWQKLVKE-LLDWMPKRLNEYYTAAFKNSV
NUOCD_ACIBY      KVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWQKLVKE-LLDWMPKRLNEYYTAAFKNSV
NUOCD_ACIBS      KVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWQKLVKE-LLDWMPKRLNEYYTAAFKNSV
NUOCD_ACIAD      KVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWHKLVKE-LLEWMPKRLNEYHTAALKNSV
NUOCD_PSYA2      KAYDVIEAVTGYRMHPAWFRIGGTAHDLPRGWQRLVRE-FLDWMPKRLDEYVKAALQNSV
NUOCD_PSYCK      KAYDVIEAVTGYRMHPAWFRIGGTAHDLPRGWQRLVRE-FLDWMPKRLDEYVKAALQNSV
NUOCD_PSYWF      KAYDVIEAVTGYRMHPAWFRIGGTAADLPRGWQRLVRE-FLDWMPQRLDEYVKAAMENSV
NUOCD_CHRSD      KAYEVIEGITGFRMHPAWYRIGGTAHDLPRGWDKLVQG-FLDWMPKRLVEYERAMMENAI
NUOCD_SHEWM      KLFGIIEAITGARMHPSWFRIGGLAQDLPKGWDTMMQE-FVDEFPKKLDEYEVMVMQNSI
NUOCD_RHOS4      KGHEILNAITGARMHPAFFRIGGVAMDLPDGWDAMVRG-FLDWMPARLDEYERMVLRSEL
NUOCD_RHOS1      KGHEILNAITGARMHPAFFRIGGVAMDLPTGWDAMVRG-FLDWMPARLDEYERMVLRSEL
NUOCD_RHOS5      KGHEILNAITGARMHPAFFRIGGVAMDLPRGWDAMVRD-FLDWMPGRLDEYERMVLRSEL
NUOCD_RHOPA      RGYRVIESITGARMHPGFFRIGGLSMDLPDGWDRLVRE-FLDWMPSRLDDYEGMVLRNEI
NUOCD_RHOPT      RGYRVIESITGARMHPGFFRIGGLSMDLPHGWDRLVRE-FLDWMPSRLDDYEGMVLRNEI
NUOCD_RHOPS      RAYRVIESITGARMHPGFFRIGGLSMDLPQGWDGLVRE-FLDWMPSRLDDYEGMVLRNEI
NUOCD_RHOP2      RGYRVIEAITGARMHPGYFRIGGLSMDLPQGWDRLVRE-FLDWMPARLADYEGMVLRNEI
NUOCD_RHOP5      RGYRIIEAITGARMHPGWFRIGGVAADLPEGWDRLVRE-FLDWMPKRLDDYAGMVLGNEI
NUOCD_RHOPB      RGYRVIEAITGARMHPGWFRIGGLAADLPEGWDALVRD-FLDWMPARLDDYEGMVMRNEI
                 : . ::: . * *:*. ::**** : *** .*  :::   :   . ::  *    . . :

NUOCD_ACICJ      FKARTIGVGAYTLEEALDWGVTGPGLRACGLGWDYRRQRPYSGYDQLEFDIPICHN-GDC
NUOCD_GLUDA      FRARTIGVGAYDVSEAIAWGVTGPGLRACGLEWDLRRKVPYSGYDQLEFDIPTAQN-GDC
NUOCD_NITOC      LKKRTQGVGSYTIAEAMEWGVTGPGLRACGLEWDFRKQRPYSGYEQFQFDIPVAQH-GDC
NUOCD_NITMU      LKARTRGVGGYSIDEAIEWGVTGPNLRACGFEWDFRKARPYSGYDQFEFDVPTGQH-GDC
NUOCD_METCA      IQRRTRGIGAYTTTEAIDWSVTGAGLRATGLPWDYRKARPYSGYENFEFDVPTGTN-GDC
NUOCD_SHIB3      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_SHISS      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOHS      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECO24      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOSM      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOLC      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_SHIBS      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_SHIDS      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_SHIFL      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOL5      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_SHIF8      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECO57      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOK1      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOL6      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOUT      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECOLI      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_ECODH      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDC
NUOCD_CITK8      LKGRSQGVAAYGKKEALDWGCTGAALRATGIDFDVRKSRPYSGYENFDFEIPVGGGVSDC
NUOCD_ENT38      LIARSKGVAAYGAKEALDWGCTGAALRATGIDFDVRKARPYSGYENFDFEVPVGGGVSDC
NUOCD_SALDC      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALEP      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALG2      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALHS      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALTI      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALTY      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALCH      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALA4      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALPA      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALPK      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALPB      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALSV      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALNS      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_SALAR      LKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDC
NUOCD_KLEP7      LKGRSVGVAAYTAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPTGGGVSDC
NUOCD_CROS8      LKGRSQGVAAYDAKEALAWGTTGAGLRATGIDFDVRKARPYSGYQNFEFEVPVGGGISDC
NUOCD_SERP5      LKGRSVGVASYNAKEALEWGVTGAGLRATGIEFDVRKWRPYSGYENFDFEVPVGDGNSDC
NUOCD_ERWT9      LIGRAKGVSAYNMEEALAWGTTGAGLRATGLDFDVRKWRPYSGYENFDFEIPIGDGVSCA
NUOCD_PECAS      LKGRTQGVAAYNAKEALEWGVTGAGLRATGIGFDVRKWRPYSGYENFDFEVPVGDGISDC
NUOCD_PHOLL      LKGRAIGVAAYNSKQALEWGTTGAGLRATGIAFDVRKWRPYSGYENFDFDVPIGNN-GDC
NUOCD_PROMH      LKGRTIGVASYNAKEALDWGVTGAGLRATGVEFDVRKWRPYSGYENFEFEIPVASN-GDC
NUOCD_YERPE      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPP      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPA      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPN      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPS      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPB      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERP3      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPY      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERPG      LKGRSVGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_YERE8      LKGRSIGVAAYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGNN-GDC
NUOCD_SODGM      LRARAEGVAAYGAKEALDWGVTGAALRATGIDFDVRKWRPYSGYENFNFEVPVGDGVSDC
NUOCD_BUCAI      LIHRSKGIAEYNKKEALQWGVTGAGLRATGLNFDVRKWRPYSGYQNYTFEVPVGSGISDC
NUOCD_BUCAP      LIRRSKGIAQYNQKEALQWGVTGSGLRSTGLDLDVRKWRPYSGYQNYTFEIPIGQGISDC
NUOCD_BUCBP      LISRSKGIAEYNKHDALLWGVTGAGLRATGINFDVRKKRPYSGYQNFDFEVPIGAGISDC
NUOCD_BUCCC      LISRSKGIAAYGKKEALSWGITGAGLRATGVNFDVRKNRPYSGYQNFDFEVPIGNNISDA
NUOCD_BLOFL      FKKRTCGIGSYGAKEALSWGVTGSGLRATGIEFDLRKSRPYSGYENFDFDIPIGNGLSDC
NUOCD_BLOPB      FKKRACGIGAYNAKDALDWGVTGAGLRATGIEFDIRKSRPYSGYENFDFDVPIGNGISDS
NUOCD_BAUCH      LRSRSEGIASYSAKEALEWGVTGAALRATGINFDVRKWRPYSGYDNFEFEIPVGNGISDC
NUOCD_AERS4      LRGRTIGVSAYTTEQALAWGTTGAGLRATGLNFDVRKWRPYSGYDQFDFEVPVGSN-GDA
