CLUSTAL format seed alignment for MF_01366

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RM13_BOVIN            ------------------------------------------------------------
RM13_HUMAN            ------------------------------------------------------------
RM13_MOUSE            ------------------------------------------------------------
A0A2H2I6R0_CAEJA      ------------------------------------------------------------
H3FZQ1_PRIPA          ------------------------------------------------------------
A0A0R3NSN0_DROPS      ------------------------------------------------------------
Q17ET7_AEDAE          ------------------------------------------------------------
E0VQP7_PEDHC          ------------------------------------------------------------
A0A158NPD5_ATTCE      ------------------------------------------------------------
A0A088AH49_APIME      ------------------------------------------------------------
B7PBT5_IXOSC          ------------------------------------------------------------
G4VGE1_SCHMA          ------------------------------------------------------------
B3S1A8_TRIAD          ------------------------------------------------------------
A0A1X7VF42_AMPQE      ------------------------------------------------------------
A7SWD2_NEMVE          ------------------------------------------------------------
RL13_THEMA            ------------------------------------------------------------
RL13_AQUAE            ------------------------------------------------------------
RL13_DICTD            ------------------------------------------------------------
RL13_CHLAA            ------------------------------------------------------------
RL13_GEOSL            ------------------------------------------------------------
RL13_SALRD            ------------------------------------------------------------
RL13_CHLTE            ------------------------------------------------------------
D1B6V8_THEAS          ------------------------------------------------------------
Q7UEY3_RHOBA          ------------------------------------------------------------
RL13_VIBCH            ------------------------------------------------------------
RL13_ALIF1            ------------------------------------------------------------
RL13_SHEON            ------------------------------------------------------------
RL13_YERPE            ------------------------------------------------------------
RL13_PSEAE            ------------------------------------------------------------
RL13_XANCP            ------------------------------------------------------------
RL13_BUCAI            ------------------------------------------------------------
Q5NFG3_FRATT          ------------------------------------------------------------
RL13_NEIG1            ------------------------------------------------------------
RL13_BURPS            ------------------------------------------------------------
RL13_BORPE            ------------------------------------------------------------
RL13_MYCS2            ------------------------------------------------------------
RL13_MYCTU            ------------------------------------------------------------
RL13_CORGL            ------------------------------------------------------------
RL13_STRCO            ------------------------------------------------------------
RL13_BIFLO            ------------------------------------------------------------
RL13_MOOTA            ------------------------------------------------------------
RL13_AGRFC            ------------------------------------------------------------
RL13_RHOS4            ------------------------------------------------------------
RL13_BRADU            ------------------------------------------------------------
RL13_RHORT            ------------------------------------------------------------
RL13_RICPR            ------------------------------------------------------------
Q9A8H7_CAUVC          ------------------------------------------------------------
RL13_BACAN            ------------------------------------------------------------
RL13_BACSU            ------------------------------------------------------------
RL13_LISMO            ------------------------------------------------------------
RL13_STAA8            ------------------------------------------------------------
Q8CWU5_STRR6          ------------------------------------------------------------
Q9CDG6_LACLA          ------------------------------------------------------------
RL13_LACPL            ------------------------------------------------------------
RL13_MESFL            ------------------------------------------------------------
RL13_MYCMS            ------------------------------------------------------------
RL13_BORBU            ------------------------------------------------------------
RL13_CLOAB            ------------------------------------------------------------
A5I7H1_CLOBH          ------------------------------------------------------------
RL13_SYNY3            ------------------------------------------------------------
RL13_THEEB            ------------------------------------------------------------
RL13_PROMA            ------------------------------------------------------------
Q7ND18_GLOVI          ------------------------------------------------------------
M1AA76_SOLTU          MAVQCSSSSVIFAS------HSPAK--TFSSSPNKTLFLGFSISSKPS-----IVVAK-T
K4DCX4_SOLLC          MAVHYYCS-LMFTC------PSP------KSLSNKTPFLGFSMAAPSS-----LTFSG-N
F6H2K9_VITVI          MAITFASSSVMLPS------PSPSPKPSFGSLKKTTPFLGFSISAAN------PKPSF-P
RK13_ARATH            MAVLCSSSTVILSS------SSVKS----SGSERKSPFLGFSLTAISKPSVRVGIYAN-S
M0TW58_MUSAM          MAATIPASASLSVGRFPNNRASSSSCPCPATALRRTFLVGFSKFPAAVAKPSLGVASLPS
Q94J17_ORYSJ          MATAIAASAFLSSAFAR-----------DRPLPRQRRAARPATRRAAA-----GGLSVRC
C5XK39_SORBI          MATAVASPTFLSSAFA------------PRQHRRLTRLAGP--RRAAP-----VGLAVRC
I1MID7_SOYBN          MALLCGSTSVTPFL---------SHKNVGFTTSAKSSFVGFQLPLPKLTLS--SSVRTLL
RL13_CHLTR            ---------------------------------------------------------MEK
