CLUSTAL format seed alignment for MF_01361

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1737_BORPE      ---MLHYAVVFFVIAIIAAVLGFGGIAAGAAGIAKILFFVFLVLALLSILGGVFRK----
Y1230_BORA1      ---MLYYAAVFFVIALIAAVLGFGGIAAGAAGIAKILFFVFLVLALLSVLSGALRKK---
Y352_GLUOX       ---MLHYAIVFFIISIIAGVFGFSGISAATAGIAKLFFIVFLVLAVLAILAGVAGLHAL-
Y4217_XANOR      ---MLHYAMIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVISM-FRR-GKV---
Y1350_BURCA      ---MLRYAIIFFIIAIIAAVFGFGGIAAGAAEIAKILFYIFVVIFLVTLLLGVVRR----
Y7021_BURL3      ---MLRYAVIFFIIAIVAAVFGFGGIAAGAAEIAKILFYIFVVIFLVTLLLGVVRR----
Y1464_PARXL      ---MLRYAAIFFIIAIIAAVFGFGGIAAGATEIAKVLFFIFVVIFLVTLLMGVMRR----
Y6216_BURPS      ---MLRYALVFFIIAIIAAVLGFGGIAAGAAEIAKILFYIFVVIFLVTLVLGVARR----
Y2958_PARXL      ---MLHYAIVFFVIAIIAAVFGFTGIAAGAAEIAKILFYIFLVVFVVTLLLGVFRT----
Y2080_DECAR      ---MLRYAIVFFIIALIAALFGFTGIAAGAVEIAKIMFFIFVLLALVSLVMGFTRRK---
Y124_CUPPJ       ---MLQYALVFFVIALIAAVFGFGGIAAGAVEIAKILFFIFLIVALVTAVMGLVRRR---
Y093_CUPMC       ---MLYYALVFFIVALIAAIFGFGGIAAGAVEIAKILFLIFLVVAIVTFVMGLVRRR---
Y2238_THIDA      ---MLYYALVFFIIAIVAAVFGFSGIAAGAVGIAKILFVVFLIMAIATFVVNLLRGR---
Y879_POLSJ       ---MLHYSVVFLVIALIAAIFGFGGIAAGAVEIAKILFFIFAIMAVVSFVMGLIKKN---
Y1875_RHOFT      ---MLHYAVVFFVIALIAALFGFGGIAASAVSIGKILFIVFAILAVASFLFGLIKKR---
Y947_METFK       ---MLHYSVIFFVIALIAAFFGFSGIAAGAAEIAKILFFVFLIITIVSLVAGIFHKR---
Y5166_RALSO      ---MLRYAVIFFIIALIAALFGFGGIAAGAAGIAKILFMIFVVLFVVSLFWGLVAGRG--
YTJA_ECOLI       ---MFRWGIIFLVIALIAAALGFGGLAGTAAGAAKIVFVVGIILFLVSLFMGRK-RP---
YTJA_SALTY       ---MFRWGIIFLVIALIAAALGFGGLAGTAAGAAKIVFVVGIVLFLVSLFMGRK-RP---
Y577_YERPS       ---MFRWGIIFLIIALIAAALGFGGLAGTAAWAAKVVFVVGIILFLISLFTGRK-RL---
Y393_SODGM       ---MFRWGIIFLVIALIAAALGFGGLAGTAAWAAKIVFVVGIILFLISLFTGRR-GR---
Y482_NITOC       ---MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLGRRGRPPL-
Y484_NITOC       ---MFGWAVTFLIVALVAALLGFTGIAGIATEIAWILFVVGIILFVVFLVLGRRGRPPL-
Y1120_NITEU      ---MFNMALVFFLIAVLAGILGFAGIAGTLAWAAKVLFFAGLILTVVFYLLGKR-TPPV-
Y2772_THIDA      ---MFGWAITFLVIAIAAGIFGFAGLAGTAAWIAKVLFVVGLAAVLIMLVMGRR-PPTV-
Y270_SACD2       ---MLYYSIVFLLIALVAGLFGFVGIAGVATGIAKILFFVFLIAFVVSLVIGRR--PRV-
Y044_PSEPF       ---MLSWAITFLIIAIIAAVLGFGGIAGTATGIAKILFVVFLVMFIASFFFGRRGRG---
Y249_PSE14       ---MLSWAITFLIIAIVAAVLGFGGIAGTATGIAKILFVVFLVMFVVSFFFGRRGRG---
Y135_PSEPK       ---MLSWAITFLIIAIVAAVLGFGGIAGAATGIAKILFIVFLVLFVASFFFGR-GRG---
Y5482_PSEAE      ---MLSWAITFLIIAIIAAVLGFGGIAGAATGIAKILFVLFLVLFVVSFFFGR-RRG---
Y2627_CHRSD      ---MLNYAIIFLIIAIIAGVLGFGGIAGAAATIAKVLFFVFLILFIVSLVRSR-GR----
Y6560_BRADU      ---MLGWVVTFLVIALIAGILGFGGIAGASIEIAKIIFFIAVVLFLVSAVV---GLARGR
Y3278_RHOPB      ---MLGWVITFLVVALIAGILGFGGIAGASIEIAKIIFFIAVVLFLVSAVV---GLARGR
Y2024_RHOP2      ---MLGWVVTFLVVALIAGLLGFGGIAGASIEIAKVIFFIAIVLFLVSAVV---GLVRGR
Y3505_RHOPA      ---MLGWVVTFLVVALIAGLLGFGGIAGASIEIAKIIFFIAIVLFLVSAVI---SIFRGR