NUOCD_SHEON      LRGRTIGVAAYTTEQALAWGTTGAGLRATGLNFDVRKWRPYSGYEQFDFEVPVGSN-GDA
NUOCD_AERHH      LRGRTIGVAAYNTEQALAWGTTGGGLRATGLNFDVRKWRPYSGYDQFEFEVPVGAN-GDA
NUOCD_PSEAE      LRGRTIGVAQYNTKEALEWGTTGAGLRATGCDFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEAB      LRGRTIGVAQYNTKEALEWGTTGAGLRATGCDFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEA7      LRGRTIGVAQYNTKEALEWGTTGAGLRATGCDFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEP1      LKGRTIGVAAYNTKEALEWGTTGAGLRATGCNFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEPK      LKGRTIGVAAYNTKEALEWGTTGAGLRATGCNFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEPG      LKGRTIGVAAYNTKEALEWGTTGAGLRSTGCDFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEPW      LKGRTIGVAAYNTKEALEWGTTGAGLRATGCDFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEE4      LKGRTIGVAAYNTKEALEWGTTGAGLRATGCNFDLRKARPYSGYENFEFEVPLAHN-GDA
NUOCD_PSEF5      LKGRTIGVAAYNTKEALEWGVTGAGLRSTGCDFDLRKARPYSGYENFEFEVPLAAN-GDA
NUOCD_PSEPF      LKGRTIGVAQYNTKEALEWGVTGAGLRSTGCDFDLRKARPYSGYENFEFEVPLAAN-GDA
NUOCD_PSE14      LKGRTVGVAAYNTKEALEWGVTGAGLRSTGCDFDLRKARPYSGYENFEFEVPLAAN-GDA
NUOCD_PSEU2      LKGRTIGVAAYNTKEALEWGVTGAGLRSTGCDFDLRKARPYSGYENFEFEVPLAAN-GDA
NUOCD_PSESM      LKGRTVGVAAYNTKEALEWGVTGAGLRSTGCDFDLRKARPYSGYENFEFEVPLAAN-GDA
NUOCD_PSEMY      LKARTIGVAQYNTKEALEWGTTGAGLRATGCDFDLRKARPYSGYEHFEFEVPLAAN-GDA
NUOCD_ACIBC      FIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFEVPVEYE-GDA
NUOCD_ACIBT      FIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFEVPVEYE-GDA
NUOCD_ACIBY      FIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFEVPVEYE-GDA
NUOCD_ACIBS      FIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFEVPVEYE-GDA
NUOCD_ACIAD      FIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFDVPLEYE-GDA
NUOCD_PSYA2      LKGRTQGVAQYNTKQALAWGVTGAGLRATGLDFDLRKARPYMGYENYDFEVPVGYN-GDA
NUOCD_PSYCK      LKGRTQGVAQYNTKQALAWGVTGAGLRATGLDFDLRKARPYMGYENYDFEVPVGYN-GDA
NUOCD_PSYWF      LKGRTQNVAQYDAKQALAWGVTGAGLRATGVEFDLRKARPYMGYENYDFEIPVGYN-GDA
NUOCD_CHRSD      IRERTKQVAAFTTREALEWGVTGPNLRATGCDFDLRKQRPYSGYENFDFEVPLGAN-GDV
NUOCD_SHEWM      LKRRSIGIGQYNTQEALDWNITGAGLRATGLEWDLRKARPYSGYENYDFEVPTGHK-GDA
NUOCD_RHOS4      FRARTVGVGAYDTDTALTWGTTGPGLRATGCDWDLRKLRPYSGYEQFDFEVPLGQR-GDI
NUOCD_RHOS1      FRARTVGVGAYDTDMALTWGTTGPGLRATGCDWDLRKLRPYSGYEQFDFEVPLGQR-GDI
NUOCD_RHOS5      FRARTVGVGAYDTDTALTWGTTGPGLRATGCNWDLRKQRPYCGYEQFDFEVPLGQR-GDI
NUOCD_RHOPA      FRARTKGIAAYDTAMALDWGVTGPGLRATGYAWDVRKARPYAGFENFDFEIPVGHA-GDC
NUOCD_RHOPT      FRARTKGIAAYDTAMALDWGVTGPGLRATGYAWDVRKARPYAGFENFDFEIPVGHA-GDC
NUOCD_RHOPS      FRARTKGVGAYDTAMALDWGVTGPGLRATGYAWDVRKARPYAGFENFDFEIPVGVN-GDC
NUOCD_RHOP2      FQARTKGVAAYDTAMALDWGVTGPGLRATGSAWDVRKARPYSGFENFEFEIPVGHN-GDC
NUOCD_RHOP5      FRGRTVGIAAYDTATALDWGITGPGLRATGCDWDLRKARPYGGYENFEFEVPTGNN-GDC
NUOCD_RHOPB      FRARTVGIAAYDTATAFDWGITGPGLRATGCGWDMRKARPYGGYQNFEFEVPTGHR-GDC
                 :  *:  :. :    *: *. **  **: *   * *:  ** *:::  *::*     .  

