CLUSTAL format seed alignment for MF_01363

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL21_TREDE      ----------------------------MYALIEYKGKQYKAEKGAKLVVDKLSAES-GS
RL21_TREPA      ----------------------------MYALIEYKGKQYKVERGSSIVVDNISEVAPGG
RL21_DEHMC      -----------------------MGGVNIYAIIESGGKQYKVTPGQLVEVDLLDLAE-GD
RL21_PELUB      ---------------------------MSYAIIQTGGKQYKVKAGEILKIERLEDSKPET
RL21_THEMA      ---------------------------MLYAIVETAGRQYRVEEGKILYTEKQKDYSPGD
RL21_BORAP      ----------------------------MYALVEINGKQYKAVEGEFLKIDKISPIE-KE
RL21_HELHP      ----------------------------MYAIFKNGGKQYKVVEGSIILLDKM-SLEPKS
RL21_WOLSU      ----------------------------MYAIVKNGGKQYKVQEGDIVLFDKM-SLEPKS
RL21_HELPJ      ---------------------------MSYAIFKHGGKQYKVVEGDIVLLDKM-NKEPKA
RL21_SULDN      ----------------------------MYAIIKNGGKQYKVQEGDILLFDRM-TLEPKA
RL21_CAMJR      ----------------------------MYAIIKHSGKQYKVSVGDELKLDHF-EAESKA
RL21_ECOLI      ----------------------------MYAVFQSGGKQHRVSEGQTVRLEKL-DIATGE
RL21_SODGM      ----------------------------MYAVLQSGGKQHRVSEGQTVRLEKL-DIATGE
RL21_PHOLL      ----------------------------MYAVFQSGGKQHRVSEGQTIRLEKL-DIATGE
RL21_HAES1      ----------------------------MYAVFQSGGKQHRVSEGHVVRLEKL-ELATGS
RL21_PSEA6      ----------------------------MYAVFQSGGKQHRVAEGQTVRLEKI-EVAPGE
RL21_IDILO      ----------------------------MYAVFQSGGKQHRVSEGQIVRLEKL-EAATGD
RL21_PHOPR      ----------------------------MYAVFQSGGKQHRVSEGQTLRLEKL-EAETGA
RL21_PSET1      ----------------------------MYAVFQSGGKQHRVTEGQTIRLEKL-DVETGA
RL21_SHEON      ----------------------------MYAVFQSGGKQHRVAPGHTVRLEKL-EVATGS
RL21_COLP3      ----------------------------MYAVFQSGGKQHRVTEGQTVRLEKL-ELEVGA
RL21_SACD2      ----------------------------MYAVFIAGGKQHRVEEGEVLRLEKI-EVATGE
RL21_HAHCH      ----------------------------MYAVIVSGGKQHRVKEGERLKLEKI-EVETGG
RL21_PSEAE      ----------------------------MYAVIVTGGKQHKVTEGEFLKVEKL-DVATGE
RL21_CHRSD      ----------------------------MYAVIKSGGKQYRVQEGQTLKLEKL-EVATGE
RL21_ALCBS      ----------------------------MYAVIKTGGKQYRVEEGDVVRIEKI-EVATGE
RL21_ALKEH      ----------------------------MYAVIKTGGKQYKVSEGDVLRVEKL-AGEAGA
RL21_HYDCU      ----------------------------MYAVIKTGGKQYRVREGQILRVESL-GANEGD
RL21_LEGPL      ----------------------------MYAVIKTGGKQYTVKEGDVLKIEML-PENVGN
RL21_COXBU      ----------------------------MYAIIKTGGKQYRVTEGQMLKVEKL-AQDVGQ
RL21_PSYCK      ----------------------------MYAVIKTGGKQHRVVVNELLKVELL-KAETGE
RL21_ACIAD      ----------------------------MYAVIQSGGKQHRVVEGETLKVELL-KAETGS
RL21_PARXL      ----------------------------MYAVIKTGGKQYKVAVGEKLKVEQI-PADIDA
RL21_BORA1      ----------------------------MYAVVKTGGKQYRVAAGEKLKVEQI-PADIGQ
RL21_AROAE      ----------------------------MYAVIKTGGKQYRVAAGEKIKVEQI-PADVGS
RL21_DECAR      ----------------------------MYAVIKTGGKQYRVSAGQKLKVEQI-PADVGA
RL21_RHOFT      ----------------------------MYAVIKTGGKQYRVAAGEKIKVEQI-AADVGQ
RL21_POLSJ      ----------------------------MYAVIKTGGKQYKVAAGEKIKVEQI-AADVGQ
RL21_NEIG1      ----------------------------MYAVVKTGGKQYKVSVGEKLKVEQI-PAQLDS
RL21_CHRVO      ----------------------------MYAVIKTGGKQYKVAIGEKLKVEQI-PADVDS
RL21_NITEU      ----------------------------MYAVIKTGGKQYRVEVGNKLKVETL-PAEVGS
RL21_NITMU      ----------------------------MYAVIKTGGKQYRVENGLKLKIEQV-PVEIGS
RL21_THIDA      ----------------------------MYAVIKTGGKQYRVSAGDKLKIEKL-EAEVGS
RL21_METFK      ----------------------------MYAVIKTGGKQYRVAAGDKLKVEKL-AGEVGS
RL21_XANOM      ----------------------------MYAVLVTGGKQYRVAQGETLRVEKL-EVEAGN
RL21_XYLFT      ----------------------------MYAVLVTGGKQYRVVQGETLRVEKL-DVETGG
RL21_METCA      ----------------------------MYAVIQTGGKQYRVQPGDKVKVESL-DAEAGQ
RL21_NITOC      ----------------------------MYAVIKTGGKQYRVQEGDTLRVEKI-NADEGA
RL21_BLOFL      ----------------------------MYAVFQIGSKQYYVRTGQVIFIDRV-KLDIGN
RL21_BLOPB      ----------------------------MYAVFQTGSKQYRVVEGQVIHIERI-DLEVGN
RL21_WIGBR      ----------------------------MYAIFKINGVQYKAKSGSVVCLNKI-SGDIGS
RL21_BUCAI      ----------------------------MYAVFISGGKQYRVVKNQIIRLEKL-NSPLGT
RL21_BUCAP      ----------------------------MYAVFMSGGKQYRVKKNQIIQLEKL-NNSPGS
RL21_BUCBP      ----------------------------MYAIFKSGGKQHKVIKGQTIRLEKI-NQSIGT
RL21_BAUCH      ----------------------------MYAIFQSGGKQYQVKEGQTIRLEKL-NVATGS
RL21_RHOBA      ----------------------------MYAIFVDGGRQYRVEPGMELDVDYR-DIAAGE
RL21_GEOSL      ----------------------------MYAVIRTGGKQYKVSEGDFLKVEKL-EGAVGD
RL21_PELCD      ----------------------------MYAVIKTGGKQYKVSEGDLVKIEKI-EGAVGD
RL21_BDEBA      ----------------------------MYAIIRTGGKQYKVQAGDVVQVDKL-EQALGA
RL21_SYNAS      ----------------------------MYAVIKTGGKQHRVSEGDLLTVEKL-AGSKGD
RL21_DESPS      ----------------------------MYAIVRTGGKQYQVACGDQLRVEKL-EGNVGD
RL21_ZYMMO      ----------------------------MFAIVRTGGKQYRVAAGDKIVVEKI-AGEAGT
RL21_SPHAL      ----------------------------MFAIVRTGGKQYRVAAGDKIAVEKI-EGEAGD
RL21_NOVAD      ----------------------------MFAIVRTGGKQYRVAAGDKIAVEKL-AGEAGD
RL21_MAGSA      ----------------------------MFAVIQTGGKQYKVASGDVIRVEKL-AGEAGA
RL21_RICBR      ----------------------------MFAVIKAGGKQYKVDQNSVIKVEKI-EGELGS
RL21_ANAMM      ----------------------------MFAVVEAGGKQYKVKESYVIKVELM-DVSVGE
RL21_ANAPZ      ----------------------------MFAVVETGGKQYKVKEQDVIKVELL-KAGIGE
RL21_EHRRW      ----------------------------MFAIIETGGKQYKVKEHDIIRIEKL-NASVGE
RL21_WOLTR      ----------------------------MFAVIETGGKQYLVKKGSVIKVEKL-EAEEGK
RL21_NEOSM      ----------------------------MLAVVEQGSKQYLVRKGQVISVEKI-SAEPGK
RL21_RHOPA      ----------------------------MFAVIKTGGRQYRVVPEDVLEVGKI-DGDVGS
RL21_RHOPB      ----------------------------MFAVIKTGGRQYRVVPDDVLEIGKI-AGDVGT
RL21_NITWN      ----------------------------MFAVIKTGGRQYRVVPDDVLEIGKI-AGEVGT
RL21_BRADU      ----------------------------MFAVIKTGGRQYRVAPDDVLEVGKI-EGEVGS
RL21_GLUOX      ----------------------------MYAVIRTGGKQYRVAPESILKVEKL-EAEAGS
RL21_GRABC      ----------------------------MFAVIRTGGKQYRVTPNAVLKVEKL-EAEPGS
RL21_BARQU      ----------------------------MFAVIKTGGKQYHVVANQVVKVEKV-IGNAGD
RL21_CHESB      ----------------------------MFAVIKTGGKQYRVAANDTLLIERI-AGEVGE
RL21_RHILO      ----------------------------MFAVIKTGGKQYRVAANDLLKIEKV-EANVGD
RL21_BRUSU      ----------------------------MFAVIKTGGKQYRVAANDLIKVEKV-AGEAGD
RL21_AGRFC      ----------------------------MFAVIKTGGKQYRVAADAVLTIEKL-EAEAGA
RL21_RHIME      ----------------------------MFAVIKTGGKQYRVAANDVITIEKL-EGVAGD
RL21_HYPNA      ----------------------------MFAVIKTGGKQYKVAEGDTIVIERL-AAAAGE
RL21_RHORT      ----------------------------MFAVIKTGGKQYKVAENDVIDIEKL-EADEGA
RL21_MARMM      ----------------------------MFAVIKTGGKQYRVAAGDEIRIEKL-EGAAGD
RL21_RUEPO      ----------------------------MFAVLKTGGKQYKVQAGDVLRVEKL-AADAGE
RL21_RUEST      ----------------------------MFAVLKTGGKQYKVQAGDMLRVEKL-AADAGE
RL21_RHOS4      ----------------------------MFAVLKTGGKQYKVQAGDVLRVEKL-ACEAGD
RL21_ROSDO      ----------------------------MFAVLKTGGKQYKVQAGDMLRVEKL-AADAGE
RL21_JANSC      ----------------------------MFAVMKTGGKQYKVQAGDKLRVELL-AAEAGE
RL21_ANADE      ----------------------------MYAVIRTGGKQYRVAQGDRVKIEKL-AGDVGG
RL21_MYXXD      ----------------------------MYAVIRTGGKQYRVAEGDVVRIEKI-AGDVGA
RL21_CAUVC      ----------------------------MYAVIKTGGKQYRVQAGDLLVVEKL-EGEPGA
RL21_DESVH      ----------------------------MYAIIETGGKQFRVEEGSKIFVEKL-ASEAGS
RL21_ONYPE      ----------------------------MFAIIKTGGKQFRVFEGQEIYVEKL-NVEPET
RL21_LACPL      ----------------------------MYAIIVTGGKQYKVEAGQAIYVEKL-DAAAGD
RL21_LACSS      ----------------------------MYAIIKTGGKQYKVEAGQAIYVEKL-TAEAGE
RL21_LACS1      ----------------------------MYAIIKTGGKQLKVEAGQTIYVEKL-DAKEGD
RL21_ENTFA      ----------------------------MYAIIKTGGKQVKVEVGQAIYVEKL-NVEAGE
RL21_LACLA      --------------------------MSNYAIIKTGGKQLKVEEGSVIYVEKL-NVEAGQ
RL21_STRMU      --------------------------MSTYAIIKTGGKQVKVEVDQAIYVEKL-DVEAGA
RL21_BACC1      ----------------------------MYAIIETGGKQIKVEAGQEIYIEKL-DVEAGE
RL21_GEOKA      ----------------------------MYAIIETGGKQLKVEEGQEIYIEKL-DANEGD
RL21_BACSK      ----------------------------MYAIIETGGKQIKVEEGQEIYVEKL-DAEAGE
RL21_BACHD      ----------------------------MYAIIETGGKQVKVEEGQEIYIEKL-DAEAGE
RL21_LISIN      ----------------------------MYAIIETGGKQIKVEAGQEIYVEKL-AGEVGD
RL21_OCEIH      ----------------------------MYAIIETGGKQIKVVEGQEIYVEKV-TADVNE
RL21_BACSU      ----------------------------MYAIIKTGGKQIKVEEGQTVYIEKL-AAEAGE
RL21_STAEQ      ----------------------------MFAIIETGGKQIKVEEGQEIYVEKL-NANEGD
RL21_LACDA      ----------------------------MYAVIKTGGKQYKVAEGESIFVEKL-DVQAGE
RL21_LACJO      ----------------------------MYAVIKTGGKQYKVAKGDSVFVEKL-EVKPGD
RL21_MYCGE      ----------------------------MHAIVVCGAKQYLVHENESIFVEKL-AGKVGQ
RL21_MYCPN      ----------------------------MHAIVVCGSKQYLVHENDTFFVEKL-EAPVGK
RL21_MYCGA      ----------------------------MFAVIASGSKQYRVKLNDEIYVEKL-NSQVGE
RL21_MYCPE      ----------------------------MFAIFEVGSKQYKVQKGDVIYVEKQ-DKKVGE
RL21_UREPA      ----------------------------MFAIFQTGGKQYKVQQGEKIYVEKL-DLEVGS
RL21_MYCMO      ----------------------------MFAIIETGGKQILVKKDDFIFIEKI-EGEAGQ
RL21_MYCPU      ----------------------------MYAIIEVGGKQLLVKEQEVIFTEKI-EGNAGE
RL21_MYCS5      ----------------------------MFAIIETGGKQILVKEGDSIYVEKL-EGQEKS
RL21_MYCH2      ----------------------------MFAIIKTSGRQLKVEKDQTIFVEKI-DKNEGE