A8HWZ6_CHLRE          ------------------------------------------MALTASKLSGRTAFTTER
RL13_THET8            ------------------------------------------------------------
RL13_DEIRA            ------------------------------------------------------------
RL13_COXBU            ------------------------------------------------------------
RL13_DESVH            ------------------------------------------------------------
Q8RGG9_FUSNN          ------------------------------------------------------------
RL13_KORVE            ------------------------------------------------------------
B5YGH9_THEYD          ------------------------------------------------------------
RL13_MYCPN            ------------------------------------------------------------
Q8F0T2_LEPIN          ------------------------------------------------------------
A6GWU4_FLAPJ          ------------------------------------------------------------
Q8A0Z6_BACTN          ------------------------------------------------------------
RL13_HELPY            ------------------------------------------------------------
Q0P8D7_CAMJE          ------------------------------------------------------------
RM23_YEAST            ------------------------------------------------------------
Q753Q5_ASHGO          ------------------------------------------------------------
Q5A8Y6_CANAL          ------------------------------------------------------------
Q6C9L9_YARLI          ------------------------------------------------------------
Q5AQG1_EMENI          ------------------------------------------------------------
J3KDA4_COCIM          ------------------------------------------------------------
C0NVE7_AJECG          ------------------------------------------------------------
D5G6J1_TUBMM          ------------------------------------------------------------
C7Z9I3_NECH7          ------------------------------------------------------------
A7E481_SCLS1          ------------------------------------------------------------
RM23_SCHPO            ------------------------------------------------------------
I1CTI6_RHIO9          ------------------------------------------------------------
Q5KM48_CRYNJ          ------------------------------------------------------------
E3L423_PUCGT          ------------------------------------------------------------
F4P5H6_BATDJ          ------------------------------------------------------------
F6I5K7_VITVI          ------------------------------------------------------------
M0RG99_MUSAM          ------------------------------------------------------------
M1CI41_SOLTU          ------------------------------------------------------------
C6THJ7_SOYBN          ------------------------------------------------------------
A9PG49_POPTR          ------------------------------------------------------------
Q7XA68_ARATH          ------------------------------------------------------------
C5XFD0_SORBI          ------------------------------------------------------------
I1ITW2_BRADI          ------------------------MWRSRARTLLLHHSSIPSLPPQPNPLRTLIRAPAPR
Q7EYE3_ORYSJ          ------------------------------------------------------------
D0N078_PHYIT          ------------------------------------------------------------
A8J810_CHLRE          ------------------------------------------------------------
F0Z620_DICPU          ------------------------------------------------------------
A0T0K1_PHATC          ------------------------------------------------------------
A0T0Z5_THAPS          ------------------------------------------------------------
A0A077TH32_PLACH      -----------------------------------------------------MIKQSLA
A5KBY1_PLAVS          -----------------------------------------------------MIGASAR
O96222_PLAF7          -----------------------------------------------------MIRRSLI
B9PMD5_TOXGV          -----------------------------------------------------MWTSLLR
Q4UGV0_THEAN          -----------------------------------------------------MFISKFL
Q580D5_TRYB2          ------------------------------------------------------------
A4IAD5_LEIIN          ------------------------------------------------------------
RL13_METAC            ------------------------------------------------------------
RL13_METHJ            ------------------------------------------------------------
RL13_THEKO            ------------------------------------------------------------
RL13_ARCFU            ------------------------------------------------------------
RL13_THEAC            ------------------------------------------------------------
RL13_METJA            ------------------------------------------------------------
B1L7A3_KORCO          ------------------------------------------------------------
RL13_NANEQ            ------------------------------------------------------------
RL13_METKA            ------------------------------------------------------------
RL13_HALSA            ------------------------------------------------------------
RL13_PYRAE            ------------------------------------------------------------
A1RWV8_THEPD          ------------------------------------------------------------
RL13_SACS2            ------------------------------------------------------------
A2BK81_HYPBU          ------------------------------------------------------------
RL13A_CAEEL           ------------------------------------------------------------
E9HBC4_DAPPU          ------------------------------------------------------------
Q5UAS5_BOMMO          ------------------------------------------------------------
A0A158NDR5_ATTCE      ------------------------------------------------------------
E0VX11_PEDHC          ------------------------------------------------------------
Q297M7_DROPS          ------------------------------------------------------------
Q16US7_AEDAE          ------------------------------------------------------------
RL16B_YEAST           ------------------------------------------------------------
RL16A_YEAST           ------------------------------------------------------------