NUOCD_ACICJ      YDRVVVHIEEIRQSLRIIRQCLDNMPPGPYKSDHRLTTPPLKERTMQDIETLITHFLNVS
NUOCD_GLUDA      YDRVRVHIAEIRQSLRIIRQCLDGMPAGAIKAEHRLTTPPPRARTMHDIETLIHHFLSVS
NUOCD_NITOC      YDRCWVRIEEMRQSLRIIEQCLNHMPAGSYKADHPLTTPPRKERTMHDIETLISHFLSVS
NUOCD_NITMU      YDRCAVRVQEIRQSLRIIDQCLENMPAGAHKADHPLTTPPLKKHTLHDIETLIDHFLGVS
NUOCD_METCA      YDRCAVRVEEMRQSLRIIEQCVEHMPSGPYKAEHPLTTPPPKERTMHDIETLIQHFLSVS
NUOCD_SHIB3      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SHISS      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOHS      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECO24      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOSM      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOLC      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SHIBS      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SHIDS      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SHIFL      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOL5      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SHIF8      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECO57      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOK1      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOL6      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOUT      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECOLI      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ECODH      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_CITK8      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ENT38      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALDC      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALEP      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALG2      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALHS      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALTI      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALTY      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALCH      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALA4      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALPA      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALPK      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALPB      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALSV      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALNS      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SALAR      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_KLEP7      YTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_CROS8      YTRVMLKVEEVRQSLRILEQCLKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SERP5      YTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ERWT9      YSRVMLKMEEMRQSMRILEQCLNNMPAGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PECAS      YSRVMLKVEELRQSLRILDQCLKNMPEGPFKADHPLTTPPPKERTLQHIDTLINHFLQVS
NUOCD_PHOLL      YDRVMLKVEEVRQSLRILKQCLDNMPEGPFKADHPLTTPPPKERTLQHIETMINHFLQVS
NUOCD_PROMH      YDRVMLKVEELRQSLRILEQCYKNMPAGPFKADHPLTTPPPKERTLQHIETMINHFLQVS
NUOCD_YERPE      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPP      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPA      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPN      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPS      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPB      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERP3      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPY      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERPG      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_YERE8      YDRVMLKVEELRQSLRILEQCYKNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_SODGM      YSRVMLKVEEMRQSLRILEQCLNNMPAGPFKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_BUCAI      YSRVMIKVEEIYQSLFILKQCLCNMPSGPFKSEDSLTTPPSKECVLQNIETMITHFLQVS