RL21_MYCMS      ----------------------------MFAIIRTGGKQIKVEQGQEIFIEKI-KGEVND
RL21_MESFL      ----------------------------MFAIIKTGGKQIKVEAGMEIFIEKL-EGELNT
RL21_CARHZ      ----------------------------MYAIIQTGGKQYKVAEGDKIFVEKL-NAEPGS
RL21_DESHY      ----------------------------MYAVIETGGKQFRVEEGKVLFVEKL-DANVGD
RL21_CLOPS      ----------------------------MYAVLTTGGKQYRVQEGDVLFVEKL-NAEVDS
RL21_CLOTE      ----------------------------MYAVVVTGGKQYKVTEGDVLFVEKL-DAEVDA
RL21_CLOD6      ----------------------------MYAIVKTGGKQYKVSEGDVLFVEKL-EANAGD
RL21_CLOAB      ----------------------------MYAVIATGGKQYKVQEGDAIYVEKI-AAEVDS
RL21_MOOTA      ----------------------------MYAIIMTGGKQYRVSEGDTLRVEKL-PAEVGE
RL21_SYMTH      ---------------------------MTYAIVETGGKQYRVQEGDTLRVEKL-TAGEGE
RL21_CALS4      ----------------------------MYAIIETGGKQYMVREGDVLKVEKL-NYPEGE
RL21_FUSNN      ----------------------------MYAVIKTGGKQYKVTEGDVLKVEKL-NAEVNT
RL21_SYNWW      ----------------------------MYAIIESGGKQYKVAEGSVIKVEKL-DVAAGE
RL21_FRATO      ----------------------------MYAIIKNGGKQYKVKEGEVVKLEKF-DLGIGE
RL21_CUTAK      ----------------------------MYAIVRSGGRQHKVAVGDVVEIDKV-ADEAGS
RL21_THEFY      ----------------------------MYAIVRAGGRQEKVSVDDVVTIDRV-AKEAGD
RL21_LEIXX      ---------------------------MVYAVVRAGGRQEKVEVGTIVTMDRV-KDGENG
RL21_BIFLO      ----------------------------MYAIVKAGGHQEKVEVGDVILVNRL-DAKKGD
RL21_CORDI      ----------------------------MYAIVKTGGKQYKVAEGDFVKVEKI-EGEPGS
RL21_CORJK      ----------------------------MYAIVKTGGKQYKVAEGDLVKVEKI-EGEPGS
RL21_MYCLE      --------------------------MATYAIVKTGGKQYKVAVGDVVKIEKL-DFEPGA
RL21_RHOJR      --------------------------MATYAIVKTGGKQYKVAVGDLVKVEKI-EGEPGT
RL21_FRACC      ----------------------------MYAVVASGGKQHRVAVGDVVDVELL-SGEPGA
RL21_TROWT      ----------------------------MFAVVKASGFQRLVEVGSVISIDPT-NVDSGG
RL21_KORVE      ----------------------------MYAVIRAGSKQFRVSPGDVIKVDSA-PHSESG
RL21_DEIGD      ----------------------------MFAIIQSGGKQYRVQEGDVVRVETL-KGEAGD
RL21_DEIRA      ----------------------------MFAIIQTGGKQYRVSEGDVIRVESL-QGEAGD
RL21_THET8      ----------------------------MFAIVKTGGKQYRVEPGLKLRVEKL-DAEPGA
RL21_RUBXD      ----------------------------MYAVVKSGGKQYRVRQGDELLVERL-AGEVGD
RL21_AQUAE      ----------------------------MYAVIKTGGKQYKVEKGMKLKVEKL-PYEVGQ
RL21_BACTN      ----------------------------MYAIVEINGQQFKAEAGQKLFVHHIEGAENGS
RL21_PORGI      ----------------------------MYVIVDIQGQQMKVEQGRRLFVHHIKDVESGA
RL21_CYTH3      ----------------------------MYAIVEIGGKQYKVEKDHFIYVYRLEGAE-GS
RL21_CHLCH      ----------------------------MQALITISDKQYLVKQGDKLFVP-RQQAAIGD
RL21_PELLD      ----------------------------MQALIEISDKQYLVKKGDTLFVP-RQQTAIGD
RL21_CHLTE      ----------------------------MQALIEISDKQYLVKAGDKIFVP-KQKAAAGD
RL21_SALRD      ----------------------------MYAVVDVKDKQFKVQEGDTLYVPYHSDATAGQ
RL21_LEPIN      ----------------------------MYAIISVGNRQYKVTQ-DQEFLTEKTGKNAGE
RL21_CHLMU      --------------------------MEPYAVVQTGNKQYQVRKGDVIDVELLDGISEEN
RL21_CHLPN      --------------------------MEPYAVIQTGSKQYQVRSGDVIDVELLGEVASD-
RL21_CHLCV      --------------------------MKSYAIIQTGSKQYQVSEGDVIDVELLDGISEG-
RL21_PARUW      ----------------------------MYAIIKTGGKQYRVQEGDIIDVELLNTDPGA-
RL21_TRIV2      ---------------------------MAYAIIETGGKQVRVEPGRFYDIELLSAEPDEK
RL21_SYNE7      ---------------------------MAYAIIEASGKQLWVEPGRFYDLDRLDADLDQS
RL21_SYNY3      ---------------------------MSYAIIEIGGTQIRVEPGRFYEINHLDAAPEDS
RL21_THEEB      ---------------------------MAYAIIETGGKQLRVEPGRFYDVERLPIEPEGT
RL21_TRIEI      ---------------------------MTYAIIETGGKQLRVEAGRFYDIDLLSGSEGDR
RL21_SYNJB      ---------------------------MTYAIVETGGKQLWVEPGRFYEVDRLAEVEENS
RL21_SYNJA      ---------------------------MTYAIVETSGKQLWVEPGRFYDVDRLPGTEENS
RK21_HUPLU      --------------------------MNAYAVIETGGEQLRVEPGRFYDVRHFASLNPEN
RK21_PHYPA      ----------------------------MYAIIETGGEQLRVEPGRFYDIRHFASLKSKN
RK21_MARPO      --------------------------MSKYAIIETGGQQLRVEPGRFYNIRHFVSLTPNE
RK21_ANTAG      --------------------------MNTYAIIDTGGEQLRVEPGRFYDMRHFTLLNPSI
RK21_PSINU      --------------------------MGTYAIIETGGEQLRVEPGRFYDARCFASLNPRI
RK21_ZYGCR      --------------------------MKTYAIIEAGGEQLQVEPGRFYNIRHLSLRGVNF
RK21_CHAVU      ------------------------MNTNTYAIIQMGGQQLQVQTGRFYDTCDFSILKP--
RK21_CHAGL      --------------------------MSTYAIIDLGGKQLRVEPGRFYDAHLFSSFKSLL
RK21_ADICA      -----------------MEKWKERVRIGGYAIIDIGGKQLRVQPGRFYDVRHFPSNLNTR
RK21_STAPU      --------------------------MNTYAIIEAGGEQLQVQPGRFYDIRLNVPVTEFW
RL21_SYNS9      MADTKPAAKA------------APETSDAYAIVEASGTQIWLQTNRYYDLDRLQADVDET
RL21_SYNPX      MADTKTATPATDAEEATATPPAAAPSSEAYAIVEASGTQMWVQANRYYDVDRLHAEVDET
RL21_PROMM      MAEKPTAKPKA---------AEAKDQSDSYAIVEASGQQFLLQPNRYYDLDRLQAAVDDT
RL21_SYNS3      MAETSSSSSQ------------TTPETGTYAIVEASGQQFWVQPNRYYDLDRLHADVDAK
RL21_PROMT      MADKKSSPKK------------ENPQDKTYAIVEASGKQFWLQPNRYYDFDRCQAEVDDV
RL21_PROMA      MSFDFMTPNKT-----------KNSTVGNYAIVETSGTQFWLEADRYYDIDRINANVDET
RL21_PROM9      MTNSKNSSNN------------STNGNELYAIAETSGQQFWFEVNRYYDIDRLNAKEKDK
RL21_PROMP      MTSSKKPSNS------------SAKNENLYAIAETSGQQFWFEVDKYYDIDRLNAKEKDK
RK21_EMIHU      --------------------------MSSYAIVEACGKQMWIEEGKFYDFDKLPFSKGDV
RK21_CYACA      --------------------------MTNYAIVKASGRQLWFEPGKYYNINYVHANPGDK
RK21_CYAM1      ------------------------MSPTAYAIVETCGKQYWFQPGRYYDINFINAEPGDK
RK21_GUITH      ---------------------------MKYAIIEASGKQFWVEPGRFYDFNSLNVEPGDK
RK21_TRICV      ---------------------------MKYAIVEISGRQFWIETGKYYDFNRIPTELGKE
RK21_PYRYE      ---------------------------MTYAIIEASGTQLWIEEGRYYDLNHIPVDPGQS
RK21_GRATL      ---------------------------MLYAIIEADGKQMWIEPGKYYDVNYIPGEPGDY
RK21_CYAPA      --------------------------MTTYAIIDIAGKQLWVEPKRYYSVNKINVEIGKK
RL21_GLOVI      ---------------------------MVYAIVETGGKQVLVQPGRFYDVELLALDVEAA
                                              .:      *                     

RL21_TREDE      -----KIDIDTVLLISDGDKV-TVGTPYVSGAKVSATVGDSFR-ERKIIVYKHKAKKNY-
RL21_TREPA      -----CIDVREVLMIGGEGLT-RIGSPYLEGVGVRAVVGECFR-SRKITVYKYKSKKDY-
RL21_DEHMC      -----SIELDKVLMLNDGETV-TIGSPTISGAKVTATVAGHIK-GDKVFAYRFKAKTRN-
RL21_PELUB      -----KIEFKEILAYGDDKTI-EVGSPVVEGAKVEADLVENGK-NRTILIFKKRRRQ-NS
RL21_THEMA      -----EIVFDRVVFVRKDGEV-LVGKPYVEGAKVVGKVLEHAK-ARKVKTVKYRPRK-NS
RL21_BORAP      -----KLEFNSVLLINKDGEI-KIGKPYVINSSIKCTYKEDKK-DKKVVSYRYRRRK-SS
RL21_HELHP      -----KVELNEVLAIVDGDKT-DVGTPFVKGAKIEAEVINEGR-GKKVVTFKKRRRK-DS
RL21_WOLSU      -----KVELNEVLALCKDDNL-ILGTPFVEGAKIEIEVINEDR-AKKVVTFKKRRRK-DS
RL21_HELPJ      -----LVELVEVLAVSKEGKL-SCGKPFVNGAKIEAEVINEGR-SKKVITFKKRRRK-DS
RL21_SULDN      -----TFEIKEVLAV-NAGEL-KMGAPFLEGAVVTAEVINEGR-DKKVITFKKRRRK-DS
RL21_CAMJR      -----SIEVSEVLAI-NDKEL-KVGAPFVAGAKVVLEVINHGK-DKKVVIYKKRRRK-DS
RL21_ECOLI      -----TVEFAEVLMIANGEEV-KIGVPFVDGGVIKAEVVAHGR-GEKVKIVKFRRRK-HY
RL21_SODGM      -----TVEFDQVMMIANGDDI-QIGGPFVTGGKITAEVVAHGR-GDKVMIVKFRRRK-YF
RL21_PHOLL      -----TVEFDQVLMVANGDDI-KIGAPVVEGVKIKAEVVAHGR-GEKIKIVKFRRRK-HS
RL21_HAES1      -----TVEFDSVLMIVNGEDI-KIGTPVVTGAKVVAEVVSQGR-GEKVKIVKFRRRK-HS
RL21_PSEA6      -----SVEFGDILMVSNGEDV-KIGTPFVSGGKVTAEVVTHGR-GEKVKIVKFRRRK-HS
RL21_IDILO      -----VVEFDQVLMVSDGNDV-NIGAPFVSGGKVKAEVIDHGR-GDKIKIVKFRRRK-HS
RL21_PHOPR      -----NVEFDCVLLVANGEEV-TVGAPFVTGGKVTAEVVTHGR-GDKIKVVKFRRRK-HS
RL21_PSET1      -----AVEFDSVLLVADGEKI-EIGVPFVNGGKITAEVVSHGR-GEKIKVVKFRRRK-HS
RL21_SHEON      -----TVEFDQVLLIADGEKV-HVGAPLVAGGKVVAEVVSHGR-GEKVTIVKFRRRK-HH
RL21_COLP3      -----TVEFDNVLMIANGDNI-NVGAPYVAGGKVVAEVVTQAR-APKITIVKFKRRK-HS
RL21_SACD2      -----SVDFDQVLLVTKGDDV-KIGAPYVEGAKVTAEVVSHGR-ADKVRIIKFRRRK-HS
RL21_HAHCH      -----VVEFDKVLLVANGDDV-KVGAPVVEGAKVTAEVVAHGR-HKKVNIIKFRRRK-HH
RL21_PSEAE      -----AIDFDRVLLVANGEDV-KIGLPVVEGAKVTAEVVSHGR-HDKVRIIKFRRRK-HH
RL21_CHRSD      -----TLELDQVLLVADDDDV-KVGAPLVEGAKVTAEVVSHGR-GEKVKIIKFRRRK-HQ
RL21_ALCBS      -----SVDFDQVLLVANGDDV-KVGQPMLDGAKVTAEVLEQGR-HKKIKIVKFRRRK-HS
RL21_ALKEH      -----SVEFDQVLMVGEGDDV-KVGAPTVEGGKVTAEVLGQGR-ARKIEIQKFKRRK-QY
RL21_HYDCU      -----KVEFDQVMMVGEGADV-KLGAPLVEGAKVAATVTANGR-GKKVTIIKFRRRKNRS
RL21_LEGPL      -----EIKFSEVLMLVDGDKV-TCGAPFVAKATVKAEVLDHGR-HKKVKIIKFRRRK-HH
RL21_COXBU      -----SVKFDDVLMVAAGDEL-HIGTPSVKDAAVTAEVVDQGR-QAKIEIIKFKRRK-HH
RL21_PSYCK      -----TIKFEDVLMIVDGETV-KIGQPIVEGASVEVEVVEHGR-GEKIRIVKHNRRK-HY
RL21_ACIAD      -----TITFDDVLMVVSGESV-QIGAPVVAGAKVTAEVVGHGR-HDKIRIIKMRRRK-HY
RL21_PARXL      -----EITLDQVLAVGEGESI-KFGTPLVSGASVKATVVSQGR-HAKVTIFKMRRRK-HY
RL21_BORA1      -----EITLDQVLSVGEGDQL-KVGTPLVAGAVVKATVLAHGR-HDKVKIFKMRRRK-HY
RL21_AROAE      -----EITIDQVFMVGEGESV-KIGTPVVSGATVTATVVSHGR-HDKIKIFKMRRRK-HY
RL21_DECAR      -----EVTLDQILMVGEGESV-KIGAPFLAGATVKCTVVSHGR-HDKVKIFKMRRRK-HY
RL21_RHOFT      -----EIVFNEVLAVGNGAEL-KVGTPLVSGATVSVTVLAHGK-HDKVSIFKMRRRK-HY
RL21_POLSJ      -----EIVIDQVLAVGEGSAI-KVGTPLVSGATVTVTVLSHGR-HDKVRIFKMRRRK-HY
RL21_NEIG1      -----QIELTEVLMIADGESV-KVGAPFIEGAKVTAKVVAHGR-GEKVRIFKMRRRK-HY
RL21_CHRVO      -----QIVLEEVLMIADGEQV-VVGAPLVSGATVKATVVSHGR-GEKIRIFKMRRRK-HY
RL21_NITEU      -----DIQLDQVLMIADGEAI-SAGAPLLDQAKVSATVVSHGR-HDKIRIFKMRRRK-HY
RL21_NITMU      -----ELLIDQVLMVADGDNI-SLGKPLVSGASVKATVLEQGR-HDKVRIFKMRRRK-HY
RL21_THIDA      -----EITFDQVLMVGDGADI-KMGAPLLRGATVSATVLNQAR-GDKIKIFKMRRRK-HY
RL21_METFK      -----EITLDKVLLVSDGDNT-TIGSPLVQGASVQAKVVAHGR-GDKVLIFKMRRRK-HY
RL21_XANOM      -----EIKFDTVLMLGDSDGI-KLGDALK-GASVTAKVVAHGR-ADKVRIIKFRRRK-HH