Y2738_NITHX      ---MLSWVVTFLIIALIAGILGFGGLAGASVEIAKIIFFIAVILFVVSAVV---GLLRGR
Y2359_NITWN      ---MLNWVVTFLVIALIAGVLGFGGIAGASFEIAKIIFFIALILFVISAVV---GFLRGR
Y696_IDILO       ---MLRWVLIFLAVAVVAAILGFGGIAGTAAGIAKIIFYIFIILFAISLVV---RLLQGN
Y537_PSET1       ---MLRWTITFLVIALIAAVLGFGGIAGAAAGIAKIIFFIFLILLVISLVS---GALRGK
Y3570_JANSC      ---MLRWAVTFLIIALIAALFGFGGIAGASAGIAQILFFVFIALFAISLVA---RGLSGP
Y2720_RUEST      ---MLSWALAFLVIALIAAVFGFGGIASASAGIAQILFFIFLVMFVVALIL---RAVRG-
Y3110_CHESB      ---MLYWALVFLVVAIIAGALGFGGIAGASAGIAQILFYIFLILLVVSLLF---GLFRRA
Y3702_RHILO      ---MLYWALVFLVVAIIAGALGFGGIAGTSAGIAQILFFIFLAFLVISLLA---GLFRRA
Y741_RHIME       ---MLYYALVFLIVAIIAGVLGFGGIAGASAGIAQVLFFLFLIFLVISLVA---GLIRRT
Y373_BRUME       ---MLYYVLVFLVVALVAGALGFGGIAGASAGIAQILFFFFLALLVISLIA---SAIRKA
Y4916_RHIL3      ---MLYYALVFLVVALIAGVLGFGGIAGASASIAQVLFFIFLVLFVVSLVM---RLMRKV
Y4387_HAHCH      ---MLYWSIVFFVVALVAGVLGFTGIAAATADIAQILFVIFLVLFVISIIA---GGFRRN
Y119_RHORT       ---MLTWALIFLVVAVVAALFGFGGIAGAAASIAQILFFVFLVLLVISLIM---HFTRRS
Y082_VIBPA       ---MVRWMFIFLALALVSAVLGFSGIAGAAAAVAQVIFYLFLLSLIVSIVF---VILGKK
Y2443_LEGPL      ---MLSWALIFFIIAIIAAAFGFGGIAVAAAGIAKILFFLFLVMFVIFLIMGLIGRRGPP
Y2589_LEGPA      ---MLTWALIFFIIAIIAAAFGFGGIAVAAAGIAKILFFLFLVMFVIFLIMGLVGRRGPP
Y2415_LEGPH      ---MLYWALIFLIVAIVAGLFGFRGVASAATGIAKVLFFLFIVMFIVLLVFSLLGGTPEP
Y4467_AGRFC      ---MLKWALIFFVISLIAGVFGFTGISAAAAGVARILFFIAVVIFLVFLVL---ALMAGS
Y4195_RHIL3      ---MLKWALIFFVISIIAGFFGFSGVSAATATIARVLFGIALVIFLIFLVL---ALMAGQ
Y4784_RHIME      ---MLKWALIFFVISLIAGFLGFSGVSAATAGIAKILFYIAVIIFLVFLVL---ALAVGG
Y2239_THIDA      ---MLKWALVFFVISLIAGFFGFTGVASGAAAIAKILFYIAVALFLLFLVL---GVFAVK
Y3963_AROAE      ---MIKWAIIFFVISVIAGLLGFTGVAAGAAGIARVLFYIALAIFLIVLVF---GVLLGV
Y5717_BRADU      -MTILKWALIFLLVSIVAGVLGFTGISAASADIARFLFYVFVVIFLVLLIL---GLTIFR
Y3029_RHOPA      -MTILKWALIFLVVSIIAGIFGFTGISAASADIARILFYVFVVIFVVLLIL---GFTIFR
Y2356_RHOPB      -MTILKWALIFFVVSVIVGVLGFTGISAASADVARILFYIFLVIFLVLLIL---GLTIFR
Y2510_RHOP2      -MTILKWALIFLVISVIAGIFGFTGISAASADLARILFYIFAVIFIVLLIL---GFTIFR
Y130_NITEU       ---MLKWAIIFAIISFISGVFGFRSTSAGTASIAKFLFFLFALITLVLLVL---GLLGIG
Y2959_PARXL      ---MLKWALFFAVVAVIAGVLGFTGVAAGAAAIAKFLFIVFVILCVVFLVL---GFVVTK
Y066_POLSJ       ---MLKYAIIFAVISLIAGALGFGGVAAGAAGIAKILFGLFLILAVIFVVLAALGVGAVR
Y1885_XANOR      ---MIKWAIIFAIIGLIAGALGFGGMAGAAMGIAKFLFWAGIIIAIVLFVL---GMTIAK
Y3392_CHESB      ---MLKWILILLIVAAVAGLLGMHSLAGAAMTGAKILIAIVLILFLLAVL----GIIAIA
Y4317_RHILO      ---MIKWIIILLIVAAAASLLGMPALAGAAATGARILIGIVLVIFLLVVL----GIFAVT
Y673_CAUVC       ---MLKWAIILAIVALIAGALGFSGLAGAAAGVAKILFFLFLVGFVLVLLLGG-TVFKAA
Y139_PSYCK       ---MFRWAIIFAVIALLASFLGFGGVAGLSANFAYILLALAVILFIVAFVSR---RM---
Y3602_ACIAD      ---MFRWAIIFAVIALIASLLGFGGVAGLSKDFAVILLVVAVILAIVGFISRG--RV---
Y2507_HALMA      ----MYYAVVLVILAVVAGIAGFRGIAGLSFRVAKFLIVIFLVLALVTFLL---------