NUOCD_BUCAP      YSRVIIKVEEIYQSLSILKQCLKNMPEGPFKSDHPLTTPPPKERVLKDIDTMITHFLQVS
NUOCD_BUCBP      YSRVMLKLEEIWQSLAILKQCLENMPEGPFKMDHPNTTPPHKVRTLQHIETMISHFLKVS
NUOCD_BUCCC      YTRVLLKIEEIRQSLKILNQCLLHMPLGSYKSDHPLSTPQKKNKSLFHIERMITHFLQMS
NUOCD_BLOFL      YNRLVLKIEEMYQSIRILNQCLKNMPTGPVKSDHPLTTPPMKKYALKHIETLITHFLQVS
NUOCD_BLOPB      YSRVMLKVEEIYQSVRILEQCLQNMPIGPFKSDHPLATPPMKEYALQHIETLITHFLQVS
NUOCD_BAUCH      YSRVMLKVEEIRQSIRILKQCLHNMPAGPFKADHPLTTPPPKERTLQHIETLISHFLQVS
NUOCD_AERS4      YDRATVRIEEIRQSLSIIEQCMKNMPEGPFKADHPLTTPPPKDRTLQDIETLITHFLQVS
NUOCD_SHEON      YDRATVRIEEIRQSMRIIEQCMNNMPEGPFKADHPLTTPPPKERTLQHIETLINHFLQVS
NUOCD_AERHH      YDRALVRIEEVRQSMRIIEQCMKNMPEGPFKADHPLTTPPPKERTLQDIETLITHFLQVS
NUOCD_PSEAE      YDRCMVKMGEMRQSLRIIEQCLKNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEAB      YDRCMVKMGEMRQSLRIIEQCLKNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEA7      YDRCMVKMGEMRQSLRIIEQCLKNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEP1      YDRCMVRVEEMRQSIRIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEPK      YDRCMVRVEEMRQSIRIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEPG      YDRCMVRVEEMRQSIRIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEPW      YDRCMVRVEEMRQSIRIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEE4      YDRCMVRVEEMRQSIRIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEF5      YDRCMVRVEEMRQSIKIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEPF      YDRCMVRVEEMRQSVKIIDQCLRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSE14      YDRCMVRVEEMRQSIKIIDQCMRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEU2      YDRCMVRVEEMRQSIKIIDQCMRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSESM      YDRCMVRVEEMRQSIKIIDQCMRNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_PSEMY      YDRCMVRVEEMRQSIRIIDQCLKNMPEGPYKADHPLTTPPPKERTLQHIETLITHFLQVS
NUOCD_ACIBC      YARVLVHFREIEQSLKIIKQCLDNMPSGPYKADHPLAVPPPKDKTLQDIETLITHFLSVS
NUOCD_ACIBT      YARVLVHFREIEQSLKIIKQCLDNMPSGPYKADHPLAVPPPKDKTLQDIETLITHFLSVS
NUOCD_ACIBY      YARVLVHFREIEQSLKIIKQCLDNMPSGPYKADHPLAVPPPKDKTLQDIETLITHFLSVS
NUOCD_ACIBS      YARVLVHFREIEQSLKIIKQCLDNMPSGPYKADHPLAVPPPKDKTLQDIETLITHFLSVS
NUOCD_ACIAD      YARVMVHFREITESLKIIQQCLDNMPSGPYKADHPLAVPPPKDKTLQDIETLITHFLSVS
NUOCD_PSYA2      YDRCMVKVEEMRQSLRIIRQCMDNMPQGPYKADHPLAVPPPKDRTLNDIETLINHFISVS
NUOCD_PSYCK      YDRCMVKVEEMRQSLRIIRQCMDNMPQGPYKADHPLAVPPPKDRTLNDIETLINHFISVS
NUOCD_PSYWF      YDRCMVKIEEIRQSLRIIRQCMDNMPSGPYKADHPLAVPPPKNRTLNDIETLINHFISVS
NUOCD_CHRSD      FDRGQLRIDEMRQSLRIIQQCVDHMPAGDYKADHPLTTPPPREKMLQHIETLITHFLQVS
NUOCD_SHEWM      YDRCQLRVEEMRQSVKIIQQCINNMPEGEVKADHPLTTPPSQ-RSKHDIETLIQHFLNVS
NUOCD_RHOS4      FDRTRVRADEMRESLKIIRQCLENMPEGPVKADHPLTTPPPRGAMQKDIETLIAHFLQSS
NUOCD_RHOS1      FDRTRVRADEMRESLKIIRQCLGNMPEGPVKADHPLTTPPPRGAMQKDIETLIAHFLQSS
NUOCD_RHOS5      FDRTRVRADEMRESLKIIRQCLENMPEGAVKADHPLTTPPPRGAMQTDIETLIAHFLQSS
NUOCD_RHOPA      YDRTVVRVEEIRQSLKIIRQCVDNMPSGPIKADHPLTTPPPRERMLHDIETMIHHFVSTS
NUOCD_RHOPT      YDRTVVRVEEIRQSLKIIRQCVDNMPSGPIKADHPLTTPPPRERMLHDIETMIHHFVSTS
NUOCD_RHOPS      FDRTVVRVEEIRQSLKIIRQCVDNMPSGPIKADHPLTTPPPRERMLHDIETMIHHFVGAS
NUOCD_RHOP2      YDRTVVRVEEIRQSLKIIRQCVDNMPSGPIKADHPLTTPPPRERMLHDIETMIHHFVGAS
NUOCD_RHOP5      YDRVLVRVEEMRQSLRIIRQCLDHMPSGPIKADHPLTTPPPRERMLHDIDTLIHHFVGVS
NUOCD_RHOPB      YDRARVRVDEIRQSLRIIRQCLDHMPAGPIKADHPLTTPPPRERMLHDIETMIHHFVGSS
                 : *  ::  *: :*: *: **   ** *  * :.  :.*  :     .*: :* **:  *