RL21_XYLFT      -----DVTFNSVLLMGGSDGI-HVGEALK-DASVTAKVVAHGR-ARKVRIIKFRRRK-HH
RL21_METCA      -----EVAFEKVLLIQSDDGV-KIGQPFVSGGKVTGTVVAHGR-HPKIRIIKFRRRK-HH
RL21_NITOC      -----TITLDEVLLVANEDNI-QVGAPYIEGGKVSATVKTHGR-GEKIRIIKLRRRK-HH
RL21_BLOFL      -----QIEFNQVLLIRDMKNI-YIGNPFIQNGKIIADILDHSL-GKKIRIVKFRRRK-HF
RL21_BLOPB      -----QVEFNQILLIDSNECL-HIGSPFIKKGRIIAEIIAQSL-NQKIKIIKFRRRK-HF
RL21_WIGBR      -----TIEIKKIMALFNDEKI-IFGQPFIKNSRIIATIKKHIN-GKKISIVKFSRRK-HF
RL21_BUCAI      -----TIEFDKILMLFDKDSI-KIGTPFVEGGTIKAHIQNHGR-LKKIKIIKFNRRK-HY
RL21_BUCAP      -----IIEFDKILMISAKKEV-KIGEPFLKGTKIKAHVENHGR-LKKIKIIKFNRRK-HY
RL21_BUCBP      -----QIKFKKILMCCNGTHI-TIGKPHIHNNFILANIINHGR-HKKIKIIKFNRRK-HY
RL21_BAUCH      -----TIEFHDIMMINDEDNI-YIGDPILHNSKITAKVIAHGR-SKKLHIIKFRRRK-HF
RL21_RHOBA      -----NLKFETVLAVGAEDGL-KLGAPTLDGVSVSASVLGMSQ-DKKIYIQKFRRRK-HS
RL21_GEOSL      -----TVELKDVLMVG-GETVA-IGTPLVPSASVVGRIVDQGK-DKKILVFKSKRRKNF-
RL21_PELCD      -----TIELDEVLMVG-GEEVK-IGTPLLPGAKVTARIVQQGK-DKKVLVFHSKRRKGY-
RL21_BDEBA      -----EFEINEVLMVG-GESTA-VGQPLVKGAKVTVVVTKQAK-TRKEIVFKKKRRQGY-
RL21_SYNAS      -----SVVFDDVLMVAKEGEIR-VGKPVLEGAKVVGEIVAQVK-GPKIYVFHMKKRKGF-
RL21_DESPS      -----SLDLTDVLMLVDGDNVQ-VGQPVLENAKVVAKIAEQGR-GKKIIIFKKKRRKGY-
RL21_ZYMMO      -----TVSLEDVLLAGEGA-----DLQPVKGLTVSAEIIAQAK-AEKVIVFKKRRRHNY-
RL21_SPHAL      -----TVSLGDVLLAGDGG-----EVKDAKGLTVSAEIIAQTR-GEKVIVFKKRRRHNY-
RL21_NOVAD      -----KITLGEVLLAGEGD-----SLADAAKVTVSAEIIAQAK-SEKVIVFKKRRRHNY-
RL21_MAGSA      -----EVVLDQVLMVGDKI-----GVPVVAGASVKATVVAQAR-GEKIIVFKKRRRQNS-
RL21_RICBR      -----KIQLNQVLMMGEYSKPSFIGTPLVKGAVVTAEITNQLR-DNKIIVFKKKRRKNY-
RL21_ANAMM      -----KVKLDSLATFGGKKKD---AVLQRQSSAVTAEVVARCR-NDKIIVFKKRRRKNY-
RL21_ANAPZ      -----KVLLKSLATFN-NDGS---GSFSASSGSVSAEVVAHCR-SDKIIVFKKRRRKNY-
RL21_EHRRW      -----EVTLSKVIALTGVNNE---VIFT-QNASVTASVLEQCR-NDKVIIFKKKRRKNY-
RL21_WOLTR      -----EVEIDKAVC-LSGNGL---SYLT--DATVKAEVLEQCR-GEKIIIFKKKRRKNY-
RL21_NEOSM      -----EVEISCVKCVLDEEAR---PHFG--VGTVKAKVLAQER-GEKLVIFKKRRRKNS-
RL21_RHOPA      -----IIQLGEVLVLGG-DTP-VLGAPTVAGATVAAEVLDHKR-GPKVIAFKKRRRKHS-
RL21_RHOPB      -----IIQLGEVLMLGG-DTP-VLGLPTVAGATVAAEVLQHKR-GPKVISFKKRRRKNS-
RL21_NITWN      -----IVQLGEVLVLGG-DTP-VLGAPTVAGASIAAEVLQHKR-GPKVIAFKKRRRKHS-
RL21_BRADU      -----IVQLNEVLVVGG-DTP-ILGLPTVAGASVAVEVLDHKR-GPKVIAFKKRRRKNS-
RL21_GLUOX      -----TITFTDVLMVGGEGTL-TVGAPLVAGATVTATVVAQDR-LPKVIIFKKRRRQNS-
RL21_GRABC      -----TITFTDVLAVGGEGNL-TIGAPVVAGASVTATVIAQDR-LDKIVVFKKRRRQNS-
RL21_BARQU      -----VVEFNDILMVGQEDNT-IIGAPVVADALVTAEIIKQAR-ARKVISFKKRRRQNS-
RL21_CHESB      -----IVQIGNVLAVGEGENV-TIGAPFVEGASVAAEVVEQGR-GPKVIAFKKRRRQNS-
RL21_RHILO      -----IVEIGHVLAHGEGENV-TFGAPFVDGALVTAEVVEQGK-NRTVIAFKKRRRQNS-
RL21_BRUSU      -----IVEFAEVLMVGS-----TIGAPTVAGALVTAEVVEQGR-GRKVIAFKKRRRQNS-
RL21_AGRFC      -----TVEFTEVLVIGEGADA-QFGAPFVKGAIVKAEVVEHNR-GKKVIAFKKRRRQNS-
RL21_RHIME      -----KIEFTEILMVGVGADA-TIGAPFVEGAVVSAEVVDQGR-AKKVIAFKKRRRQNS-
RL21_HYPNA      -----TVTFDSVLMVGAGAGV-TVGAPMVAGATVTGEVAAEVR-GPKLITRKKRQRQTY-
RL21_RHORT      -----TVEFDSVLALGD-----TVGLPTIAGAKVTGEVLSQFR-GEKVIIFKKHRRQNY-
RL21_MARMM      -----TLDLGDVLMLGSEAGV-TVGSPTIDGAQVIGELLDTNR-ARKIIVFKKRRRQNY-
RL21_RUEPO      -----KVQFNDVLMLGGDAPV--VGAPLVDGAAVQAEVIDQIK-GEKLIHFVKRRRKHSS
RL21_RUEST      -----TVQFNDVLMIGGDAPV--VGAPFVSGAAVQAEVVEQIK-GDKVIKFVKRRRKHSS
RL21_RHOS4      -----KIQFNDILMVGGDSVT--VGAPFVAGAAVQAEVIAQIK-GEKTIHYVKRRRKHSS
RL21_ROSDO      -----TVQFNEVLMLGGENTV--VGAPFVKDAGVQAEVVDQIK-GEKVINFVKRRRKHSS
RL21_JANSC      -----AVQFNEILMLGGDNVT--VGAPLVEGAAVQANVIEQVK-GAKLIHYVKRRRKHSS
RL21_ANADE      -----KVNF-DVLLVGGEGEA-KVGKPTLAGVTVEGEIVAQGK-HKKVIHFRKKK-EGWT
RL21_MYXXD      -----EVTFTEILLVGGSESP-KVGQPTVAGAKVVGKVLAQDK-HRRVLHFRKEK-EGWT
RL21_CAUVC      -----AVAFGEVLMLGEGEAV-TVGAPTVDGAVVSGTLLETRK-GEKVKIFKKIRRQGYR
RL21_DESVH      -----EIVIDKVLMLG-G-GDVKVGAPYVENAKVTAEVVEHGR-GEKVVIFKKWRRNDS-
RL21_ONYPE      -----TYQFQEVLAVG-G-SNPVLGTPFVKDAKVTAQVIKHDR-AKKIIVFKYKKRKKY-
RL21_LACPL      -----KVTFDQVVFVG-G-DTTKVGTPTVDGATVEGTVEKQGR-DRKVVTFKYKAKKGQ-
RL21_LACSS      -----KVTFDQVILVG-G-ETTKVGTPNIDGVTVDGTVEKQGR-EKKVVTFKYKPKKHS-
RL21_LACS1      -----KVTFDKVVFVG-G-DKTVIGTPFVEGATVEATVEKQGR-AKKVVTFKYKPKKHQ-
RL21_ENTFA      -----KVVFDEVILVG-G-ESTKVGAPTVAGATVEGTVEKHGK-QKKVVTFQYKPKKHS-
RL21_LACLA      -----TVTFDEVIFVG-G-ETTKVGAPLVEGATVVGEVEKHGK-QKKVVTFQYKPKKHS-
RL21_STRMU      -----EVTFDQVVLVG-G-DKTVVGTPIVQGATVVGTVEKQGK-QKKVVTYKYKPKKGS-
RL21_BACC1      -----TVTFDKVLFVG-G-ENVKVGSPVVEGATVTAKVEKHGR-AKKIIVFKYKAKKNN-
RL21_GEOKA      -----TVTFDKVLFVG-G-ETVKIGNPTVEGATVTARVQKHGR-QKKIIVFKYKAKKNY-
RL21_BACSK      -----EVSFDKVLFVG-G-ESAKVGAPFVEGASVTGTVEKHGR-NKKIIVYKMKAKKNY-
RL21_BACHD      -----SVNFDKVVLVG-G-DDVKVGSPYVEGASVTAKVEKHGR-GKKIIVFKMKAKKNY-
RL21_LISIN      -----VVTFDKVLFVG-G-DSAKVGVPFVDGATVTAKVEKQGR-AKKLTVYKYKPKKNY-
RL21_OCEIH      -----SVTFDKVLFIG-G-DDVKVGAPLIDGATVTAKVEKHGR-QKKIDVHKFKPKKNY-
RL21_BACSU      -----TVTFEDVLFVG-G-DNVKVGNPTVEGATVTAKVEKQGR-AKKITVFRYKPKKNV-
RL21_STAEQ      -----SFTFDKVLFVG-G-DSVKVGAPTVEGASVTATVNKQGR-GKKITVFTYKRRKDS-
RL21_LACDA      -----EVVFDQVILVANG-DDVKVGTPLVEGAKVVASVDKQGK-EKKVVTFKYKPKKHS-
RL21_LACJO      -----EVTFDEVILVNDG-KSTKIGTPVVEGAKVVAKVEKQGK-EKKVVTFKYKPKKHS-
RL21_MYCGE      -----EIQLDKVLMLD-----EKIGKPYLEKAKVVCVIEKHGL-KSKIKLIKHISQKHH-
RL21_MYCPN      -----EIQLDKVLMLD-----EKIGAPYLEKARVVCVVEKHGL-QRKVNVIKHISQKHH-
RL21_MYCGA      -----KIVFDKVYFVN-----NTFGKPFVKGASVTCEVLKQGR-QKKINVIKHISQKHH-
RL21_MYCPE      -----SISFDKVLMVD-----ATIGKPYIKNATVSCKVEKQGK-QKKIFIIKHKRYTRS-
RL21_UREPA      -----KISFDQVIMVE-----GSVGTPFVKNAVVNATVIKQGK-QKKINIIKFKSKKHH-
RL21_MYCMO      -----NVVFDKVLLVD-----DKIGTPFLKNATVTGIIEKQGK-QKKIVVYRHNAKSTH-
RL21_MYCPU      -----KVEFDKVLLFG-----DKVGRPYLEKVKVIGEIQKQSK-HKKIIVYRHNAKSTH-
RL21_MYCS5      -----EVKFDKVLAVN-----DVFGKPYVTGAVVHGTIEKQGK-AKKIVVYRHNPKSTH-
RL21_MYCH2      -----TITFTDILFIN-----GKIGTPYVENASVTGIIEKQGK-AKKIVVYRHNPKSTH-
RL21_MYCMS      -----KIAFDEILMID-----GKIGTPTIKGAKVLGTIIKQGK-AKKIRVIRYHPKKNV-
RL21_MESFL      -----EVTFEEVLMVD-----GKFGSPLVQGAKVTGTIVKQGK-GKKIRVVRYHPKKNV-
RL21_CARHZ      -----IVTINEVLAVVKD-GSIKAGNPYVEGAKVNLKVVRHGK-GRKIIVFKYKPKKNY-
RL21_DESHY      -----TVTIDKVLLVEKD-GAVKVGTPVVDGAKALLKVVEHGK-GEKIIVFKMKSKKNY-
RL21_CLOPS      -----TVELTEVLAVAKD-GEIKVGAPVVEGAKVVAKVLAQGK-AKKVVVFKYKRKKDY-
RL21_CLOTE      -----AIELDNVLAISKDNGEFVVGKPVVEGAKVTAKVLKQGK-AKKVVVFKYKPKKHY-
RL21_CLOD6      -----VVTLNEVLACSKD-GELKLGSPVVEGASVQAKVVEQGK-AKKVIVFKYKAKKDY-
RL21_CLOAB      -----TIELNEVLAVSKE-DGLVLGKPVVEGAKVVAKVEAQGK-SKKIIVFKYKRKKDY-
RL21_MOOTA      -----KVVLDKVLAVG-EGADLKVGNPYVEGAKVTASVQAQDK-APKIIVFKYKPKKNY-
RL21_SYMTH      -----TVVFDKVLAIS-RDGKVTVGTPYIEGAKVTAKVAAHGK-GPKIIVFKYRNKTNY-
RL21_CALS4      -----VIALDKVLAVSFEDGNVEFGKPYLENVKVTAKVLEHGK-GPKIRVFKYKPKKNY-
RL21_FUSNN      -----TVELTEVLLVAGGDNAVKVGKPLVEGAKVVVEVLSQGK-GPKVINFKYKPKKAS-
RL21_SYNWW      -----KLTLDQVLFFNDGNGNVKIGNPLVAGVRVIAEVMEQGK-HKKITVFKYKRRKNY-
RL21_FRATO      -----KVEFDTVLMGQTAAGEVKIGAPTVAGAKVVGEVVEQGR-HKKVKIMKFRRRKHS-
RL21_CUTAK      -----SIELTPLLVVDGESVT--SDKDVLGKVKVTAEVLGETK-GPKIRILKYKNKTGY-
RL21_THEFY      -----TLNLEPLLVVDNGKVV--SDAAELNKYQVTAEVLGEVT-GPKIKILKYKSKTGY-
RL21_LEIXX      -----TIELAAVLLVDGDKIT--SDAKSLSKVTVTATVLEDLR-GPKIVIQKFKNKTGY-
RL21_BIFLO      -----TVEFPVSLVVDGDKVT--LAAADLAKVSVKAEVVNDEAKGPKISIQKYKNKTGV-
RL21_CORDI      -----SVALTPILLVDGADVT--TKAADLAKVSVTAEIVEAVK-GPKIKILKYKNKTGY-
RL21_CORJK      -----SVALTPVLVVDGANVT--T-GDKLASVNVNAEIVEHVR-GPKIRGMHYRNKTGY-
RL21_MYCLE      -----KVSLPVTLVVDGATVT--TNAKALAKVAVTGKVLEHTK-GPKIRIHKFKNKTGY-
RL21_RHOJR      -----AVSLAPVLVVDGSDLT--TDADKLAKISVTGEVVEHTK-GPKIRIHKFKNKTGY-
RL21_FRACC      -----AVNLPALLLVDGESVT--HDADALASVAVTAEVVGVVK-GPKIRIHKFKNKTGY-
RL21_TROWT      -----FVHFPVLLLVDGAEVV--SDPDKLRLARVSAKFLRKLR-GPKVRIHKFKNKTGY-
RL21_KORVE      -----KLEIADVLAVSNG--Q--GKFGSPENATVTAEILGDGR-GDKILVFHYKRKKQY-
RL21_DEIGD      -----KLELKPIL-VGGNDTL--LGDEAAR-FTVNAEIVEHGL-GKKIYIRKYKSGIQY-
RL21_DEIRA      -----KVELKALF-VGGEQTV--FGEDAGK-YTVQAEVVEHGR-GKKIYIRKYKSGVQY-
RL21_THET8      -----TVELPVLL-LGGEKTV--VGTPVVEGASVVAEVLGHGR-GKKILVSKFKAKVQY-
RL21_RUBXD      -----RVELPVSL-RAEE------GVLDLEPRTARAEILEHLR-GEKLKVYKYKPKKGY-
RL21_AQUAE      -----TVEFEALM-LRKDD-----GSIEFNKGKVIAEVKAHGR-GKKLIVFKYRPKKNY-
RL21_BACTN      -----TVEFEKVLLVDKDGNVTVGAPTVEGAKVVCQVISNLVK-GDKVLVFHKKRRKGY-
RL21_PORGI      -----SVEFDKVLLVDNNGAITVGSPLVEGAKVVCEVLTPLVK-GDKVLIFHKKRRKGY-
RL21_CYTH3      -----AVTFDNVLLLADNNQYQVGAPSVAGASVSGKILEHL-K-DDKVTAFKKKRRKGF-
RL21_CHLCH      -----KLTIASLAQIDGAN------TTLQNSNSVQAVVLEHVK-DEKVIVFKKKRRKRY-
RL21_PELLD      -----TMEISSMATIDGAN------TVLNPAVSVKAKVLGHVK-DDKVVVFKKKRRKRY-
RL21_CHLTE      -----VIEVKTLMQVNQAD------SALK-AGTATIKVLEHVR-DETIIVFRKKRRKRF-
RL21_SALRD      -----ELTLDRVLLVSDGDGDVTLGTPTVEDATATARVLEHVK-GDKVIVFKKKRRKRY-
RL21_LEPIN      -----SFDAKVLLFAESNNKVHIG-QPELKTARVSLKVLEDVK-GDKIHGYVYKRRKNY-
RL21_CHLMU      -----KEVLFQEVLFVFDGEKASVGSPTVGNAVVKGELISFVR-GEKVVAYKYKKRKNY-
RL21_CHLPN      -----KEVIFQDVLFVFDGTKASLGSPTIANAQVKAEYLSHVK-GEKVVAYKYKKRKNY-
RL21_CHLCV      -----QEIVFDQVLFTFDGSKVSLGTPIVKDAVVKGQLLSQVR-GEKVTAYKYKRRKNY-
RL21_PARUW      ------QVEFGEVLFAFDGAKTQIGKPGIPNFLVYGEVVGTVK-GEKVTSLKYKPSHNQ-
RL21_TRIV2      ------VTIESVLLVQNDGE-VTIGQPLVAGA-TVQGTVLRHLRGRKVLVYKMKPKKKT-
RL21_SYNE7      ------LTLDKVLLVQDEGA-PQIGQPYVAGA-TVQVTVLSHPRGRKVTVYKMKPKKKT-
RL21_SYNY3      ------YVVDKVLLVKDGDN-VTIGQPYVAGA-TVEGEILSHRRGRKVIVYKMQPKKKT-
RL21_THEEB      ------IDLEQVLLVQTDSQ-VHVGQPYVSGA-VVSGTVMEHRRGPKVIVYKMRPKKKT-