Q5AB87_CANAL          ------------------------------------------------------------
Q756A0_ASHGO          ------------------------------------------------------------
G5EB54_EMENI          ------------------------------------------------------------
A7EPJ6_SCLS1          ------------------------------------------------------------
Q0U0K4_PHANO          ------------------------------------------------------------
C7Z299_NECH7          ------------------------------------------------------------
Q6CCI0_YARLI          ------------------------------------------------------------
D5G9H4_TUBMM          ------------------------------------------------------------
I1BSI4_RHIO9          ------------------------------------------------------------
RL16A_SCHPO           ------------------------------------------------------------
RL16C_SCHPO           ------------------------------------------------------------
B3RYA7_TRIAD          ------------------------------------------------------------
A7SBZ8_NEMVE          ------------------------------------------------------------
A9V9H5_MONBE          ------------------------------------------------------------
F4P0Q4_BATDJ          ------------------------------------------------------------
E3KWG5_PUCGT          ------------------------------------------------------------
Q5K7I5_CRYNJ          ------------------------------------------------------------
RL13A_BOVIN           ------------------------------------------------------------
Q5RK10_RAT            ------------------------------------------------------------
Q28HK3_XENTR          ------------------------------------------------------------
Q1LYB7_DANRE          ------------------------------------------------------------
C3ZL87_BRAFL          ------------------------------------------------------------
W4XS18_STRPU          ------------------------------------------------------------
B7PR90_IXOSC          ------------------------------------------------------------
G4VQW2_SCHMA          ------------------------------------------------------------
RL13A_DICDI           ------------------------------------------------------------
F0ZPD3_DICPU          ------------------------------------------------------------
Q7F225_ORYSJ          ------------------------------------------------------------
I1H4D4_BRADI          ------------------------------------------------------------
C5YZ01_SORBI          ------------------------------------------------------------
C6SYZ8_SOYBN          ------------------------------------------------------------
F4JD96_ARATH          ------------------------------------------------------------
A5BL45_VITVI          ------------------------------------------------------------
K4CWK0_SOLLC          ------------------------------------------------------------
A9PHS9_POPTR          ------------------------------------------------------------
A9P8J0_POPTR          ------------------------------------------------------------
A9SHV1_PHYPA          ------------------------------------------------------------
A8IVU0_CHLRE          ------------------------------------------------------------
B7FSS8_PHATC          ------------------------------------------------------------
B8C0R3_THAPS          ------------------------------------------------------------
H3G8D4_PHYRM          ------------------------------------------------------------
B9PT75_TOXGV          --------------------------------MMFSISIPGLEATAHPCGPVHVRVVLYS
A5K762_PLAVS          ------------------------------------------------------------
A0CIE1_PARTE          ------------------------------------------------------------
Q245E7_TETTS          --------------------------------------------MIKGQIKREVKKINQQ
C4M3F3_ENTHI          ------------------------------------------------------------
A2DGT9_TRIVA          ------------------------------------------------------------
Q585J5_TRYB2          ------------------------------------------------------------
A4H7Z1_LEIBR          ------------------------------------------------------------
A0RXP5_CENSY          ------------------------------------------------------------
A9A5C3_NITMS          ------------------------------------------------------------
Q8SS16_ENCCU          ------------------------------------------------------------
                                                                                  

RM13_BOVIN            -------------------------------------------MASLSRAPQQWATFARV
RM13_HUMAN            -------------------------------------------MSSFSRAPQQWATFARI
RM13_MOUSE            -------------------------------------------MSSFSRAPQQWATFARM
A0A2H2I6R0_CAEJA      --------------------------------------MSARRVVSRVDRVNQWLQFSRQ
H3FZQ1_PRIPA          --------------------------------------MSHSGVVSRMNRVRQWAQFARQ
A0A0R3NSN0_DROPS      --------------------------------------------MSIAKRVQQWATFART
Q17ET7_AEDAE          --------------------------------------------MSVTRRVQQWATFART
E0VQP7_PEDHC          --------------------------------------------MSAYGRVQQWATFCRV
A0A158NPD5_ATTCE      --------------------------------------------MSLARKGQHWGTFARI
A0A088AH49_APIME      --------------------------------------------MSLLRKGQHWGTFSIV
B7PBT5_IXOSC          -----------------------------------------MCALSSFKRVQQWATFTRR
G4VGE1_SCHMA          --------------------------------------------MSHW-RVLQWRAFARE
B3S1A8_TRIAD          -------------------------------------------MSSFHRASQSLRTHARM
A0A1X7VF42_AMPQE      -----------------------------------------MASLRTSLLSQSLATHTKL
A7SWD2_NEMVE          -------------------------------------------MAFTNRASQSFKTHARL
RL13_THEMA            -------------------------------------MARYFPVQKTTMIKPEEVERK--
RL13_AQUAE            --------------------------------------------MKTYRIKPEEVERK--
RL13_DICTD            --------------------------------------------MKTFMAKKEEIKRE--
RL13_CHLAA            --------------------------------------------MKTYHQKPTEVQRD--
RL13_GEOSL            -------------------------------------------MKTTKVAKKEEVTRD--