NUOCD_ACICJ      WGPVLPPGEAMVSIEATKGINGYYLVADGDTVSYRTRIRTPSFPHLQMIPLISRGAYVAD
NUOCD_GLUDA      WGPVIPPGEAHACVEATKGLNSYHLISDGGTMSYRTRIRTPSFPHLQMIPLISRGGMIAD
NUOCD_NITOC      WGPVIPAGEACVGIEATKGNNSYYLISDGHTQPYRVRIRTPSFPHLQMIPLISRGSMVPD
NUOCD_NITMU      WGPVIPPGEAFVGIEATKGNNGYYLISDGNTTAYRVRIRTPSFPHLQMIPLISRGLMISD
NUOCD_METCA      WGPVIPPGEVCVTIEATKGLNGYYLTSDGGTMSYRTRIRTPSFPHLQMIPLMSRGMMVAD
NUOCD_SHIB3      WGPVMPANESFQMIEATKGINSYYLTSDGSTISYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_SHISS      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOHS      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECO24      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOSM      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOLC      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_SHIBS      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_SHIDS      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_SHIFL      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOL5      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_SHIF8      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECO57      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOK1      WGPVMPANESFQMVEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOL6      WGPVMPANESFQMVEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOUT      WGPVMPANESFQMVEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPAAIRGSLVSD
NUOCD_ECOLI      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPAAIRGSLVSD
NUOCD_ECODH      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPAAIRGSLVSD
NUOCD_CITK8      WGPVMPANESFQMVEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPVAVRGSLVSD
NUOCD_ENT38      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPVAVRGSLVSD
NUOCD_SALDC      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALEP      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALG2      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALHS      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALTI      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALTY      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALCH      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALA4      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALPA      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALPK      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALPB      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALSV      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALNS      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_SALAR      WGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_KLEP7      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSD
NUOCD_CROS8      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFPHLQQIPSVIRGSLVSD
NUOCD_SERP5      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPAVIRGSLVSD
NUOCD_ERWT9      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFPHLQQIPSVINGSLVSD
NUOCD_PECAS      WGPVMPANESFQMVEATKGINSYYLTSDGGTMSYRTRIRTPSYAHLQQIPSVIRGCLVSD
NUOCD_PHOLL      WGPVMPANESFQMIEATKGINSYYLTSDGSTVSYRTRVRTPSYPHLQQIPSVIRGSLVSD
NUOCD_PROMH      WGPVMPANESFQMVEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPAVIRGSLVSD
NUOCD_YERPE      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPP      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPA      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPN      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPS      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPB      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERP3      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPY      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERPG      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_YERE8      WGPVMPANESFQMVEATKGINSYYLTSDASTMSYRTRIRTPSYAHLQQIPSVIRGSLVSD