RL21_TRIEI      ------ISINNVLLVQNDGD-VHIGQPLVEGA-LIEGTIMKHLRGKKIIVYKMRPKKKT-
RL21_SYNJB      P-----FDLSRVLLINHEGQ-ITLGHPYVSEA-VVRARVLQHRRGDKIIVYKMRPKKKT-
RL21_SYNJA      P-----LALSQVLLINHEGQ-VTLGHPYVPEA-VVRARVLQHRRGNKIIVYKMRPKKGT-
RK21_HUPLU      LGPNSKILIYRVLMICDEST-INIGHPWLKGA-MIKGRILHSRLDNKITVYRMRSKKKT-
RK21_PHYPA      LSSNTKILIYRVLMIRNETT-INIGQPWLKNA-VIKGRILHSHLENKITVYKMNSKKKT-
RK21_MARPO      LEQNTKILIYRVLMIRQEST-IKMGHPWLKGA-IVKGRILHSCLEKKITIYKMISKKKT-
RK21_ANTAG      LDSNTKVLIYRVLMIHHESN-IALGDSWLEDA-TIKGRVLHSHFKDKITIYKMRSKKKM-
RK21_PSINU      LSANAKILIHRVLMIRREST-TNLGHPWLRNA-IVRGRILHSCYGEKITIYKMHSKKKV-
RK21_ZYGCR      WGQNTKLLLYRVLMIRHQSA-TVLGNPWVQNA-TVKGRILDARRDDKLVIYKMRAKKKT-
RK21_CHAVU      ---DTKIIIYKVTMIHLNSQ-LVIGKPWLHNA-MIKGRILHSYRDNKVTIYRMHSKKKM-
RK21_CHAGL      SESNTKIIIFRVLMISHGTE-VQFGYPWLKNA-SVKARILHKKQNDKMLIYKMRSKKKT-
RK21_ADICA      -GSDTKVSMGRVLLIRDGSK-IDIGSPWLANA-VVKGRILHNCFEDKLVIKKIFSKRKT-
RK21_STAPU      --ENRKIVFSRVLMIRSESN-TFLGKPWLEHA-TVNGRIFHPRRGNKLIIYKMRPKKHT-
RL21_SYNS9      ------LKLDNVLLVKDSKG-TTLGQPYVKDA-SVELKVMAHRRGPKVIVYKMRPKKKT-
RL21_SYNPX      ------IKLENVLMVKDSKG-TTLGQPFVKDA-TVALKVMAHRRGPKVIVYKMRPKKKT-
RL21_PROMM      ------VTLEKVLLIKDGKNDATVGQPYVKGA-SVELKVMDHRRGPKIIVYKMRPKKKT-
RL21_SYNS3      ------ITLDKVLLVKNGDA-ATIGKPYVQGA-SVELKVMAHRRGQKVIVYKMRPKKKT-
RL21_PROMT      ------LTLENVLLLNDGKD-LKLGKPYVKDA-KVEIKVLEHRRGPKIIVYKMRPKKKT-
RL21_PROMA      ------VTLDKVLLINDQKG-FAIGKPYIKGA-SVQLKVMAHKRGPKIIVYKMRPKKKT-
RL21_PROM9      ------ITLEKILLLKDKNS-ITIGKPYVKDA-KIELEVVSHKRDKKILVYKMRPKKKT-
RL21_PROMP      ------ITIDKILLIKDKDN-ISLGQPYVKNA-KIELEVVSHKRDKKIIVYKMRPKKKT-
RK21_EMIHU      ------FSLSDILLVKMDDS-AEIGQPYLTDKYSVELRVLQHFSGPKIRVYKMRSKKKT-
RK21_CYACA      ------IIFYKVLLLKNTNS-LLIGKPFVEKV-EVHATILQHLKDKKITVFKMQAKKGT-
RK21_CYAM1      ------IIFHRVLWLQH-QQ-LLIGRPFLPNT-HVEATILQHLKSKKVLVYHMRSKKKT-
RK21_GUITH      ------IALTRVLLINDNGN-ITVGKPCLDNV-KVEATVLGHLRGQKVTVYKMQPKKKT-
RK21_TRICV      ------ITLNRVLLLNNEGE-ILIGKPYLESV-TVKGKILEHLRGRKTLVYKMRPKKKT-
RK21_PYRYE      ------IILGKVLLLNKNGE-VTLGRPCIEGV-TIKATVMRHLRGKKITVFKMKPKKKM-
RK21_GRATL      ------IQFNKVLVLRQEND-IYVGKPCIQSI-IIKAKILKHLKSKKITVFKIKPKKNS-
RK21_CYAPA      ------IALQRILLLSKIGEKIKIGQPFLNGI-SINAIILRHFLAPKVIVYKMQPKKKT-
RL21_GLOVI      ------LTFDKVLLVRHEGG-AVVGRPTVEGA-AVQGRILQHGKAAKVTVYKMRPKKGY-
                                                                            

RL21_TREDE      HRTQGHRQAHTCITVDNIVG----------------------------------------
RL21_TREPA      HRTIGHRQWYTRLTVSDILGV---------------------------------------
RL21_DEHMC      HKKMGHRQLYTVLTIGEILTGGAAEKPARKPRAKKTNEVTTDGA----------------
RL21_PELUB      RRKNGHRQQYSLIRISKIFSKDGKVLSEAEKMVKPTKKVEKVETEVASK-----------
RL21_THEMA      KVEKGHRQWYTAIKIEKIEL----------------------------------------
RL21_BORAP      ERKVGHRQTYSYILVDEIVF----------------------------------------
RL21_HELHP      KTKRGFRRDFTRVRILKIVAK---------------------------------------
RL21_WOLSU      KTKRGFRRDFTRVRILKIAA----------------------------------------
RL21_HELPJ      KTKRGFRRDFTRVRITKIVA----------------------------------------
RL21_SULDN      KVKRGFRRDYTRVRITKIAA----------------------------------------
RL21_CAMJR      KLKRGFRRQFTRVVVKDIKA----------------------------------------
RL21_ECOLI      RKQQGHRQWFTDVKITGISA----------------------------------------
RL21_SODGM      RKHQGHRQWFTDVKITGIGA----------------------------------------
RL21_PHOLL      RKQQGHRQWFTDVKITGIA-----------------------------------------
RL21_HAES1      RKQQGHRQWFTEVKITGIQA----------------------------------------
RL21_PSEA6      RTQMGHRQWFTEVKITGISA----------------------------------------
RL21_IDILO      RRQQGHRQWFTEVKITGINS----------------------------------------
RL21_PHOPR      RKQMGHRQWFTEVKITGISA----------------------------------------
RL21_PSET1      RKQMGHRQWFTEVKITGISA----------------------------------------
RL21_SHEON      DKKLGHRQWFTEVKITAINA----------------------------------------
RL21_COLP3      RKQAGHRQWFTEVKITGING----------------------------------------
RL21_SACD2      MTRQGHRQWYTEVKITGIAG----------------------------------------
RL21_HAHCH      MKRMGHRQWFTEVKITGITG----------------------------------------
RL21_PSEAE      MKRQGHRQWFTEIKITGIQA----------------------------------------
RL21_CHRSD      MRRQGHRQWFTEVKITGISA----------------------------------------
RL21_ALCBS      RKQQGHRQWYTAVKITGIQG----------------------------------------
RL21_ALKEH      RRFAGHRQQFTEVKITGISAG---------------------------------------
RL21_HYDCU      RTKQGHRQNYTEVEITGISA----------------------------------------
RL21_LEGPL      MKQMGHRQYYSQVKIT--AIGK--------------------------------------
RL21_COXBU      MKRQGHRQDFTAVKITEIALGKAKKEVKTDGA----------------------------
RL21_PSYCK      HKEQGHRQWYTLLKIKAINA----------------------------------------
RL21_ACIAD      RKQQGHRQWFTELKITGISG----------------------------------------
RL21_PARXL      QKHGGHRQNYTELRIDAINA----------------------------------------
RL21_BORA1      QKRQGHRQNYTEIRIEAITA----------------------------------------
RL21_AROAE      QKHQGHRQNYTELRIEAISA----------------------------------------
RL21_DECAR      QKRQGHRQNYTELRIDTIAA----------------------------------------
RL21_RHOFT      QKRQGHRQQFTELLVNTIAG----------------------------------------
RL21_POLSJ      QKRQGHRQNFTELQIGAIVG----------------------------------------
RL21_NEIG1      QKRQGHRQNFTQIEIVAIA-----------------------------------------
RL21_CHRVO      QKHQGHRQNYTEIRIDAISK----------------------------------------
RL21_NITEU      RKQQGHRQNYTEIQITGISA----------------------------------------
RL21_NITMU      RKQQGHRQNYTEIQITGISV----------------------------------------
RL21_THIDA      RKSQGHRQYFTEVQIGGITA----------------------------------------
RL21_METFK      RKTQGHRQSFTEIQIEKIAAK---------------------------------------
RL21_XANOM      MKRQGHRQHYTEIEITGIAGGDKK------------------------------------
RL21_XYLFT      MKHQGHRQYYTEIQITGISGPAKQ------------------------------------
RL21_METCA      MKQAGHRQNYTEVQINEISA----------------------------------------
RL21_NITOC      RKRMGHRQYFTELHIDNISTG---------------------------------------
RL21_BLOFL      RKFQGHRQCMTKIKVVKINSNNSDIECYKSVDIETKIGEEVHGA----------------
RL21_BLOPB      RKFQGHRQCFTTIKIVSIKHKH--------------------------------------
RL21_WIGBR      KKITGYRQKLTNIKIIDICC----------------------------------------
RL21_BUCAI      KKQQGHRQYFTDVKIIDINSIKGEV-----------------------------------
RL21_BUCAP      KKKQGHRQYFTNVKILDINNFNGK------------------------------------
RL21_BUCBP      KKQQGHRQNFTDVLITNIHNNYREQNNGS-------------------------------
RL21_BAUCH      RKHQSHRQWFTDLEIINVSY----------------------------------------
RL21_RHOBA      KKRTGHRQKNTRIRIEEIAGV---------------------------------------
RL21_GEOSL      RKMYGHRQPRTVLKIEKINA----------------------------------------
RL21_PELCD      RKTYGHRQPITRLQITGIEA----------------------------------------
RL21_BDEBA      RKFATHKQEFTELFVKAISFDGKTAKSDEAATVVDVKAVRAEKAQARVAARKERAANKGP
RL21_SYNAS      HKKTGHRQQLTRMRIKEISI----------------------------------------
RL21_DESPS      RLKQGHRQSYTALKIEEISA----------------------------------------
RL21_ZYMMO      RRRNGHRQQHTILKIVSVGNAAA-------------------------------------
RL21_SPHAL      RRRNGHRQSLTLLRILAVGEARKAAPKKEAAPKEEA-----------------------A
RL21_NOVAD      RRRNGHRQQMTLLRIVSVA-----------------------------------------
RL21_MAGSA      RRKNGHRQDLTILRITDISAG---------------------------------------
RL21_RICBR      RRKAGHRQELTELKILDITKQ---------------------------------------
RL21_ANAMM      RRKIGHRQELVVLRVLKVG-----------------------------------------
RL21_ANAPZ      RRKNGHRQNMTVLRVVEVR-----------------------------------------
RL21_EHRRW      RRKNGHRQYMTVLRITKINNME--------------------------------------
RL21_WOLTR      RRKTGHRQYITVLRINEINLQK--------------------------------------
RL21_NEOSM      RRRNGHRQYVTILRVTDVTL----------------------------------------
RL21_RHOPA      KRKRGYRDEITVLRITEILADGKKPSVGPRAKRTK-------------------------
RL21_RHOPB      KRKRGYRDEITVLRITEILADGKAPSIGPRPPREKK------------------------
RL21_NITWN      KRKRGYRDEITVLRVTEILADGKSPTIGPRPKKEKA-----------------------V
RL21_BRADU      RRKRGYRDEITVLRVSEILTDNAKPTKGPRPKKEK-------------------------
RL21_GLUOX      RRKNGHRQPVTVLRINAINAA---------------------------------------
RL21_GRABC      RRKNGHRQHVTVLRVGDIVAA---------------------------------------
RL21_BARQU      KCTRGHRQEVTILRILEILTGGLK-PKRAVAKPIKE-----------------------E
RL21_CHESB      RRKRGHRQLLTTVRIAEILLDGAKPSKKVAAKPATS-----------------------E
RL21_RHILO      RRKIGHRQLLTTVRISEILLGGAKPAKKAAVKAEAK-----------------------A
RL21_BRUSU      KRTRGHRQELTTIRISEILTDGAKPSKKAAEKKAPK-----------------------A
RL21_AGRFC      KRSRGHRQHHTVVRITDIVAA---------------------------------------
RL21_RHIME      KRSRGHRQHQTIVRILDIAAAGGK-AKKASKKTEAA-----------------------A
RL21_HYPNA      RRTIGHRQDLMEVTITSINTDGK-------------------------------------
RL21_RHORT      RRKNGHRQFLTRVRITGFAGV---------------------------------------
RL21_MARMM      RRTKGHRQWGTVVRIAEIVAPGEKAKTALKS-TTAE-----------------------P
RL21_RUEPO      QRTKGHRQKLTLVRITEILTSGADKTGVKAATGQA------------------------A
RL21_RUEST      KRTVGHRQKLTLVKITEILASGADASGVKAATGKG------------------------E
RL21_RHOS4      QRTKGHRQQLTLLRVTDVLASGADASGVAVATGTA------------------------D
RL21_ROSDO      KRTKGHRQKLTLVKVTDILASGADKSGVKAAMGAG------------------------S
RL21_JANSC      QRKKGHRQKLTLIEITDILASGGDKSGMKTAIGAGMVAVAAGAVATAAVVATKAAKKAKD