RL13_SALRD            ---------------------------------------MDTQSFKTFNAKPDEVERD--
RL13_CHLTE            --------------------------------------MSKTLSFKTYSAKPGEVKRT--
D1B6V8_THEAS          -----------------------------------------MIGTRSFMAKKEAVERK--
Q7UEY3_RHOBA          -----------------------------------------MAVQRTYMAKPGQIEKQ--
RL13_VIBCH            --------------------------------------------MKTFVAKPETVKRD--
RL13_ALIF1            --------------------------------------------MKTFVAKPAAVKRD--
RL13_SHEON            --------------------------------------------MKTFTATPETVTRD--
RL13_YERPE            --------------------------------------------MKTFTAKPETVKRD--
RL13_PSEAE            --------------------------------------------MKTYTAKPETVQRD--
RL13_XANCP            --------------------------------------------MTTFTAKSETVQRD--
RL13_BUCAI            --------------------------------------------MKTFSIKSSNIKRH--
Q5NFG3_FRATT          -----------------------------------MTTINKGKKMKTFTAKPSNIKRE--
RL13_NEIG1            --------------------------------------------MKTFSAKPHEVKRE--
RL13_BURPS            --------------------------------------------MKTFSAKAHEVTRE--
RL13_BORPE            --------------------------------------------MKTFVAKPHEVKRD--
RL13_MYCS2            --------------------------------------------MPTYTPKAGDTTRS--
RL13_MYCTU            --------------------------------------------MPTYAPKAGDTTRS--
RL13_CORGL            --------------------------------------------MSTYHPKSGDITRK--
RL13_STRCO            --------------------------------------------MRTYSPKPGDVTRQ--
RL13_BIFLO            --------------------------------------------MKTFTPKPADLTHD--
RL13_MOOTA            --------------------------------------------MSTFMAKPHEVERK--
RL13_AGRFC            --------------------------------------------MSTFVQKPAEVEKK--
RL13_RHOS4            --------------------------------------------MKTFTATPADIEKK--
RL13_BRADU            --------------------------------------------MKTFSAKPAEVTKK--
RL13_RHORT            --------------------------------------------MKTYSAKPSEVDRK--
RL13_RICPR            --------------------------------------------MKTYSAKPSEIEKK--
Q9A8H7_CAUVC          ------------------------------------------MQKITASLKPAEVEKK--
RL13_BACAN            -------------------------------------------MRTTFMAKANEVERK--
RL13_BACSU            -------------------------------------------MRTTPMANASTIERK--
RL13_LISMO            -------------------------------------------MRTTYMAKPGEVERK--
RL13_STAA8            -------------------------------------------MRQTFMANESNIERK--
Q8CWU5_STRR6          ------------------------------------------MNKTTFMAKPGQVERK--
Q9CDG6_LACLA          ------------------------------------------MMKTTFMANAQNVDRK--
RL13_LACPL            -------------------------------------------MRTTYMAKPGEIDRK--
RL13_MESFL            -------------------------------------------MKQTTLIAAKDIKKN--
RL13_MYCMS            -------------------------------------------MKQTTMISAKDTNKK--
RL13_BORBU            --------------------------------------MNKITNNDTIWIKPKTVEKK--
RL13_CLOAB            --------------------------------------------MKSYLAKPQEIERK--
A5I7H1_CLOBH          -------------------------------------------MMKSYIAKPHEVERK--
RL13_SYNY3            ----------------------------------------MNKTVLPTIDN---LDHK--
RL13_THEEB            -------------------------------------MTSTVKTPLPAVDD---LAPQ--
RL13_PROMA            ----------------------------------------MNKTITPSIDS---INRQ--
Q7ND18_GLOVI          ---------------------------------------MTAKTFLPAVDE---IERR--
M1AA76_SOLTU          HRATQICCQEK-----TALVPLEQRWMFEDSE--INGPDIWNETWYPKGADHVNTDKP--
K4DCX4_SOLLC          NRTAQIRCQDK-----AAYIPLDQRWMFEESE--IDGPDIWNETWYPKAADHVNTDKP--
F6H2K9_VITVI          RQSFRVNCQDK-----AAVVPLDQRWMFEQSE--VSGPDIWNKTWYPKAADHINTEKT--
RK13_ARATH            KRGLQVKCEAEPTTT-TSLVPANQRWMFDEEE--ANGPDIWNTTWYPKASDHVNTDKP--
M0TW58_MUSAM          RRYLRTHCQQQEQQQRLAFVPREQRWMFEESE--INGPDIWNKTWYPKAADHISTEKT--
Q94J17_ORYSJ          EQSEKQKRQPL-----SALVPREQRFMFEGDE--LCGPDIWNTTWYPKAADHVTTEKT--
C5XK39_SORBI          EKSDKQKRQPL-----SALVPREQRFMFEGDE--LCGPDIWNTTWYPKAADHVTTEKT--
I1MID7_SOYBN          PATSRVRCQQE-STTVTPVAEEDPRFACVEPEPRFKGPDIWNKSWYPKAADHVNTEKT--
RL13_CHLTR            R-------------------KDTKTTLAKAS---------------------DDRNKA--
A8HWZ6_CHLRE          RVAVRAAFQSTRVAARVAPVSRVQSVVCKASATEFKGD-LLNKSYYPTSADASNVNKR--
RL13_THET8            --------------------------------------------MKTYVP--KQVEPR--
RL13_DEIRA            ----------------MAFPDTDVSPPRGGPSSPAKSPLLRSFKVKTYIP--KNDEQN--
RL13_COXBU            --------------------------------------------MATYMANAKTVSPR--
RL13_DESVH            ------------------------------------------MK--TFSPTPENINRE--
Q8RGG9_FUSNN          ------------------------------------------MKKYTFMQRKEDVVRE--
RL13_KORVE            ------------------------------------------MS--TYFPK-GEVARK--
B5YGH9_THEYD          ------------------------------------------MK--TVFVKKEEVNRR--
RL13_MYCPN            -------------------------------------------MQKTSMLTKEQANKRRQ
Q8F0T2_LEPIN          -------------------------------------MSVLSKVHKTPSLTKENAVKG--
A6GWU4_FLAPJ          ---------------------------------------MDALSYKTQSASKATITKE--
Q8A0Z6_BACTN          ---------------------------------------MDTLSYKTISANKATVTKE--
RL13_HELPY            ---------------------------------------------MTKTAKVNDIVRD--
Q0P8D7_CAMJE          ---------------------------------------------MTKITKPNEVKRE--
RM23_YEAST            ---------------------------------------------MSQKIGHSGLAFARL
Q753Q5_ASHGO          ---------------------------------------------MSQKIGQSGLAFARL
Q5A8Y6_CANAL          ---------------------------------------------MSQRIGITASALTRV
Q6C9L9_YARLI          ---------------------------------------------MSQTIGKARLAFSRT
Q5AQG1_EMENI          ---------------------------------------------MSQTVGKTRLAYSRA
J3KDA4_COCIM          ---------------------------------------------MSQSIGRTRLAYSRT
C0NVE7_AJECG          ---------------------------------------------MSQTVGRTRLAYSRT
