CLUSTAL format seed alignment for MF_01364_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS14Z_DESAG      MSRTSLEVK-AKRKPKFS-ARAYNRCPICGRPRGYMRKFGICRICFRNMSLRGELPGVRK
RS14Z_DESVH      MSRTSLEVK-AQRKPKFS-ARAYNRCPICGRPRAYLRKFGLCRICFRNMALRGELPGVRK
RS14Z_DEHM1      MAKTSKIVQ-SQRASKFK-VQHHNRCSRCGRPRGYINRFGLCRICFRELALQGQIPGVRK
RS14Z_DEHMC      MAKTSKIVQ-SQRASKFK-VQHHNRCSRCGRPRGYINRFGLCRICFRELALQGQIPGVRK
RS14Z_DEIGD      MANTSKVVK-AARGHKFA-VQNYNRCSRCGRARGYYRFFGMCRICIRELAHKGELPGVKK
RS14Z_BORBU      MAKKSMIIR-ALRKPKYK-TRQNNRCKLCGRPRGYLRDFCMCRICFRKYASEGLIPGVSK
RS14Z_BORBP      MAKKSMIIR-ALRKPKYK-TRQNNRCKLCGRPRGYLRDFCMCRICFRKYASQGLIPGVSK
RS14Z_BORAP      MAKKSMIIK-ALRKPKYK-TRQNNRCKLCGRPRGYLRDFCMCRICFRKYASEGLIPGVSK
RS14Z_TREPA      MATVAMINK-AKATPKYA-TRRYNRCGVCGRPRGYMRRFQLCRLCFRKLASEGQIPGVTK
RS14Z_TREDE      MATVAKINQ-ANRKAKYP-TRQYNRCKVCGRPRGYLRKFKMCRVCFRKLASEGQIPGVTK
RS14Z_CARHZ      MAKKSMIAK-AQRPPKFK-VRKYNRCKICGRPRAYLRDFGMCRICFRKLAHQGEIPGVKK
RS14Z_CALS4      MARKALIVK-QQKPQKYK-TREYNRCKICGRPRAYLRKFGMCRLCFRKYAHQGMIPGVKK
RS14Z_LEPIC      MAKTSITVR-HQRKKKFE-VREYNRCPICGRSRGYLRRFDMCRICFRKLASGAQIPGVVK
RS14Z_LEPIN      MAKTSITVR-HQRKKKFE-VREYNRCPICGRSRGYLRRFDMCRICFRKLASGAQIPGVVK
RS14Z_GEOMG      MAKTSMIIK-AQRGSKFK-VREYNRCPLCGRPRAYYRKFDMCRICLRKLASTGQIPGVIK
RS14Z_GEOSL      MAKTSMIIK-AQRGSKFK-VREYNRCPLCGRPRAYYRKFDMCRICLRKLASAGQIPGVIK
RS14Z_PELCD      MAKKSMMIK-AARSNKFK-VRKYNRCPLCGRPRAYYRKFDMCRICLRKLALEGKLPGVIK
RS14Z_ANADE      MAKLSKMAQ-ATRKLKFP-VRQYNRCPLCGRPRAFLRKFQMCRICFRKRALQGEITGVIK
RS14Z_MYXXD      MAKLSKIAQ-AKRKPKFS-VRQYNRCPLCGRPRAFLRKFKMCRICLRNRALRGEVTGVTK
RS14Z_DESPS      MAKKSIIAK-AKRKQKFA-VREYNRCPLCGRPRAFIRKFGICRICFRKLASSGEVTGVTK
RS14Z_SYNAS      MAKKSLIAK-AKREQKYS-VRTYNRCSICGRPRAYYRKFGMCRICLRKLSSKGEIPGVIK
RS14Z_CAMJE      MAKKSMIAK-AARKPKFK-VRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKK
RS14Z_CAMJR      MAKKSMIAK-AARKPKFK-VRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKK
RS14Z_HELPY      MAKKSMIAK-AQRKPKFQ-VRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRK
RS14Z_HELPH      MAKKSMIAK-AQRKPKFQ-VRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRK
RS14Z_HELPJ      MAKKSMIAK-AQRKPKFQ-VRAYTRCRICGRPHSVYRDFGLCRVCLRKMASEGLIPGLRK
RS14Z_SULDN      MAKKSMIVK-AAREPKFK-VRGYTRCQICGRPHSVIRDFGICRVCFRKMANEGLIPGVRK
RS14Z_THET8      MARKALIEK-AKRTPKFK-VRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRK
RS14Z_THET2      MARKALIEK-AKRTPKFK-VRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRK
RS14Z_MYCLE      MAKKALVNK-AARKPKFT-VRGYTRCSKCGRPRAVFRKFGLCRICLREMAHAGELPGVQK
RS14Z_MYCPA      MAKKALVNK-AARKPKFA-VRGYTRCNKCGRPRAVFRKFGLCRICLREMAHAGELPGVQK
RS14Z_MYCTU      MAKKALVNK-AAGKPRFA-VRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQK
RS14Z_MYCBO      MAKKALVNK-AAGKPRFA-VRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQK
RS14Z_MYCSS      MAKKALVNK-ANKKPKFK-VRGYTRCQRCGRPHAVFRKFGLCRICLREMAHAGELPGVQK
RS14Z_RHOJR      MAKKALVNK-ANKKPKFA-VRAYTRCQRCGRPHSVFRKFGLCRICVREMAHAGELPGVHK
RS14Z_NOCFA      MAKKALVNK-ANRKPKFA-VRAYTRCQRCGRPHAVYRKFGLCRVCLRDMAHKGELPGVHK
RS14Z_STRCO      MAKKALIAK-AARKPKFG-VRGYTRCQRCGRPHSVYRKFGLCRVCLREMAHRGELPGVTK
RS14Z_STRAW      MAKKALIAK-AARKPKFG-VRGYTRCQRCGRPHSVYRKFGLCRVCLREMAHRGELPGVTK
RS14Z_FRACC      MAKKALIEK-SNRKPKYA-VRGYTRCQRCGRSRSVYRGFGLCRVCLRQMAHRGELPGVTK
RS14Z_BIFLO      MAKTALKNK-AAGKPKFK-VRAYTRCQVCGRPHSVYRKFGLCRICLREKAHRGELPGVTK
RS14Z_CUTAK      MAKTALKVK-AARKPKFG-VRAYTRCQRCGRPHSVYRKFGLCRICLREMAHAGQLPGVTK
RS14Z_THEFY      MAKKALIAK-ANRKPKFR-VRAYTRCSRCGRPRAVFRKFGLCRICFREMAHRGELPGVTK
RS14Z_RUBXD      MPRKALIAK-QQRKQKYR-TREYNRCQRCGRARAYYRKFGLCRICLRELAHEGKIPGVKK
RS14Z_THEMA      MAKKAMIER-WKKPKKYK-VREYTRCHICGRPRAVYREFGLCRICFRKLALEGKLPGVRK
RS14Z_CLOP1      MARKAMIEK-WKKEPKYK-TRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRK
RS14Z_CLOPS      MARKAMIEK-WKKEPKYK-TRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRK
RS14Z_CLOPE      MARKAMIEK-WKKEPKYK-TRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRK
RS14Z_CLOAB      MARKALIEK-WKKEPKYS-TRAYTRCKICGRPHSVLKKYGICRICFRELAYKGEIPGCRK
RS14Z_MYCS5      MARKALIEK-AKKHPKFS-SRAYTRCELCGRPHSVLRKYKICRICFRNLAHEGKIPGVKK
RS14Z_MYCPU      MAKKSLKVK-AARVAKFS-TRAYTRCQLCGRPHAVLRKFEICRICFRKLAHEGKIPGLKK
RS14Z_MYCMO      MAKTSLKVK-ATRHPKYS-ARAYTRCQICGRPQAVLRKYKICRICFRKLAHEGKIPGMKK
RS14Z_MYCH2      MAKTSWKVK-ANRAPKFK-VRAYTRCQLCGRSHSVLRKFRICRICFRVLAHQGRIPGIKK
RS14Z_MYCH7      MAKTSWKVK-ANRAPKFK-VRAYTRCQLCGRSHSVLRKFRICRICFRVLAHQGRIPGIKK
RS14Z_MYCHJ      MAKTSWKVK-ANRAPKFK-VRAYTRCQLCGRSHSVLRKFRICRICFRVLAHQGRIPGIKK
RS14Z_MOOTA      MAKKSLRVK-QARPQKFK-VRAYNRCLRCGRPHGYMRKFGLCRICFRELAYKGELPGIVK
RS14Z_SYMTH      MAKTSLKVK-AARPQKFK-VRAYNRCKLCGRPRAYMRKFGLCRHCFRKLAHEGQIPGIRK
RS14Z_DESHY      MAKKSMIVR-NARQPKYA-VRHHNRCKLCGRPHAYIRKFGICRICFRELAYKGELPGVKK