RL21_ANADE      KKR-GHRQPYTEVLITTVRA----------------------------------------
RL21_MYXXD      RRR-GHRQPYTEVKVTSIAG----------------------------------------
RL21_CAUVC      RTR-GHRQFESVVRVTSVAGAGKEAKWEGTIDLTPKVILDARARGLGDAAVPATIPAPVE
RL21_DESVH      RKKQGHRQDFTALKIKAITA----------------------------------------
RL21_ONYPE      RCKQGHRQSYTKLLITKITV----------------------------------------
RL21_LACPL      HTKKGHRQPYTKVTIDTINA----------------------------------------
RL21_LACSS      HQKKGHRQPYTKVMIDAINA----------------------------------------
RL21_LACS1      HTKQGHRQPYTKVVIDAINA----------------------------------------
RL21_ENTFA      HRKQGHRQPYTKVMIEAINA----------------------------------------
RL21_LACLA      HRKQGHRQPYTKVVIKSVNA----------------------------------------
RL21_STRMU      HRKQGHRQPYTKVVIKAINA----------------------------------------
RL21_BACC1      RKKQGHRQPYTKLVVEAINA----------------------------------------
RL21_GEOKA      RRKQGHRQPYTKVVIEKINA----------------------------------------
RL21_BACSK      RRKQGHRQPYTKVVIGKING----------------------------------------
RL21_BACHD      RRKQGHRQPYTKVVIEKINA----------------------------------------
RL21_LISIN      HKKQGHRQPYTKLTIDAINA----------------------------------------
RL21_OCEIH      HRKQGHRQPYTKLVIDKINA----------------------------------------
RL21_BACSU      HKKQGHRQPYTKVTIEKINA----------------------------------------
RL21_STAEQ      KRKKGHRQPYTKLTIDKINA----------------------------------------
RL21_LACDA      HSKYGHRQPYTKVTVKSIEA----------------------------------------
RL21_LACJO      HTKYGHRQPYTKVTIESIEA----------------------------------------
RL21_MYCGE      LKRYGHRQPYTKLKVVRFIHD---------------------------------------
RL21_MYCPN      LKKYGHRQPYTKLKVVRFVHD---------------------------------------
RL21_MYCGA      LKKYGHRQPYTKLKVVAINHG---------------------------------------
RL21_MYCPE      LKRQGHRQPYTKLVVTGINVK---------------------------------------
RL21_UREPA      LKRQGHRQPYTQLVIDSISVK---------------------------------------
RL21_MYCMO      KRKLGHRQPYTRVKILEIKG----------------------------------------
RL21_MYCPU      KRKLGHRQPYTRVKILEIKG----------------------------------------
RL21_MYCS5      KRKLGHRQPYTLVKITKIKGK---------------------------------------
RL21_MYCH2      KRKLGHRQLFTKVKITELKG----------------------------------------
RL21_MYCMS      NKIYGHRQPYTKVKIDEISAK---------------------------------------
RL21_MESFL      NKVYGHRQPYTKVKIEKIEA----------------------------------------
RL21_CARHZ      RRKYGHRQPFTEVIVEKIEA----------------------------------------
RL21_DESHY      RRKQGHRQPYTKVVVEAIQA----------------------------------------
RL21_CLOPS      RRKNGHRQPYTKIVIEKIEA----------------------------------------
RL21_CLOTE      RKKQGHRQPYTKIQIEKINA----------------------------------------
RL21_CLOD6      RRKQGHRQSYTKIVVEKINA----------------------------------------
RL21_CLOAB      RRKRGHRQAYTKLVIEKIQA----------------------------------------
RL21_MOOTA      RRKQGHRQPYTQLQIEKIEIQ---------------------------------------
RL21_SYMTH      RRKTGHRQPFTAITIESIEG----------------------------------------
RL21_CALS4      RRRQGHRQPYTKIQIEKIEK----------------------------------------
RL21_FUSNN      HRKRGHRQLFTEVKVTSIIA----------------------------------------
RL21_SYNWW      RKKQGHRQPYTKIKVEKIEA----------------------------------------
RL21_FRATO      MKQQGHRQYFTAVKVSSISL----------------------------------------
RL21_CUTAK      KKRQGHRQKYTQVKVTGIEG----------------------------------------
RL21_THEFY      KRRLGHRQKYTQIRVTGIAAK---------------------------------------
RL21_LEIXX      KKRQGHRQELTRVKIIGIK-----------------------------------------
RL21_BIFLO      ARRKGHRQKLTIVKITAIA-----------------------------------------
RL21_CORDI      KKRQGHRQQLTVLKITGIK-----------------------------------------
RL21_CORJK      KRRFGHRQSLTVLKVTGIK-----------------------------------------
RL21_MYCLE      HKRQGHRQQLTVLKVTGIK-----------------------------------------
RL21_RHOJR      HKRQGHRQKLTVLKVTGIK-----------------------------------------
RL21_FRACC      HKRQGHRQKLTRLKVTGIETGKA-------------------------------------
RL21_TROWT      HKRQGHRQGVYVFSVTSIERGD--------------------------------------
RL21_KORVE      KKLQGHRQGFTALKITEINVDGEKFTIDDMPKKEAAPAKARRSTKKAAAAE---------
RL21_DEIGD      RRRNGHRQPYTAIRITSIA-----------------------------------------
RL21_DEIRA      RRRTGHRQNFTAIKILGIQG----------------------------------------
RL21_THET8      RRKKGHRQPYTELLIKEIRG----------------------------------------
RL21_RUBXD      RRKKGHRQALTRIRVVEV------------------------------------------
RL21_AQUAE      KRWKGHRQPYTEIEIKDILP----------------------------------------
RL21_BACTN      RKLNGHRQQFTELTITEVVA----------------------------------------
RL21_PORGI      RKLNGHRQQFTEILVKEVVA----------------------------------------
RL21_CYTH3      RKTVGFRQSLTKVLITSLN-----------------------------------------
RL21_CHLCH      QSRNGHRQQMTHIEVLSL------------------------------------------
RL21_PELLD      QSRNGHRQQMTQIEVVSL------------------------------------------
RL21_CHLTE      QKRNGHRQHMTQVEVLSL------------------------------------------
RL21_SALRD      RVKRGHRQQYTQIEIESLNANGPASSDDEEAAETSDAEPDEDPEAEPAEA----------
RL21_LEPIN      QKAWGHRQQLQKVKVVSLSAV---------------------------------------
RL21_CHLMU      HKKIGHRQNYLRVKICDLVM----------------------------------------
RL21_CHLPN      HRKHGHRQKYLRVKIREILI----------------------------------------
RL21_CHLCV      HRKTGHRQNYLRVKISNLVI----------------------------------------
RL21_PARUW      CRKWGHRQHYTRVKITGIGSKRKGKEGNHGS-----------------------------
RL21_TRIV2      RKKRGHRQEITRLLIDSITFNGTVLTAPTASAETADATPDTETAAE--------------
RL21_SYNE7      RKKQGHRQDLTRVLVESITVGGKVLTANAADLPKSEADIDAAG-----------------
RL21_SYNY3      RKKRGHRQELTRLLVKSISVNG---TAIAEALEVDAKTPVVAG-----------------
RL21_THEEB      RRKKGHRQELTRIMINEIRLNGESLGG---------------------------------
RL21_TRIEI      RKKRGHRQELTRLMIDSISLNGKVLASLEKSLVEKPESSVMEVTSETTETVT--------
RL21_SYNJB      RKKRGHRQPLTRLLIESIELNGVPLATAPSRTEAAPESNPEAAPSAAATGIPADEE----
RL21_SYNJA      RKKRGHRQPLTRVLIESIELNGTTLATAQS----APPSTSEA--TTDTTGIPAAEE----
RK21_HUPLU      RRKLGHRQKLIRFVVDSICSDVKDLYKQKD------------------------------
RK21_PHYPA      RRKFGHRQNSARFVVDSICLDGKDL-----------------------------------
RK21_MARPO      RRKLGHRQKSTRFIVDSIFLNGKEI-----------------------------------
RK21_ANTAG      RRKLGYRLNLARFVVDSICFDGKEFYK---------------------------------
RK21_PSINU      RRKLGYRQKLVRFVVDSISSNGEEFFD---------------------------------
RK21_ZYGCR      RRKRGHRQGLTRFVVDAICLNGKVLLD---------------------------------
RK21_CHAVU      RRKQGHRQNITRFIVDGIFLDGKNI-----------------------------------
RK21_CHAGL      RKKFGHRQKIARFIVDAIQYNGQTFTTNLK------------------------------
RK21_ADICA      RGSRGCRGSIIRFAIDSIHFNCSNATNK--------------------------------
RK21_STAPU      SKKNGHRQTFMRLIIDSIFFNNQNL-----------------------------------
RL21_SYNS9      RRKNGHRQELTRVMVQSISVGGKAIG----------------------------------
RL21_SYNPX      RRKNGHRQELTRVMVESITVGGKAIS----------------------------------
RL21_PROMM      RRKNGHRQELTRVMVQSISIDGKALS----------------------------------
RL21_SYNS3      RRKNGHRQELTRVMVESISVGGKAIS----------------------------------
RL21_PROMT      RRKNGHRQELTRVLVQSISIGSNTKKSKAVKTTASKVESE--------------------
RL21_PROMA      RTKNGHRQELTRVMVTSISNGEKPKKATTSAKPNTKKPSTAVKSSKVEKTPE--------
RL21_PROM9      RRKMGHRQELTRVMVKSISLGKSAPKSSAKKETVKKETKPKSEKSTN-------------
RL21_PROMP      RRKMGHRQELTRVMVKSISITNSTPKTSSKTEVKKKSTSPKASNPEN-------------
RK21_EMIHU      RKTFGHRSKLTRVLVQSISKKGVAQTTCFM------------------------------
RK21_CYACA      KKKKGYKTVLTKIKINCIHNHKK-------------------------------------
RK21_CYAM1      RKKYGARQLLTRIYIHPFHGS---------------------------------------
RK21_GUITH      RKKQGHRTNLTRLLIDNIIN----------------------------------------
RK21_TRICV      RKKQGHRQELTRVLIEEIKTN---------------------------------------
RK21_PYRYE      RLKKGHRQELTRLMIDSITS----------------------------------------
RK21_GRATL      RKKQGHRQKLTRLLIEEFYNQI--------------------------------------
RK21_CYAPA      RRKRGHRQHLTSFLINDF------------------------------------------
RL21_GLOVI      RRKKGHRQRFTRVMIESIDFEGRSFTAEAKAEAVSST-----------------------
                      :     . :                                             

RL21_TREDE      ------------------------------------------------------------
RL21_TREPA      ------------------------------------------------------------
RL21_DEHMC      ------------------------------------------------------------
RL21_PELUB      ------------------------------------------------------------
RL21_THEMA      ------------------------------------------------------------
RL21_BORAP      ------------------------------------------------------------
RL21_HELHP      ------------------------------------------------------------
RL21_WOLSU      ------------------------------------------------------------
RL21_HELPJ      ------------------------------------------------------------
RL21_SULDN      ------------------------------------------------------------
RL21_CAMJR      ------------------------------------------------------------
RL21_ECOLI      ------------------------------------------------------------
RL21_SODGM      ------------------------------------------------------------
RL21_PHOLL      ------------------------------------------------------------
RL21_HAES1      ------------------------------------------------------------
RL21_PSEA6      ------------------------------------------------------------