Y2216_METBU      MADLIGLAIVFLIFALVAYVLGARGVAGLSMTIAKWLVIIFIVLAIITILL---------
Y1438_BDEBA      ---MLRAAIAFFIIAIVAYIFGASGVAGMSVEIGRILLFVFLALAIISFVINLVSGRKP-
Y2640_GLOVI      ---MLNLLWLVVVLMVIAALLGFGGVVSSLQSVAWFLIVAAVVLAVVGFVTGRRAL----
                     .     .  .       *  .        .  ..                      

Y1737_BORPE      ----------------
Y1230_BORA1      ----------------
Y352_GLUOX       ----------------
Y4217_XANOR      ----------------
Y1350_BURCA      ----------------
Y7021_BURL3      ----------------
Y1464_PARXL      ----------------
Y6216_BURPS      ----------------
Y2958_PARXL      ----------------
Y2080_DECAR      ----------------
Y124_CUPPJ       ----------------
Y093_CUPMC       ----------------
Y2238_THIDA      ----------------
Y879_POLSJ       ----------------
Y1875_RHOFT      ----------------
Y947_METFK       ----------------
Y5166_RALSO      ----------------
YTJA_ECOLI       ----------------
YTJA_SALTY       ----------------
Y577_YERPS       ----------------
Y393_SODGM       ----------------
Y482_NITOC       ----------------
Y484_NITOC       ----------------
Y1120_NITEU      ----------------
Y2772_THIDA      ----------------
Y270_SACD2       ----------------
Y044_PSEPF       ----------------
Y249_PSE14       ----------------
Y135_PSEPK       ----------------
Y5482_PSEAE      ----------------
Y2627_CHRSD      ----------------
Y6560_BRADU      T-------RI------
Y3278_RHOPB      N-------RV------
Y2024_RHOP2      T-------RV------
Y3505_RHOPA      T-------RV------
Y2738_NITHX      T-------RV------
Y2359_NITWN      N-------RV------
Y696_IDILO       K-------RL------
Y537_PSET1       K-------P-------
Y3570_JANSC      S-------S-------
Y2720_RUEST      ----------------
Y3110_CHESB      R---------------
Y3702_RHILO      ----------------
Y741_RHIME       ----------------
Y373_BRUME       ----------------
Y4916_RHIL3      ----------------
Y4387_HAHCH      R-------L-------
Y119_RHORT       R-------L-------
Y082_VIBPA       N-----VNR-------
Y2443_LEGPL      PV--------------
Y2589_LEGPA      PV--------------
Y2415_LEGPH      VVIVKP----------
Y4467_AGRFC      AIV-------------
Y4195_RHIL3      AIL-------------
Y4784_RHIME      AVT-------------
Y2239_THIDA      SIK-------------
Y3963_AROAE      LVF-------------
Y5717_BRADU      A---------------
Y3029_RHOPA      A---------------
Y2356_RHOPB      A---------------
Y2510_RHOP2      T---------------
Y130_NITEU       VVA-------------
Y2959_PARXL      KIVD------------
Y066_POLSJ       KGMK------------
Y1885_XANOR      KVI-------------
Y3392_CHESB      ----------------
Y4317_RHILO      ----------------
Y673_CAUVC       TGPK------------
Y139_PSYCK       ----------------
Y3602_ACIAD      ----------------
Y2507_HALMA      ----------------
Y2216_METBU      ----------------
Y1438_BDEBA      ----------------
Y2640_GLOVI      ----------------