D5G6J1_TUBMM          ---------------------------------------------MSTNIGRTSLAYSRS
C7Z9I3_NECH7          ---------------------------------------------MSQTLGLTRLAYSRV
A7E481_SCLS1          ---------------------------------------------MSQTNGFTKLAYSRT
RM23_SCHPO            ---------------------------------------------MSTLNGQTALAYAKV
I1CTI6_RHIO9          ---------------------------------------------MSQAVGNTALAYARV
Q5KM48_CRYNJ          ---------------------------------------------MSATKGNTALALTRV
E3L423_PUCGT          --MKCCGLVTSGRGPRKRNPRIIGLGEASGDEDGPTKPTQEILEEMYSPATRTGAGFVRL
F4P5H6_BATDJ          ------------------------------------------------MSLKNGLAHARL
F6I5K7_VITVI          ----------------------------------MATSSFNGNMKKALAGLRRINLEGLR
M0RG99_MUSAM          --------------------------------MAVATQTFKGNLKKALAGLRRIDLEGLR
M1CI41_SOLTU          ---------------------------------MVMGQPFSGNMKKALAGIKRINLEGLR
C6THJ7_SOYBN          ---------------------------------MKMVTAFTGNMKKAAAGLRRINLDGLR
A9PG49_POPTR          ------------------------------MASQAAASAFNSSMKKAHAGLKRINLEGLR
Q7XA68_ARATH          -----------------------------MATQAAAAASFKGNLKKAVAGIKRINLDGLR
C5XFD0_SORBI          --------------------------------MAATAPAFTGNLKKALAGLRRINLDGLR
I1ITW2_BRADI          LLSRFLSSSAEATRVPDASPSSSSVRAVSTSAPAGAPPAFTGNLKKALAGLRRINLEGLR
Q7EYE3_ORYSJ          --------------------------------MAAAPPAFTGNLKKALAGLRRINLDGLR
D0N078_PHYIT          -------------------------------------------MSKIAQASK------VA
A8J810_CHLRE          -------------------------------------MSRVTEAIKHLKDLQHIKLEGLR
F0Z620_DICPU          ---------------------------------------------MSRSIFKNPLTSSHL
A0T0K1_PHATC          ----------------------------------------MNSLNKTFLPTKNYKNRN--
A0T0Z5_THAPS          -------------------------------------------MNKTFIPASNYNKRK--
A0A077TH32_PLACH      RLAGYPKASFHEQNINPFSNVQWKSFPFLKKNMPK-VDIFAEDHVSKTAISVFDKEKGN-
A5KBY1_PLAVS          RLAGYPKASFHEQSINPFSNVQWKSTPFLKKNMPK-TDPFAEEHVSRNAISVFDREKGN-
O96222_PLAF7          KLGGYPKASFHEQHINPFSNVQWQSYPFLKKNMPK-VDIFSEEHISKCALSVFDKEKGN-
B9PMD5_TOXGV          LSQSYPKGSFHEGHINPFADVQWISRPFMKRNMPRDHHPLAKQHTSLKAVTMLDEESGNH
Q4UGV0_THEAN          LARSL-RSSFHEGTVNPFSKVQWVSRPFLKKNLPT-VSPLATPHQSLGAITHMDTTAGN-
Q580D5_TRYB2          -----------------MQRSTRIVMAPFKSVLRRHKHHPEGLPLYNDMSKQWLCREGER
A4IAD5_LEIIN          -----------------MLRATFILGAPFKSVLRRHKYHPEGLPLYNDLSKQWLCREGER
RL13_METAC            ---------------------------------------------------------MLK
RL13_METHJ            -----------------------------------------------------------M
RL13_THEKO            ------------------------------------------------------------
RL13_ARCFU            ---------------------------------------------MAVNVSRVIKTLGDD
RL13_THEAC            ------------------------------------------------------------
RL13_METJA            ------------------------------------------------------------
B1L7A3_KORCO          ---------------------------------------------------------MNF
RL13_NANEQ            -----------------------------------------------MEFLGE-------
RL13_METKA            ----------------------------------------------MVEYAHSKPVDPEE
RL13_HALSA            ----------------------------------------------------MSLAEFDA
RL13_PYRAE            -------------------------------------------MNVVKRPLDISQLPDAG
A1RWV8_THEPD          ----------------------------------------------------MSGKEEA-
RL13_SACS2            ----------------------------------------------------MSTQVQEQ
A2BK81_HYPBU          ----------------------------------------------MGTVKVVAPKPPER
RL13A_CAEEL           ----------------------------MGLS--------------------------NR
E9HBC4_DAPPU          ---------------------------MPGFT--------------------------NK
Q5UAS5_BOMMO          ---------------------------MTGFS--------------------------NK
A0A158NDR5_ATTCE      ---------------------------MTGFS--------------------------EK
E0VX11_PEDHC          ---------------------------MTGFA--------------------------KK
Q297M7_DROPS          ---------------------------MTGLT--------------------------NR
Q16US7_AEDAE          ---------------------------MPGLS--------------------------EK
RL16B_YEAST           -----------------------------MS---------------------------QP
RL16A_YEAST           ----------------------------MSV---------------------------EP
Q5AB87_CANAL          ---------------------------MSSF---------------------------EK
Q756A0_ASHGO          ---------------------------MSSF---------------------------EP
G5EB54_EMENI          ---------------------------MSSI---------------------------DP
A7EPJ6_SCLS1          ---------------------------MSTF---------------------------EP
Q0U0K4_PHANO          ---------------------------MSTF---------------------------EP
C7Z299_NECH7          ---------------------------MSTF---------------------------EQ
Q6CCI0_YARLI          ---------------------------MSTF---------------------------EP
D5G9H4_TUBMM          ---------------------------MSQF---------------------------EP
I1BSI4_RHIO9          ---------------------------MSTF---------------------------EK
RL16A_SCHPO           ---------------------------MSEF---------------------------QK
RL16C_SCHPO           ---------------------------MSEF---------------------------QK
B3RYA7_TRIAD          ----------------------------MGF---------------------------EK
A7SBZ8_NEMVE          ----------------------------MGF---------------------------EK
A9V9H5_MONBE          --------------------------MSCSF---------------------------EK
F4P0Q4_BATDJ          ----------------------------MAY---------------------------EK
E3KWG5_PUCGT          --------------------------MSKMS---------------------------SA
Q5K7I5_CRYNJ          --------------------------MSAFS---------------------------AQ
RL13A_BOVIN           ---------------------------MAE----------------------------GQ
Q5RK10_RAT            ---------------------------MAE----------------------------GQ
Q28HK3_XENTR          ---------------------------MADAANKKLMKDIARVSLPGLHKSSGGFKSARQ
Q1LYB7_DANRE          ---------------------------MADRFNK--------------------------
C3ZL87_BRAFL          ----------------------------MAV---------------------------GK