RL21_IDILO      ------------------------------------------------------------
RL21_PHOPR      ------------------------------------------------------------
RL21_PSET1      ------------------------------------------------------------
RL21_SHEON      ------------------------------------------------------------
RL21_COLP3      ------------------------------------------------------------
RL21_SACD2      ------------------------------------------------------------
RL21_HAHCH      ------------------------------------------------------------
RL21_PSEAE      ------------------------------------------------------------
RL21_CHRSD      ------------------------------------------------------------
RL21_ALCBS      ------------------------------------------------------------
RL21_ALKEH      ------------------------------------------------------------
RL21_HYDCU      ------------------------------------------------------------
RL21_LEGPL      ------------------------------------------------------------
RL21_COXBU      ------------------------------------------------------------
RL21_PSYCK      ------------------------------------------------------------
RL21_ACIAD      ------------------------------------------------------------
RL21_PARXL      ------------------------------------------------------------
RL21_BORA1      ------------------------------------------------------------
RL21_AROAE      ------------------------------------------------------------
RL21_DECAR      ------------------------------------------------------------
RL21_RHOFT      ------------------------------------------------------------
RL21_POLSJ      ------------------------------------------------------------
RL21_NEIG1      ------------------------------------------------------------
RL21_CHRVO      ------------------------------------------------------------
RL21_NITEU      ------------------------------------------------------------
RL21_NITMU      ------------------------------------------------------------
RL21_THIDA      ------------------------------------------------------------
RL21_METFK      ------------------------------------------------------------
RL21_XANOM      ------------------------------------------------------------
RL21_XYLFT      ------------------------------------------------------------
RL21_METCA      ------------------------------------------------------------
RL21_NITOC      ------------------------------------------------------------
RL21_BLOFL      ------------------------------------------------------------
RL21_BLOPB      ------------------------------------------------------------
RL21_WIGBR      ------------------------------------------------------------
RL21_BUCAI      ------------------------------------------------------------
RL21_BUCAP      ------------------------------------------------------------
RL21_BUCBP      ------------------------------------------------------------
RL21_BAUCH      ------------------------------------------------------------
RL21_RHOBA      ------------------------------------------------------------
RL21_GEOSL      ------------------------------------------------------------
RL21_PELCD      ------------------------------------------------------------
RL21_BDEBA      AEVVKKAAKKVAKKKVAKKAVKKTVKKATKTGAKKKAAKKTSKKA---------------
RL21_SYNAS      ------------------------------------------------------------
RL21_DESPS      ------------------------------------------------------------
RL21_ZYMMO      ------------------------------------------------------------
RL21_SPHAL      PKAEAKAAAPAKEAAPKKEAAPKKAAAPKAEA---------AEKKPAARKAAPKKDA---
RL21_NOVAD      ------------------------------------------------------------
RL21_MAGSA      ------------------------------------------------------------
RL21_RICBR      ------------------------------------------------------------
RL21_ANAMM      ------------------------------------------------------------
RL21_ANAPZ      ------------------------------------------------------------
RL21_EHRRW      ------------------------------------------------------------
RL21_WOLTR      ------------------------------------------------------------
RL21_NEOSM      ------------------------------------------------------------
RL21_RHOPA      --------------------AAPAAEAAE-------------------------------
RL21_RHOPB      ---------------PVVETSAEADDAAA-------------------------------
RL21_NITWN      EPVE--GASDDKPRRAAKKTAAKTAEDAD-------------------------------
RL21_BRADU      -----------------VAKEATKEDAAA-------------------------------
RL21_GLUOX      ------------------------------------------------------------
RL21_GRABC      ------------------------------------------------------------
RL21_BARQU      AAVLKETTKKTKATVSIKKTAKKPSEKKSAPQ---------KKAAVVSNNKED-------
RL21_CHESB      EKAAEEKP--AKAKKEAAEKGASPRETKAAPL---------FSAPEGEPDNLTVIKGIGP
RL21_RHILO      EVAAEAAPKEAKAKKEAAPKADVTAETAAAPL---------FKAPKGEPDDLTVIKGIGP
RL21_BRUSU      DAAEGEAA---KPKKAAPKKAAAKAESAE-------------------------------
RL21_AGRFC      ------------------------------------------------------------
RL21_RHIME      EAAN--------------------------------------------------------
RL21_HYPNA      --APAKKAAAKKEEAPKADTAPKAAAAPTEEA---------AAG----GDNLKKITGIGP
RL21_RHORT      ------------------------------------------------------------
RL21_MARMM      KAADAPKAKAKAAPKAEKAAAPKAEKAPAKKA---------AAPKAAAADALTELTGVGP
RL21_RUEPO      AGAAAPAA-----------------AAPAAAG----------------SDDLTKITGVGP
RL21_RUEST      AAPAAKAAPKAK------------AAAPAAAG----------------SDDLTQLTGVGP
RL21_RHOS4      ARRAAHNA----------------------------------------------------
RL21_ROSDO      VSATAVAAAAPKPTKKAAPAKAEKAEAAPAAG----------------ADDLKKLSGVGP
RL21_JANSC      AKDEAPKAAPKAEKKKAAPKKAKAEAAPAAADEGTRPANLLDAARDGKADDLKKISGVGP
RL21_ANADE      ------------------------------------------------------------
RL21_MYXXD      ------------------------------------------------------------
RL21_CAUVC      AAPAKAEAAPKKKAAPKKAAAKTEEGEA--------------------------------
RL21_DESVH      ------------------------------------------------------------
RL21_ONYPE      ------------------------------------------------------------
RL21_LACPL      ------------------------------------------------------------
RL21_LACSS      ------------------------------------------------------------
RL21_LACS1      ------------------------------------------------------------
RL21_ENTFA      ------------------------------------------------------------
RL21_LACLA      ------------------------------------------------------------
RL21_STRMU      ------------------------------------------------------------
RL21_BACC1      ------------------------------------------------------------
RL21_GEOKA      ------------------------------------------------------------
RL21_BACSK      ------------------------------------------------------------
RL21_BACHD      ------------------------------------------------------------
RL21_LISIN      ------------------------------------------------------------
RL21_OCEIH      ------------------------------------------------------------
RL21_BACSU      ------------------------------------------------------------
RL21_STAEQ      ------------------------------------------------------------
RL21_LACDA      ------------------------------------------------------------
RL21_LACJO      ------------------------------------------------------------
RL21_MYCGE      ------------------------------------------------------------
RL21_MYCPN      ------------------------------------------------------------
RL21_MYCGA      ------------------------------------------------------------
RL21_MYCPE      ------------------------------------------------------------
RL21_UREPA      ------------------------------------------------------------
RL21_MYCMO      ------------------------------------------------------------
RL21_MYCPU      ------------------------------------------------------------
RL21_MYCS5      ------------------------------------------------------------
RL21_MYCH2      ------------------------------------------------------------
RL21_MYCMS      ------------------------------------------------------------
RL21_MESFL      ------------------------------------------------------------
RL21_CARHZ      ------------------------------------------------------------
RL21_DESHY      ------------------------------------------------------------
RL21_CLOPS      ------------------------------------------------------------
RL21_CLOTE      ------------------------------------------------------------
RL21_CLOD6      ------------------------------------------------------------
RL21_CLOAB      ------------------------------------------------------------
RL21_MOOTA      ------------------------------------------------------------
RL21_SYMTH      ------------------------------------------------------------
RL21_CALS4      ------------------------------------------------------------
RL21_FUSNN      ------------------------------------------------------------
RL21_SYNWW      ------------------------------------------------------------
RL21_FRATO      ------------------------------------------------------------
RL21_CUTAK      ------------------------------------------------------------
RL21_THEFY      ------------------------------------------------------------
RL21_LEIXX      ------------------------------------------------------------