NUOCD_SODGM      WGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFPHLQQIPSVIRGSLVSD
NUOCD_BUCAI      WGPVIPENESFQMIEATKGINSYYLISDGGTMSYRTRIRTPSFPHLQQIPSVIRGSLISD
NUOCD_BUCAP      WGPVIPANESFQMIEATKGINSYYLISDGGTMSYRTRIRTPSFPHLQQIPSVIRGSLISD
NUOCD_BUCBP      WGPVLSSNESFKMVEATKGINSYYLISDGNTMSYRTRIRTPSFPHLQQIPSVIRGNLISD
NUOCD_BUCCC      WGPIIPSNESFQMIEATKGINSYYLISDGLTTSYRTRIRTPSFAHLQQIPSVIRGYVISD
NUOCD_BLOFL      WGPVIPPNESLQMVEATKGINSYYLISDGNTMSYRTRIRTPSFPHLQQIPSVIRGSLIPD
NUOCD_BLOPB      WGPVIPANESFQMIEATKGINSYYLISDGNTMSYRTRIRTPSFPHLQQIPHVIRGSLISD
NUOCD_BAUCH      WGPIIPANESFQMIEATKGINSYYLTSDGNTMSYRTRIRTPSFPHLQQIPSVIRGSLISD
NUOCD_AERS4      WGPVMPAAESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVIKGSMVSD
NUOCD_SHEON      WGPVMPAAESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVIKGSMVSD
NUOCD_AERHH      WGPVMPAAESFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVIRGQMVSD
NUOCD_PSEAE      WGPVMPANEAFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVINGSMIAD
NUOCD_PSEAB      WGPVMPANEAFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVINGSMIAD
NUOCD_PSEA7      WGPVMPANEAFQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVINGSMIAD
NUOCD_PSEP1      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSEPK      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSEPG      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSEPW      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSEE4      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSEF5      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSFAHLQQIPSVIRGSMVAD
NUOCD_PSEPF      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSFAHLQQIPSVIKGSMVAD
NUOCD_PSE14      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSEU2      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSYPHLQQIPSVIKGSMVAD
NUOCD_PSESM      WGPVMPANESFQMIEATKGINSYYLTSDGGTMSYRTRIRTPSFPHLQQIPSVIQGSMVAD
NUOCD_PSEMY      WGPVMPAGEALQMIEATKGINSYYLTSDGSTMSYRTRIRTPSFAHLQQIPSVIRGSMVAD
NUOCD_ACIBC      WGPVMPAGEASFMTEVVKGASTYYLTSDKATMSYRTRIRTPTFTHLQQIPSVINGSLVSD
NUOCD_ACIBT      WGPVMPAGEASFMTEVVKGASTYYLTSDKATMSYRTRIRTPTFTHLQQIPSVINGSLVSD
NUOCD_ACIBY      WGPVMPAGEASFMTEVVKGASTYYLTSDKATMSYRTRIRTPTFTHLQQIPSVINGSLVSD
NUOCD_ACIBS      WGPVMPAGEASFMTEVVKGASTYYLTSDKATMSYRTRIRTPTFTHLQQIPSVINGSLVSD
NUOCD_ACIAD      WGPVMPAGEASFMTEVVKGASTYYLTSDKSTMSYRTRIRTPTFTHLQQMPSVINGSLVSD
NUOCD_PSYA2      WGPVMPAGECTTIVEATKGLNSYYITSDKATMSYRTRIRTPTFAHLQQMPSVINGSLVSD
NUOCD_PSYCK      WGPVMPAGECTTIVEATKGLNSYYITSDKATMSYRTRIRTPTFAHLQQMPSVINGSLVSD
NUOCD_PSYWF      WGPVMPAGEASMMVEATKGINSYYITSDRSTMSYRTRIRTPTFAHLQQMPSVINGSLVSD
NUOCD_CHRSD      WGPVLKPNESLSMIEATKGINSYYLTADGNTMSYRTRIRTPSFPHLQQIPAAVRGALVPD
NUOCD_SHEWM      WGPVMPKGESCFAVEATKGVNAYTIISDGSNTSYRTRIRTPSFAHLQMIPKMAKGLMVAD
NUOCD_RHOS4      WGTVVPAGEATGQIEGHRGLTQYAIVSDGGTQSYRTRIRTPSFAHLQMIPKIVPGMTVAD
NUOCD_RHOS1      WGTVVPAGEATGQIEGHRGLTQYSVVSDGGTQSYRTRIRTPSFAHLQMIPKIVPGMTVAD
NUOCD_RHOS5      WGTVVPAGEATGQIEGHRGLTQYAIVSDGGTQSYRTRIRTPSFAHLQMIPEIVPGMTVAD
NUOCD_RHOPA      WGPVLPPGEYTGQVETVRGLTQFALISDGEPSSYRTRIRTPSFAHLQMISAVAPGMMVAD
NUOCD_RHOPT      WGPVLPPGEYTGQVETVRGLTQFALISDGEPSSYRTRIRTPSFAHLQMISAVAPGMMVAD
NUOCD_RHOPS      WGPVLPAGEYTGQVETVRGLTQFALISDGEPSSYRTRIRTPSFAHLQMISAVAPGMMVAD
NUOCD_RHOP2      WGPVLPPGETTGQVETVRGLTQFALISDGEPSSYRTRIRTPSFPHLQMISAVAPGMMVAD
NUOCD_RHOP5      WGPVVPAGEATGQAETVRGLTQYALVSDGATCSYRTRIRTPSFAHLQAVSAIAPGLTVAD