W4XS18_STRPU          ---------------------------MSSF---------------------------AK
B7PR90_IXOSC          ---------------------------MTGIS--------------------------SK
G4VQW2_SCHMA          ----------------------------MSFQ--------------------------KK
RL13A_DICDI           ---------------------------MFQ----------------------------KK
F0ZPD3_DICPU          ---------------------------MFS----------------------------KN
Q7F225_ORYSJ          --------------------------MVSGSG------------------------LCTR
I1H4D4_BRADI          --------------------------MVSGSG------------------------ISAR
C5YZ01_SORBI          --------------------------MVSGSG------------------------LSAK
C6SYZ8_SOYBN          --------------------------MVSGSG------------------------ICAK
F4JD96_ARATH          --------------------------MVSGSG------------------------ICAK
A5BL45_VITVI          --------------------------MVSGSG------------------------ICAR
K4CWK0_SOLLC          --------------------------MVSGSG------------------------ISAK
A9PHS9_POPTR          --------------------------MVSGSG------------------------ICVK
A9P8J0_POPTR          --------------------------MVSGSG------------------------VCAK
A9SHV1_PHYPA          --------------------------MVSGSG------------------------ICAK
A8IVU0_CHLRE          ---------------------------------------------------------MPK
B7FSS8_PHATC          -------------------------------M------------------------VLSG
B8C0R3_THAPS          -------------------------------M------------------------VLEK
H3G8D4_PHYRM          -------------------------------M------------------------VFEK
B9PT75_TOXGV          VQAEGSQGVFALDLFVVAKKPRHSCVSSFSDAWNVAAQEREFTFSKDFCTRRVSKMTFKK
A5K762_PLAVS          --------------------------------------------------------MYKK
A0CIE1_PARTE          --------------------------------------------------------MFEK
Q245E7_TETTS          LMWGKQRDSFNQENNKPKDTFIQDQQLIKEINKVKKIKLREGQKINQINKQKQQRKMFDK
C4M3F3_ENTHI          ------------------------------------------------------MSTNNK
A2DGT9_TRIVA          ---------------------------------------------------------MSA
Q585J5_TRYB2          -------------------MVLPSRRSLNRSSRKG------------------FKKHRPD
A4H7Z1_LEIBR          -------------------MALPSRKNVSRVQRKK------------------AKKHRPE
A0RXP5_CENSY          ------------------------------------------------------------
A9A5C3_NITMS          ------------------------------------------------MASQETVVRTDR
Q8SS16_ENCCU          -------------------------------------------------------MEKKE
                                                                                  

RM13_BOVIN            WYLLDGKM--------------------------QPPGKLAALASVRLQGLHKPVYHQL-
RM13_HUMAN            WYLLDGKM--------------------------QPPGKLAAMASIRLQGLHKPVYHAL-
RM13_MOUSE            WYLLDGKM--------------------------QPPGKLAVIASNKLQGLNKPVYHQL-
A0A2H2I6R0_CAEJA      WHVIDANQ--------------------------QDAELLGDKVARYLTGKHKPIFHPE-
H3FZQ1_PRIPA          WHLMDANQ--------------------------QDLFKLGEKVAIHLAGRHKPIHHPE-
A0A0R3NSN0_DROPS      WHIYDCTW--------------------------QNPFESAALVKTHLMGLHKPIYHPM-
Q17ET7_AEDAE          WHVYDCTW--------------------------QNPFESASLIRKHLMGLHKPIYHPM-
E0VQP7_PEDHC          WHIYDAKW--------------------------QNPFDSAKLIIKYLTGKYKPIYHPQ-
A0A158NPD5_ATTCE      WHVYDAKW--------------------------QDPYKSAEIIKHYLLGTYKPIYHPL-
A0A088AH49_APIME      WHIFDATW--------------------------QDPFQSAPLIKKYLMGLYKPIYHPL-
B7PBT5_IXOSC          WHLYDARW--------------------------QNPFQSAELIADVLAGKHKPIYHAS-
G4VGE1_SCHMA          WLIYDAFM--------------------------QCPMLSAERIAKYLTGKHIRYYDPS-
B3S1A8_TRIAD          WYLIDAKD--------------------------QKVGRLATFVVKLLQGKTKPIYHPA-
A0A1X7VF42_AMPQE      WYLIDAKD--------------------------QVVGRLAVMVSLILQGKTKPIYHSS-
A7SWD2_NEMVE          WYLIDGRD--------------------------QICGRLAGYIGQILQGKTKPIYHHA-
RL13_THEMA            WYVVDASG--------------------------KVLGRLATRIAKILMGKHKPNYTPH-
RL13_AQUAE            WWVVDATG--------------------------KTLGRLASEIAKILRGKHKPYYQPD-
RL13_DICTD            WYVVDAKG--------------------------KVLGRLASEIAKILRGKHKPIYTPH-
RL13_CHLAA            WYVIDASG--------------------------KVLGRLATQISTLLRGKHKPTFTPS-
RL13_GEOSL            WYLVDADN--------------------------KVLGRMATEIANILRGKKKPIYTPS-
RL13_SALRD            WYVVDATN--------------------------QVVGRLASQIARVLRGKHKPTFTPH-
RL13_CHLTE            WHIIDAEN--------------------------QVLGRMAAQIANVLRGKHKPQFTPH-
D1B6V8_THEAS          WYVVDATD--------------------------KHLGRLASRIALVLSGKHRPTYTPH-
Q7UEY3_RHOBA          WHVVDASD--------------------------EVLGRLASDIAVVLMGKHRPEYTPH-
RL13_VIBCH            WYVVDAEG--------------------------KTLGRLASEIASRLRGKHKAEYTPH-
RL13_ALIF1            WYVVDAEG--------------------------KTLGRIATEIASRLRGKHKAEYTPH-
RL13_SHEON            WFVVDADG--------------------------KTLGRIATEIALRLRGKHKPEYTPH-
RL13_YERPE            WYVVDASG--------------------------KTLGRLATELARRLRGKHKAEYTPH-
RL13_PSEAE            WFVVDAAG--------------------------QTLGRLATEIARRLRGKHKPEYTPH-
RL13_XANCP            WYLVDAAG--------------------------KTLGRLSTELARRLRGKHKPVYTPH-
RL13_BUCAI            WYYVDATN--------------------------KILGRLASALSFHLRGKHKTEYTPH-
Q5NFG3_FRATT          WLLIDATD--------------------------KTLGRLATEVAMILRGKNKPEYTPH-
RL13_NEIG1            WFVIDAQD--------------------------KVLGRVATEVASRLRGKHKPEYTPH-
RL13_BURPS            WYVIDATD--------------------------KVLGRVASEVARRLRGKHKPEFTPH-
RL13_BORPE            WFVIDAKG--------------------------KVLGRVASEVAHRLRGKHKPEFTPH-
RL13_MYCS2            WYVIDASD--------------------------VVLGRLASAAATLLRGKHKPTFTPN-
RL13_MYCTU            WYVIDATD--------------------------VVLGRLAVAAANLLRGKHKPTFAPN-
RL13_CORGL            WYVIDATD--------------------------VVLGRLATHAADLLRGKGKPLYAPN-
RL13_STRCO            WHVIDAQD--------------------------VVLGRLATTAASILRGKHKPIYAPH-
RL13_BIFLO            WYVIDATD--------------------------VVLGRLATQAAILLRGKNKPTYAPH-
RL13_MOOTA            WYVIDAAG--------------------------KTLGRVATEAARLLRGKHKPIFTPH-
RL13_AGRFC            WIIIDAEG--------------------------LVVGRLATIVATRLRGKHKATFTPH-