RL21_BIFLO      ------------------------------------------------------------
RL21_CORDI      ------------------------------------------------------------
RL21_CORJK      ------------------------------------------------------------
RL21_MYCLE      ------------------------------------------------------------
RL21_RHOJR      ------------------------------------------------------------
RL21_FRACC      ------------------------------------------------------------
RL21_TROWT      ------------------------------------------------------------
RL21_KORVE      ------------------------------------------------------------
RL21_DEIGD      ------------------------------------------------------------
RL21_DEIRA      ------------------------------------------------------------
RL21_THET8      ------------------------------------------------------------
RL21_RUBXD      ------------------------------------------------------------
RL21_AQUAE      ------------------------------------------------------------
RL21_BACTN      ------------------------------------------------------------
RL21_PORGI      ------------------------------------------------------------
RL21_CYTH3      ------------------------------------------------------------
RL21_CHLCH      ------------------------------------------------------------
RL21_PELLD      ------------------------------------------------------------
RL21_CHLTE      ------------------------------------------------------------
RL21_SALRD      ------------------------------------------------------------
RL21_LEPIN      ------------------------------------------------------------
RL21_CHLMU      ------------------------------------------------------------
RL21_CHLPN      ------------------------------------------------------------
RL21_CHLCV      ------------------------------------------------------------
RL21_PARUW      ------------------------------------------------------------
RL21_TRIV2      ------------------------------------------------------------
RL21_SYNE7      ------------------------------------------------------------
RL21_SYNY3      ------------------------------------------------------------
RL21_THEEB      ------------------------------------------------------------
RL21_TRIEI      ------------------------------------------------------------
RL21_SYNJB      ------------------------------------------------------------
RL21_SYNJA      ------------------------------------------------------------
RK21_HUPLU      ------------------------------------------------------------
RK21_PHYPA      ------------------------------------------------------------
RK21_MARPO      ------------------------------------------------------------
RK21_ANTAG      ------------------------------------------------------------
RK21_PSINU      ------------------------------------------------------------
RK21_ZYGCR      ------------------------------------------------------------
RK21_CHAVU      ------------------------------------------------------------
RK21_CHAGL      ------------------------------------------------------------
RK21_ADICA      ------------------------------------------------------------
RK21_STAPU      ------------------------------------------------------------
RL21_SYNS9      ------------------------------------------------------------
RL21_SYNPX      ------------------------------------------------------------
RL21_PROMM      ------------------------------------------------------------
RL21_SYNS3      ------------------------------------------------------------
RL21_PROMT      ------------------------------------------------------------
RL21_PROMA      ------------------------------------------------------------
RL21_PROM9      ------------------------------------------------------------
RL21_PROMP      ------------------------------------------------------------
RK21_EMIHU      ------------------------------------------------------------
RK21_CYACA      ------------------------------------------------------------
RK21_CYAM1      ------------------------------------------------------------
RK21_GUITH      ------------------------------------------------------------
RK21_TRICV      ------------------------------------------------------------
RK21_PYRYE      ------------------------------------------------------------
RK21_GRATL      ------------------------------------------------------------
RK21_CYAPA      ------------------------------------------------------------
RL21_GLOVI      ------------------------------------------------------------
                                                                            

RL21_TREDE      -------------------------------------------------------
RL21_TREPA      -------------------------------------------------------
RL21_DEHMC      -------------------------------------------------------
RL21_PELUB      -------------------------------------------------------
RL21_THEMA      -------------------------------------------------------
RL21_BORAP      -------------------------------------------------------
RL21_HELHP      -------------------------------------------------------
RL21_WOLSU      -------------------------------------------------------
RL21_HELPJ      -------------------------------------------------------
RL21_SULDN      -------------------------------------------------------
RL21_CAMJR      -------------------------------------------------------
RL21_ECOLI      -------------------------------------------------------
RL21_SODGM      -------------------------------------------------------
RL21_PHOLL      -------------------------------------------------------
RL21_HAES1      -------------------------------------------------------
RL21_PSEA6      -------------------------------------------------------
RL21_IDILO      -------------------------------------------------------
RL21_PHOPR      -------------------------------------------------------
RL21_PSET1      -------------------------------------------------------
RL21_SHEON      -------------------------------------------------------
RL21_COLP3      -------------------------------------------------------
RL21_SACD2      -------------------------------------------------------
RL21_HAHCH      -------------------------------------------------------
RL21_PSEAE      -------------------------------------------------------
RL21_CHRSD      -------------------------------------------------------
RL21_ALCBS      -------------------------------------------------------
RL21_ALKEH      -------------------------------------------------------
RL21_HYDCU      -------------------------------------------------------
RL21_LEGPL      -------------------------------------------------------
RL21_COXBU      -------------------------------------------------------
RL21_PSYCK      -------------------------------------------------------
RL21_ACIAD      -------------------------------------------------------
RL21_PARXL      -------------------------------------------------------
RL21_BORA1      -------------------------------------------------------
RL21_AROAE      -------------------------------------------------------
RL21_DECAR      -------------------------------------------------------
RL21_RHOFT      -------------------------------------------------------
RL21_POLSJ      -------------------------------------------------------
RL21_NEIG1      -------------------------------------------------------
RL21_CHRVO      -------------------------------------------------------
RL21_NITEU      -------------------------------------------------------
RL21_NITMU      -------------------------------------------------------
RL21_THIDA      -------------------------------------------------------
RL21_METFK      -------------------------------------------------------
RL21_XANOM      -------------------------------------------------------
RL21_XYLFT      -------------------------------------------------------
RL21_METCA      -------------------------------------------------------
RL21_NITOC      -------------------------------------------------------
RL21_BLOFL      -------------------------------------------------------
RL21_BLOPB      -------------------------------------------------------
RL21_WIGBR      -------------------------------------------------------
RL21_BUCAI      -------------------------------------------------------
RL21_BUCAP      -------------------------------------------------------
RL21_BUCBP      -------------------------------------------------------
RL21_BAUCH      -------------------------------------------------------
RL21_RHOBA      -------------------------------------------------------
RL21_GEOSL      -------------------------------------------------------
RL21_PELCD      -------------------------------------------------------
RL21_BDEBA      -------------------------------------------------------
RL21_SYNAS      -------------------------------------------------------
RL21_DESPS      -------------------------------------------------------
RL21_ZYMMO      -------------------------------------------------------
RL21_SPHAL      -------------------------------------------------------
RL21_NOVAD      -------------------------------------------------------
RL21_MAGSA      -------------------------------------------------------
RL21_RICBR      -------------------------------------------------------