NUOCD_RHOPB      WGPVVPVGEATGQVESVRGLTQYAVVSDGETTAYRTRIRTPSFAHLQSIATIAPGLTVAD
                 **.::   *     *  :* . : : :*    .**.*:***::.*** :.    *  :.*

NUOCD_ACICJ      LIAIIGSIDFVMADVDR
NUOCD_GLUDA      LIAIIGSIDFVMADVDR
NUOCD_NITOC      LIATLGSIDFVMADVDR
NUOCD_NITMU      LIAILGSIDFVMADVDR
NUOCD_METCA      LIAILASIDFVMADVDR
NUOCD_SHIB3      LIVYLGSIDFVMSDVDR
NUOCD_SHISS      LIVYLGSIDFVMSDVDR
NUOCD_ECOHS      LIVYLGSIDFVMSDVDR
NUOCD_ECO24      LIVYLGSIDFVMSDVDR
NUOCD_ECOSM      LIVYLGSIDFVMSDVDR
NUOCD_ECOLC      LIVYLGSIDFVMSDVDR
NUOCD_SHIBS      LIVYLGSIDFVMSDVDR
NUOCD_SHIDS      LIVYLGSIDFVMSDVDR
NUOCD_SHIFL      LIVYLGSIDFVMSDVDR
NUOCD_ECOL5      LIVYLGSIDFVMSDVDR
NUOCD_SHIF8      LIVYLGSIDFVMSDVDR
NUOCD_ECO57      LIVYLGSIDFVMSDVDR
NUOCD_ECOK1      LIVYLGSIDFVMSDVDR
NUOCD_ECOL6      LIVYLGSIDFVMSDVDR
NUOCD_ECOUT      LIVYLGSIDFVMSDVDR
NUOCD_ECOLI      LIVYLGSIDFVMSDVDR
NUOCD_ECODH      LIVYLGSIDFVMSDVDR
NUOCD_CITK8      LIVHLGSIDFVMSDVDR
NUOCD_ENT38      LIVHLGSIDFVMSDVDR
NUOCD_SALDC      LIVYLGSIDFVMSDVDR
NUOCD_SALEP      LIVYLGSIDFVMSDVDR
NUOCD_SALG2      LIVYLGSIDFVMSDVDR
NUOCD_SALHS      LIVYLGSIDFVMSDVDR
NUOCD_SALTI      LIVYLGSIDFVMSDVDR
NUOCD_SALTY      LIVYLGSIDFVMSDVDR
NUOCD_SALCH      LIVYLGSIDFVMSDVDR
NUOCD_SALA4      LIVYLGSIDFVMSDVDR
NUOCD_SALPA      LIVYLGSIDFVMSDVDR
NUOCD_SALPK      LIVYLGSIDFVMSDVDR
NUOCD_SALPB      LIVYLGSIDFVMSDVDR
NUOCD_SALSV      LIVYLGSIDFVMSDVDR
NUOCD_SALNS      LIVYLGSIDFVMSDVDR
NUOCD_SALAR      LIVYLGSIDFVMSDVDR
NUOCD_KLEP7      LIVYLGSIDFVMSDVDR
NUOCD_CROS8      LIVYLGSIDFVMSDVDR
NUOCD_SERP5      LIVYLGSIDFVMSDVDR
NUOCD_ERWT9      LIVYLGSIDFVMSDVDR
NUOCD_PECAS      LIVYLGSIDFVMSDVDR
NUOCD_PHOLL      LIVYLGSIDFVMSDVDR
NUOCD_PROMH      LIVYLGSIDFVMSDVDR
NUOCD_YERPE      LIVYLGSIDFVMSDVDR
NUOCD_YERPP      LIVYLGSIDFVMSDVDR
NUOCD_YERPA      LIVYLGSIDFVMSDVDR
NUOCD_YERPN      LIVYLGSIDFVMSDVDR
NUOCD_YERPS      LIVYLGSIDFVMSDVDR
NUOCD_YERPB      LIVYLGSIDFVMSDVDR
NUOCD_YERP3      LIVYLGSIDFVMSDVDR
NUOCD_YERPY      LIVYLGSIDFVMSDVDR
NUOCD_YERPG      LIVYLGSIDFVMSDVDR
NUOCD_YERE8      LIVYLGSIDFVMSDVDR
NUOCD_SODGM      LIVYLGSIDFVMSDVDR
NUOCD_BUCAI      LIVYLGSIDFVMSDVDR
NUOCD_BUCAP      LIVYLGSIDFVMSDVDR
NUOCD_BUCBP      LIAYLGSIDFVMSDVDR
NUOCD_BUCCC      LIVYLGSIDFVMSDVDR
NUOCD_BLOFL      LIAYLGSIDFVMSDVDR
NUOCD_BLOPB      LIVYLGSIDFVMSDVDR
NUOCD_BAUCH      LIVYLGSIDFVMSDVDR
NUOCD_AERS4      LIVYLGSIDFVMSDVDR
NUOCD_SHEON      LIVYLGSIDFVMSDVDR
NUOCD_AERHH      LIVYLGSIDFVMSDVDR
NUOCD_PSEAE      LIAYLGSIDFVMADVDR
NUOCD_PSEAB      LIAYLGSIDFVMADVDR
NUOCD_PSEA7      LIAYLGSIDFVMADVDR
NUOCD_PSEP1      LIAYLGSIDFVMADVDR
NUOCD_PSEPK      LIAYLGSIDFVMADVDR
NUOCD_PSEPG      LIAYLGSIDFVMADVDR
NUOCD_PSEPW      LIAYLGSIDFVMADVDR
NUOCD_PSEE4      LIAYLGSIDFVMADVDR
NUOCD_PSEF5      LIAYLGSIDFVMADVDR
NUOCD_PSEPF      LIAYLGSIDFVMADVDR
NUOCD_PSE14      LIAYLGSIDFVMADVDR
NUOCD_PSEU2      LIAYLGSIDFVMADVDR
NUOCD_PSESM      LIAYLGSIDFVMADVDR
NUOCD_PSEMY      LIAYLGSIDFVMADVDR
NUOCD_ACIBC      LIIYLATIDVVMADVDR
NUOCD_ACIBT      LIIYLATIDVVMADVDR
NUOCD_ACIBY      LIIYLATIDVVMADVDR
NUOCD_ACIBS      LIIYLATIDVVMADVDR
NUOCD_ACIAD      LIIYLATIDVVMADVDR
NUOCD_PSYA2      AIMYLASIDVVMADCDR
NUOCD_PSYCK      AIMYLASIDIVMADCDR
NUOCD_PSYWF      LIIYLASIDIVMADTDR
NUOCD_CHRSD      LIAHLGSIDFVMADVDR
NUOCD_SHEWM      LIVILASIDFVMADVDR
NUOCD_RHOS4      LVAHIASIDFVMSDVDR
NUOCD_RHOS1      LVAHIASIDFVMSDVDR
NUOCD_RHOS5      LVAHIASIDFVMSDVDR
NUOCD_RHOPA      LVAYLGSIDYVMSDVDR
NUOCD_RHOPT      LVAYLGSIDYVMSDVDR
NUOCD_RHOPS      LVAFLGSIDYVMSDVDR
NUOCD_RHOP2      LVAYLGSIDYVMSDVDR
NUOCD_RHOP5      LVAYLGSIDYVMSDVDR
NUOCD_RHOPB      LVAYLGSIDYVMSDVDR
                  :  :.:** **:* **