RL13_RHOS4            WILIDAEG--------------------------VVLGRLATIVANILRGKNKPTFTPH-
RL13_BRADU            WVLIDAKG--------------------------LVVGRLATIVAMRLRGKHLPTYTPH-
RL13_RHORT            WYVIDAEG--------------------------VVLGRLAVIIADLLRGKNKTIYTPH-
RL13_RICPR            WWVIDAKN--------------------------VVLGRLASRVAIMLRGKHKPSFTPH-
Q9A8H7_CAUVC          WIVVDAEN--------------------------AVVGRLASFIAMRLRGKHRPDYTPH-
RL13_BACAN            WYVVDAEG--------------------------QTLGRLASEVASILRGKNKPTFTPH-
RL13_BACSU            WLVVDAAG--------------------------KTLGRLSSEVAAILRGKHKPTYTPH-
RL13_LISMO            WYVIDATG--------------------------VSLGRLSSEVASILRGKNKPQFTPH-
RL13_STAA8            WYVIDAEG--------------------------QTLGRLSSEVASILRGKNKVTYTPH-
Q8CWU5_STRR6          WYVVDATD--------------------------VPLGRLSAVVASVLRGKNKPTFTPH-
Q9CDG6_LACLA          WYVVDATD--------------------------VPLGRLSAVVASVLRGKNKPTYTPH-
RL13_LACPL            WYVVDATD--------------------------VPLGRLSTVVASILRGKNKPTFTPN-
RL13_MESFL            WYIVDAAG--------------------------QNVGRLSTEVARILRGKHKVDFTPH-
RL13_MYCMS            WYIVDAEN--------------------------KTVGRLATQVALVLRGKHKVDFTPH-
RL13_BORBU            WYVIDAAD--------------------------RILGKVAVDVVKILRGKHKAYYTPH-
RL13_CLOAB            WYVIDVAG--------------------------KPLGRAASQIASILRGKNKPIYTPN-
A5I7H1_CLOBH          WYIVDAAD--------------------------KPLGRVASQVASILRGKHKPTYTPH-
RL13_SYNY3            WYVIDAEG--------------------------QRLGRLATEVATILRGKNKPTFTPH-
RL13_THEEB            WYVIDAAD--------------------------QRLGRLAAEIARILRGKNKAIYTPH-
RL13_PROMA            WYLVDAEN--------------------------QTLGRLATEVASVLRGKNKPSFTPH-
Q7ND18_GLOVI          WLVVDAAG--------------------------QHLGRLASVVANLIRGKHRPNFTPH-
M1AA76_SOLTU          WYIVDATD--------------------------KILGRLASTIAIHIRGKNLATYTPS-
K4DCX4_SOLLC          WYIIDASD--------------------------KILGRMASTIAIHMRGKNLATYTPS-
F6H2K9_VITVI          WYIVDATD--------------------------KILGRLASTIAIYIRGKNLATYTPS-
RK13_ARATH            WFVVDATD--------------------------KILGRLASTIANHIRGKNLASYTPS-
M0TW58_MUSAM          WYIVDATD--------------------------KILGRLASTIAIYIRGKNLATYTPS-
Q94J17_ORYSJ          WYVVDATD--------------------------KILGRLASTIAVHIRGKNEATYTPS-
C5XK39_SORBI          WYVVDATD--------------------------KILGRLASTIAVHIRGKNEPTYTPS-
I1MID7_SOYBN          WYVVDATD--------------------------KVLGRLASTIAIHIRGKNLATYTPS-
RL13_CHLTR            WYVVNAEG--------------------------KTLGRLSSEVAKILRGKHKVTFTPH-
A8HWZ6_CHLRE          WYVIDAEG--------------------------QTLGRLASLAALYIRGKHLPTYTPS-
RL13_THET8            WVLIDAEG--------------------------KTLGRLATKIATLLRGKHRPDWTPN-
RL13_DEIRA            WVVVDASG--------------------------VPLGRLATLIASRIRGKHRPDFTPN-
RL13_COXBU            WLLVNAEG--------------------------KTLGRLASRIAAILRGKHKAEFTPH-
RL13_DESVH            WFVVDAED--------------------------KILGRLATQIAHRLRGKHKPEFAPH-
Q8RGG9_FUSNN          WHHYDAEG--------------------------QILGRLAVEIAKKLMGKEKLTFTPH-
RL13_KORVE            WFVVDADG--------------------------QTLGRLASRVARILSGKDNPKYTPF-
B5YGH9_THEYD          WFIFDANG--------------------------QTLGRFASRIAKVLMGKNKPTYTPN-
RL13_MYCPN            WYIVDAAG--------------------------LVLGKLAVKAADLIRGKNKVDFTPN-
Q8F0T2_LEPIN          WFVVDAEG--------------------------KTLGRLASGIAARLRGKHKATFTPN-
A6GWU4_FLAPJ          WIVVDADG--------------------------HNLGRLASKVAMILRGKYKPSYTPH-
Q8A0Z6_BACTN          WVIVDATD--------------------------QTLGRLGAKVAKLLRGKYKPNFTPH-
RL13_HELPY            WVVLDAKD--------------------------KVFGRLITEIAVLLRGKHRPFYTPN-
Q0P8D7_CAMJE          WIVLDAEG--------------------------KRFGRLLTEVATILRGKNKPCFTPN-
RM23_YEAST            WHHVDVAR------------------------DKRTLGRLASAIAITLIGRHKPVYHPS-
Q753Q5_ASHGO          WHHVDVAR------------------------EQRTLGRLASSIAITLMGKHKPVYHPS-
Q5A8Y6_CANAL          WHHVDVAA------------------------DNRSLGRLASSIAITLMGKHKPTYTPN-
Q6C9L9_YARLI          WHFVDVAK------------------------EQRTLGRLATSIAQTLQGKHKPVYNTG-
Q5AQG1_EMENI          WHLVDVGS------------------------DGRSLGRLASSIALILMGKNKPIYDPS-
J3KDA4_COCIM          WHYIDVGS------------------------DPRSLGRVASSIALFLMGKNKPIYDPS-
C0NVE7_AJECG          WHYIDVSR------------------------DPRSLGRLASSIAVFLMGKHKPIWDPS-
D5G6J1_TUBMM          WHLVDMGH------------------------DQRSFGRIATSIATTLMGKHKPTYDPS-
C7Z9I3_NECH7          WHGVSASAPHATLSTQ-------------PGVTPPSLGRLASRIAVLLMGKHKPIFDPS-
A7E481_SCLS1          WHHISASTPHIPLSTLRPRPDASSPASITSRITPPPLGRLASRIALLLMGKHKPIWDPS-
RM23_SCHPO            WHHVSAKN--------------------------VPLGRLASQIATTLMGKHKPIYHPA-
I1CTI6_RHIO9          WHVVDAKQ--------------------------RVLGRLATNVATTLMGKHKPIYDPA-
Q5KM48_CRYNJ          WHHTSAQN--------------------------RVLGTLASRIAWVLMGKHKPTYDPA-
E3L423_PUCGT          WRQVDAKD--------------------------QVLGRLATLIAHNLMGKHKPIFDPR-
F4P5H6_BATDJ          WHLVDAKD--------------------------KILGKLAQRISIALRGKYKPNYHPA-
F6I5K7_VITVI          WRVFDAKG--------------------------QVLGRLASQISTVIQGKDKPTYTPN-
M0RG99_MUSAM          WRVFDAKG--------------------------QVLGRLASQIATVIQGKDKPTYAPH-
M1CI41_SOLTU          WRVFDAKG--------------------------QVLGRLASQISTVIQGKDKPTYAPH-
C6THJ7_SOYBN          WRVFDAKG--------------------------QVLGRLASQIATVVQGKDKPTYTPN-
A9PG49_POPTR          WRVFDAKG--------------------------QVLGRLASQISTVIQGKDKPTYAPY-
Q7XA68_ARATH          WRVFDARG--------------------------QVLGRLASQISTVLQAKDKPTYCPN-
C5XFD0_SORBI          WRVFDAKG--------------------------QVLGRLASQISVVLQGKDKPTYAPH-
I1ITW2_BRADI          WRVFDAKG--------------------------QVLGRLASQIAVVLQGKDKPTYAPH-
Q7EYE3_ORYSJ          WRVFDAKG--------------------------QVLGRLASQIAVVLQGKDKPTYAPH-
D0N078_PHYIT          WHVVDAKG--------------------------QVLGRLASQLAPILRGKHKPTYAPN-
A8J810_CHLRE          FRIIDAKG--------------------------QVVGRLAEQISVILQGKDKPTYNPT-
F0Z620_DICPU          WHVIDAEG--------------------------HHVGKIATKIANLLRGKHKPIFDKSA
A0T0K1_PHATC          WFIIDCKN--------------------------QKLGRLATIIVSLLKGKTKPHYYPS-
A0T0Z5_THAPS          WYVIDCKD--------------------------RQLGRLASTIVPLLTGKSKPIYHPS-