RL21_ANAMM      -------------------------------------------------------
RL21_ANAPZ      -------------------------------------------------------
RL21_EHRRW      -------------------------------------------------------
RL21_WOLTR      -------------------------------------------------------
RL21_NEOSM      -------------------------------------------------------
RL21_RHOPA      -------------------------------------------------------
RL21_RHOPB      -------------------------------------------------------
RL21_NITWN      -------------------------------------------------------
RL21_BRADU      -------------------------------------------------------
RL21_GLUOX      -------------------------------------------------------
RL21_GRABC      -------------------------------------------------------
RL21_BARQU      -------------------------------------------------------
RL21_CHESB      VAAGQLKEQGLTTFAQLAALSDEDIARIDEAMPFSTDQIKDWREQAKEVAK----
RL21_RHILO      VAAKDLNEQGIITFAQLAKLTDKDVAKIDEHMPFSADQIKDWREQAKELAKK---
RL21_BRUSU      -------------------------------------------------------
RL21_AGRFC      -------------------------------------------------------
RL21_RHIME      -------------------------------------------------------
RL21_HYPNA      ALEKKLNAAGITTFAQIAALSADDIAKLEEELS-LAGRFAKDGWVEQAAELAKEA
RL21_RHORT      -------------------------------------------------------
RL21_MARMM      ALATKLNEAGITTFAQVAAWTEADLDALSETITGLKAKAEKNDWINAAKALAK--
RL21_RUEPO      AAAKKLVEAGIGSFAALAALSDEQIAAIDAVKV------KPEWVEQAKELAQG--
RL21_RUEST      AAAKKLEAAGLTTFAQIAALSEDDIAGIDAIKI------KPEWVEQAKELAQG--
RL21_RHOS4      -SAKE--------------------------------------------------
RL21_ROSDO      ALEKKLIEGGVTSFAQIAAWTEADVAAMDEKLSFKGRIEREGWIEQAKELAKG--
RL21_JANSC      KLEGLLNENGVYHFDQIMAWGPSEIAYMDDKLSFKGRIERDNWIEQATAFAAEQE
RL21_ANADE      -------------------------------------------------------
RL21_MYXXD      -------------------------------------------------------
RL21_CAUVC      -------------------------------------------------------
RL21_DESVH      -------------------------------------------------------
RL21_ONYPE      -------------------------------------------------------
RL21_LACPL      -------------------------------------------------------
RL21_LACSS      -------------------------------------------------------
RL21_LACS1      -------------------------------------------------------
RL21_ENTFA      -------------------------------------------------------
RL21_LACLA      -------------------------------------------------------
RL21_STRMU      -------------------------------------------------------
RL21_BACC1      -------------------------------------------------------
RL21_GEOKA      -------------------------------------------------------
RL21_BACSK      -------------------------------------------------------
RL21_BACHD      -------------------------------------------------------
RL21_LISIN      -------------------------------------------------------
RL21_OCEIH      -------------------------------------------------------
RL21_BACSU      -------------------------------------------------------
RL21_STAEQ      -------------------------------------------------------
RL21_LACDA      -------------------------------------------------------
RL21_LACJO      -------------------------------------------------------
RL21_MYCGE      -------------------------------------------------------
RL21_MYCPN      -------------------------------------------------------
RL21_MYCGA      -------------------------------------------------------
RL21_MYCPE      -------------------------------------------------------
RL21_UREPA      -------------------------------------------------------
RL21_MYCMO      -------------------------------------------------------
RL21_MYCPU      -------------------------------------------------------
RL21_MYCS5      -------------------------------------------------------
RL21_MYCH2      -------------------------------------------------------
RL21_MYCMS      -------------------------------------------------------
RL21_MESFL      -------------------------------------------------------
RL21_CARHZ      -------------------------------------------------------
RL21_DESHY      -------------------------------------------------------
RL21_CLOPS      -------------------------------------------------------
RL21_CLOTE      -------------------------------------------------------
RL21_CLOD6      -------------------------------------------------------
RL21_CLOAB      -------------------------------------------------------
RL21_MOOTA      -------------------------------------------------------
RL21_SYMTH      -------------------------------------------------------
RL21_CALS4      -------------------------------------------------------
RL21_FUSNN      -------------------------------------------------------
RL21_SYNWW      -------------------------------------------------------
RL21_FRATO      -------------------------------------------------------
RL21_CUTAK      -------------------------------------------------------
RL21_THEFY      -------------------------------------------------------
RL21_LEIXX      -------------------------------------------------------
RL21_BIFLO      -------------------------------------------------------
RL21_CORDI      -------------------------------------------------------
RL21_CORJK      -------------------------------------------------------
RL21_MYCLE      -------------------------------------------------------
RL21_RHOJR      -------------------------------------------------------
RL21_FRACC      -------------------------------------------------------
RL21_TROWT      -------------------------------------------------------
RL21_KORVE      -------------------------------------------------------
RL21_DEIGD      -------------------------------------------------------
RL21_DEIRA      -------------------------------------------------------
RL21_THET8      -------------------------------------------------------
RL21_RUBXD      -------------------------------------------------------
RL21_AQUAE      -------------------------------------------------------
RL21_BACTN      -------------------------------------------------------
RL21_PORGI      -------------------------------------------------------
RL21_CYTH3      -------------------------------------------------------
RL21_CHLCH      -------------------------------------------------------
RL21_PELLD      -------------------------------------------------------
RL21_CHLTE      -------------------------------------------------------
RL21_SALRD      -------------------------------------------------------
RL21_LEPIN      -------------------------------------------------------
RL21_CHLMU      -------------------------------------------------------
RL21_CHLPN      -------------------------------------------------------
RL21_CHLCV      -------------------------------------------------------
RL21_PARUW      -------------------------------------------------------
RL21_TRIV2      -------------------------------------------------------
RL21_SYNE7      -------------------------------------------------------
RL21_SYNY3      -------------------------------------------------------
RL21_THEEB      -------------------------------------------------------
RL21_TRIEI      -------------------------------------------------------
RL21_SYNJB      -------------------------------------------------------
RL21_SYNJA      -------------------------------------------------------
RK21_HUPLU      -------------------------------------------------------
RK21_PHYPA      -------------------------------------------------------
RK21_MARPO      -------------------------------------------------------
RK21_ANTAG      -------------------------------------------------------
RK21_PSINU      -------------------------------------------------------
RK21_ZYGCR      -------------------------------------------------------
RK21_CHAVU      -------------------------------------------------------
RK21_CHAGL      -------------------------------------------------------
RK21_ADICA      -------------------------------------------------------
RK21_STAPU      -------------------------------------------------------
RL21_SYNS9      -------------------------------------------------------
RL21_SYNPX      -------------------------------------------------------
RL21_PROMM      -------------------------------------------------------
RL21_SYNS3      -------------------------------------------------------
RL21_PROMT      -------------------------------------------------------
RL21_PROMA      -------------------------------------------------------
RL21_PROM9      -------------------------------------------------------
RL21_PROMP      -------------------------------------------------------
RK21_EMIHU      -------------------------------------------------------
RK21_CYACA      -------------------------------------------------------
RK21_CYAM1      -------------------------------------------------------
RK21_GUITH      -------------------------------------------------------
RK21_TRICV      -------------------------------------------------------
RK21_PYRYE      -------------------------------------------------------
RK21_GRATL      -------------------------------------------------------
RK21_CYAPA      -------------------------------------------------------
RL21_GLOVI      -------------------------------------------------------