RS14Z_MYCCT      MAKKSLKVK-QAKHQKFN-VRNYTRCNHCGRPHAVLKKFGICRLCFRKFAYEGQIPGIKK
RS14Z_MESFL      MAKKSLKVK-QAKHQKFG-VRNYTRCNNCGRPHAVLKKFGICRLCFRKYAYEGQIPGIRK
RS14Z_UREPA      MAKKSLIAK-QKKHQKFA-VREYTRCVRCGRPHAVNRKFGVCRLCFRDLAYAGAIPGIKK
RS14Z_MYCGE      MAKKSLKVK-QSRPNKFS-VRDYTRCLRCGRARAVLSHFGVCRLCFRELAYAGAIPGVKK
RS14Z_MYCPN      MAKKSLKVK-QTRIPKFA-VRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAGAIPGVKK
RS14Z_MYCPE      MAKKSLIVK-QKKHPKFK-VRAYTRCERCGRPRAVIRKFGICRLCFRDLAYKGAIPGVKK
RS14Z_MYCGA      MAKTSLKIK-QARHAKFK-VRAYTRCKRCGRPHAVYRKFGICRLCFRHLAYNGSLPGVKK
RS14Z_STRP1      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRP3      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRPC      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRPD      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRPF      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRPM      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRP6      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRP8      MAKKSMIAK-NKRPAKHS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVK
RS14Z_STRA1      MAKKSMIAK-NKRPAKFS-TQAYTRCEKCGRPHSVYRKFQLCRVCFRDLAYKGQVPGVTK
RS14Z_STRA3      MAKKSMIAK-NKRPAKFS-TQAYTRCEKCGRPHSVYRKFQLCRVCFRDLAYKGQVPGVTK
RS14Z_STRA5      MAKKSMIAK-NKRPAKFS-TQAYTRCEKCGRPHSVYRKFQLCRVCFRDLAYKGQVPGVTK
RS14Z_STRMU      MAKKSMVAK-SKRPAKFS-TQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVTK
RS14Z_STRT1      MAKKSLIAK-NKRPAKFS-TQAYTRCERCGRPHSVYRKFKLCRVCFRELAHKGQIPGVTK
RS14Z_STRT2      MAKKSLIAK-NKRPAKFS-TQAYTRCERCGRPHSVYRKFKLCRVCFRELAHKGQIPGVTK
RS14Z_ENTFA      MAKKSMIAK-NKRPAKHS-TQAYTRCERCGRPHSVYRKFHLCRICFRELAYKGQIPGVKK
RS14Z_LACLA      MAKKSMVVK-NQRPAKFS-TQAYTRCERCGRPHSVYRKFKLCRICLRELAYKGQLPGVKK
RS14Z_LACPL      MAKKSQIAK-QKRGAKFN-VQNYTRCERCGRPHSVYRKFHLCRICLRDLAHKGQIPGMKK
RS14Z_LACS1      MAKKSQIAK-NKRPAKFS-TQEYTRCERCGRPHSVYRKFKLCRVCLRDLAHKGQIPGMKK
RS14Z_LACDA      MAKTSQKVR-NHRPAKFS-SREYTRCERCGRPHSVYRKFGLCRICLKELGHKGQIPGLKK
RS14_BACSU       MAKKSMIAK-QQRTPKFK-VQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKK
R14Z1_BACLD      MAKKSMIAK-QKRTPKFK-VQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKK
RS14Z_BACAN      MAKKSMIAK-QKRTPKFK-VQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKK
RS14Z_BACC1      MAKKSMIAK-QKRTPKFK-VQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKK
RS14Z_BACHK      MAKKSMIAK-QKRTPKFK-VQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKK
RS14Z_BACCR      MAKKSMIAK-QKRTPKFK-VQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKK
RS14Z_BACCZ      MAKKSMIAK-QKRTPKFK-VQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKK
RS14Z_OCEIH      MAKKSMIAK-QKRPQKFK-VQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKK
RS14Z_LISMO      MAKKSMIAK-QKRTPKYA-VQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKK
RS14Z_LISIN      MAKKSMIAK-QKRTPKYA-VQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKK
RS14Z_LISMF      MAKKSMIAK-QKRTPKYA-VQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKK
RS14Z_BACSK      MAKKSMIAK-QKRTPKYN-VQAYTRCERCGRPHSVLRKFKLCRICFRELAYKGQIPGVKK
RS14Z_GEOKA      MAKKSMIAK-QKRTPKFK-VRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKK
RS14Z_BACHD      MAKKSMIAK-QKRTQKYK-VREYTRCERCGRPHSVMRKFKLCRICFRELAYKGQIPGVKK
R14Z2_BACLD      MAKTSMIVK-QKREQKFK-VREYTRCERCGRPHSVIRKFKLCRICFRELAYKGHIPGVKK
RS14Z_STAAC      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAAM      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAAB      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAHJ      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAA3      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAA8      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAAS      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAAW      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAAN      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAAR      MAKTSMVAK-QQKKQKYA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAEQ      MAKTSMVAK-QQKKQKFA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAES      MAKTSMVAK-QQKKQKFA-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_STAS1      MAKTSMVAK-QQKKQKFQ-VREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRK
RS14Z_CLOD6      MARKAMVVK-QQRKQKYA-TREYTRCTICGRPHSVLKKFGICRICFRELAYKGQIPGVRK
RS14Z_RHOBA      MASKSKVAK-ALRTPKFS-TRKENRCKFCGRPRSVYRKFGLCRICFRENANAGLIPGVRK
RS14Z_GLOVI      MVEREKKRQKLVLKGKLSDTRLHNRCWRCGRPRGYIRDFGLCRICFREMAHQGLLPGVVK
RS14Z_AQUAE      MPRKAKVAKDLMYYPKWK-SRKKNRCPICGRPRAFIRYFNMCRICFREHALRGDLPGVRK
                 *       :      :    :  .**  ***.:.    : :** *.:  .  . :.*  *

RS14Z_DESAG      SSW
RS14Z_DESVH      SSW
RS14Z_DEHM1      SSW
RS14Z_DEHMC      SSW
RS14Z_DEIGD      ASW
RS14Z_BORBU      SSW
RS14Z_BORBP      SSW
RS14Z_BORAP      SSW
RS14Z_TREPA      SSW
RS14Z_TREDE      SSW
RS14Z_CARHZ      ASW
RS14Z_CALS4      ASW
RS14Z_LEPIC      SSW
RS14Z_LEPIN      SSW
RS14Z_GEOMG      SSW
RS14Z_GEOSL      SSW
RS14Z_PELCD      SSW
RS14Z_ANADE      SSW
RS14Z_MYXXD      SSW
RS14Z_DESPS      SSW
RS14Z_SYNAS      SSW
RS14Z_CAMJE      ASW
RS14Z_CAMJR      ASW
RS14Z_HELPY      ASW
RS14Z_HELPH      ASW
RS14Z_HELPJ      ASW
RS14Z_SULDN      SSW
RS14Z_THET8      ASW
RS14Z_THET2      ASW
RS14Z_MYCLE      SSW
RS14Z_MYCPA      SSW
RS14Z_MYCTU      SSW
RS14Z_MYCBO      SSW
RS14Z_MYCSS      SSW
RS14Z_RHOJR      SSW
RS14Z_NOCFA      SSW
RS14Z_STRCO      SSW
RS14Z_STRAW      SSW
RS14Z_FRACC      SSW
RS14Z_BIFLO      SSW
RS14Z_CUTAK      SSW
RS14Z_THEFY      ASW
RS14Z_RUBXD      ASW
RS14Z_THEMA      ASW
RS14Z_CLOP1      ASW
RS14Z_CLOPS      ASW
RS14Z_CLOPE      ASW
RS14Z_CLOAB      ASW
RS14Z_MYCS5      ASW
RS14Z_MYCPU      ASW
RS14Z_MYCMO      ASW
RS14Z_MYCH2      ASW
RS14Z_MYCH7      ASW
RS14Z_MYCHJ      ASW
RS14Z_MOOTA      ASW
RS14Z_SYMTH      ASW
RS14Z_DESHY      ASW
RS14Z_MYCCT      ASW
RS14Z_MESFL      ASW
RS14Z_UREPA      ASW
RS14Z_MYCGE      ASW
RS14Z_MYCPN      ASW
RS14Z_MYCPE      ASW
RS14Z_MYCGA      SSW
RS14Z_STRP1      ASW
RS14Z_STRP3      ASW
RS14Z_STRPC      ASW
RS14Z_STRPD      ASW
RS14Z_STRPF      ASW
RS14Z_STRPM      ASW
RS14Z_STRP6      ASW
RS14Z_STRP8      ASW
RS14Z_STRA1      ASW
RS14Z_STRA3      ASW
RS14Z_STRA5      ASW
RS14Z_STRMU      ASW
RS14Z_STRT1      ASW
RS14Z_STRT2      ASW
RS14Z_ENTFA      ASW
RS14Z_LACLA      ASW
RS14Z_LACPL      ASW
RS14Z_LACS1      ASW
RS14Z_LACDA      ASW
RS14_BACSU       ASW
R14Z1_BACLD      ASW
RS14Z_BACAN      ASW
RS14Z_BACC1      ASW
RS14Z_BACHK      ASW
RS14Z_BACCR      ASW
RS14Z_BACCZ      ASW
RS14Z_OCEIH      ASW
RS14Z_LISMO      ASW
RS14Z_LISIN      ASW
RS14Z_LISMF      ASW
RS14Z_BACSK      ASW
RS14Z_GEOKA      ASW
RS14Z_BACHD      ASW
R14Z2_BACLD      ASW
RS14Z_STAAC      ASW
RS14Z_STAAM      ASW
RS14Z_STAAB      ASW
RS14Z_STAHJ      ASW
RS14Z_STAA3      ASW
RS14Z_STAA8      ASW
RS14Z_STAAS      ASW
RS14Z_STAAW      ASW
RS14Z_STAAN      ASW
RS14Z_STAAR      ASW
RS14Z_STAEQ      ASW
RS14Z_STAES      ASW
RS14Z_STAS1      ASW
RS14Z_CLOD6      ASW
RS14Z_RHOBA      SSW
RS14Z_GLOVI      ASW
RS14Z_AQUAE      ASW
                 :**