A0A077TH32_PLACH      WFVIDAYN--------------------------KSVGSLSVCISKLLQGKYRVDYNSN-
A5KBY1_PLAVS          WFVIDAYN--------------------------KSVGSLSVCISKLLQGKYRVDHNPN-
O96222_PLAF7          WFVIDATN--------------------------KSVGSLAACISKLLQGKYRVDYNPN-
B9PMD5_TOXGV          WHVLDGKG--------------------------RSVGGLAAQVVRLLQGKHRVDFTPR-
Q4UGV0_THEAN          WHIIDAAN--------------------------KTVGSIASHVSVILQGKHLPTYQPN-
Q580D5_TRYB2          WWLLDARG--------------------------EQLPRVAAVAAQYITGQHRPDFTPG-
A4IAD5_LEIIN          WWLLDARG--------------------------QQLPHVAKIAAQYMTGQHRPDFTPG-
RL13_METAC            MTVIDAKG--------------------------LILGRLASSVAKQLLSGDE-------
RL13_METHJ            VVVIDGDG--------------------------LLLGRLASNVAKRALAGEE-------
RL13_THEKO            MRIINAEG--------------------------LILGRLASKVAKMLLEGEE-------
RL13_ARCFU            FTVIDASG--------------------------HILGRLSSKIAKRLLNGER-------
RL13_THEAC            MRVIDASG--------------------------AIYGRLSAYVAKRLLEGEE-------
RL13_METJA            MTVIDAEG--------------------------AILGRLASEVAKRVLRGEE-------
B1L7A3_KORCO          DLVIDAEN--------------------------KILGRIASLAAKELLKGKR-------
RL13_NANEQ            -LIYDAEG--------------------------LVLGRLASIVARNLKRGYR-------
RL13_METKA            WTVIDAEN--------------------------AVLGRLASVVAKRILKGER-------
RL13_HALSA            DVVVDARD--------------------------CIMGRVASNVAERALAGDR-------
RL13_PYRAE            EVIVDAEG--------------------------HVAGRLATYIAKALLERPNL------
A1RWV8_THEPD          -IVIDGTG--------------------------HIAGRLASVVAKRLLKGD--------
RL13_SACS2            VVIINAEG--------------------------QILGRMASNVVRLLKEGKK-------
A2BK81_HYPBU          VLYVDATD--------------------------QVLGRMAAEVAKKLLEGYR-------
RL13A_CAEEL           AIIIDGKN--------------------------HLLGRLASIVAKKLLQGDK-------
E9HBC4_DAPPU          PIIIDARE--------------------------HLMGRLATIVAKAALNGHK-------
Q5UAS5_BOMMO          AIVIDGRG--------------------------HLLGRLAAVIAKVLLEGNK-------
A0A158NDR5_ATTCE      PILIDGRG--------------------------HLLGRLAAIVAKTILQGNK-------
E0VX11_PEDHC          AIIIDAKG--------------------------HLLGRLASIVAKALLRGEK-------
Q297M7_DROPS          TVVIDGRG--------------------------HLLGRLASVVAKYLLQGGK-------
Q16US7_AEDAE          PILIDGRG--------------------------HLLGRLASVIAKQILNGRK-------
RL16B_YEAST           VVVIDAKD--------------------------HLLGRLASTIAKQVLNGQK-------
RL16A_YEAST           VVVIDGKG--------------------------HLVGRLASVVAKQLLNGQK-------
Q5AB87_CANAL          VVVIDGKG--------------------------HLLGRLASIVSKQILNGQK-------
Q756A0_ASHGO          VI-IDGKG--------------------------HLLGRLASTVAKQLLNGQQ-------
G5EB54_EMENI          VVVIDGKG--------------------------HLLGRLASTVAKQLLNGQK-------
A7EPJ6_SCLS1          VITIDAKG--------------------------HLLGRLASTVAKQLLNGQK-------
Q0U0K4_PHANO          VIVIDGKG--------------------------HLLGRLASTVAKQLLNGQK-------
C7Z299_NECH7          VVVIDGKG--------------------------HLLGRLASIVAKQLLSGQK-------
Q6CCI0_YARLI          VVVIDGKG--------------------------HLLGRLASTVAKQILDGQN-------
D5G9H4_TUBMM          VVVIDGKG--------------------------HLLGRLASAVAKQLLNGQK-------
I1BSI4_RHIO9          VVVIDGKG--------------------------HLLGRLASIIAKQALNGQK-------
RL16A_SCHPO           VVVIDAKG--------------------------HLLGRLASVVAKQLLGGQK-------
RL16C_SCHPO           LVIIDAKG--------------------------HLMGRLASTVAKQLLAGQK-------
B3RYA7_TRIAD          AIIIDGRN--------------------------HLLGRLASTIAKTILSGQR-------
A7SBZ8_NEMVE          QIVIDGAG--------------------------HLLGRLASTVAKSILSGQR-------
A9V9H5_MONBE          QIVIDGRG--------------------------HLLGRLASIVAKQILNGQN-------
F4P0Q4_BATDJ          EIVIDAKG--------------------------HLLGRLASTIAKQLLNGQN-------
E3KWG5_PUCGT          PIVIDGKG--------------------------HLLGRLASIVAKQAISGQK-------
Q5K7I5_CRYNJ          PIVIDGKG--------------------------HLLGRLASVVAKQILTGQK-------
RL13A_BOVIN           VLVLDGRG--------------------------HLLGRLAAIVAKQVLLGRK-------
Q5RK10_RAT            VLVLDGRG--------------------------HLLGRLAAIVAKQVLLGRK-------
Q28HK3_XENTR          VLIIDGRG--------------------------HLLGRLAAIVAKQVLLGRK-------
Q1LYB7_DANRE          VLIIDGRG--------------------------HLLGRLSAIVAKQVLLGHK-------
C3ZL87_BRAFL          VLIIDANN--------------------------HLLGRLAAVVAKSILQGQK-------
W4XS18_STRPU          VLVIDGRG--------------------------HLLGRLASIVAKNLLQGQK-------
B7PR90_IXOSC          PIIIDGQG--------------------------HLLGRLSALIAKTLLHGQR-------
G4VQW2_SCHMA          PIIIDAQG--------------------------HLLGRLASVVAKTLLNGQK-------
RL13A_DICDI           AIVIDGKG--------------------------HLLGRLASVVAKSLLSGQK-------
F0ZPD3_DICPU          QIVIDAKG--------------------------HLLGRLAAKVAKELLSGQS-------
Q7F225_ORYSJ          RVVVDARH--------------------------HMLGRLASLVAKELLNGQR-------
I1H4D4_BRADI          RVVVDARH--------------------------HMLGRLASIVAKELLNGQR-------
C5YZ01_SORBI          RIVVDARH--------------------------HMLGRLSSIIAKELLNGQK-------
C6SYZ8_SOYBN          RVVVDARH--------------------------HMLGRLASIVAKELLNGQK-------
F4JD96_ARATH          RVVVDARH--------------------------HMLGRLASVVAKDLLNGQN-------
A5BL45_VITVI          RVVVDARH--------------------------HMLGRLASILAKELLNGQK-------
K4CWK0_SOLLC          RIVVDARH--------------------------HMLGRLSSILAKELLNGQR-------
A9PHS9_POPTR          RVVVDARH--------------------------HMLGRLASIIAKELLNGQR-------
A9P8J0_POPTR          VVLVDARH--------------------------HMLGRLASIIAKELLNGQK-------
A9SHV1_PHYPA          VVVVDARH--------------------------HMLGRLASILAKELLNGQK-------
A8IVU0_CHLRE          TVVIDGRA--------------------------HMLGRLASVVAKQILAGQQ-------
B7FSS8_PHATC          VKVIDGRD--------------------------HLLGRLCSIVAKELLAGQK-------
B8C0R3_THAPS          PILIDCRD--------------------------HLHGRLCSIVAKELLAGQK-------
H3G8D4_PHYRM          PIIVDCRG--------------------------HLVGRLASLIAKELLQGQH-------
B9PT75_TOXGV          VVVIDCQG--------------------------HLLGRLASVVAKELLKGQQ-------
A5K762_PLAVS          VYVIDCKG--------------------------HLLGRLASIIAKELLNGQR-------
A0CIE1_PARTE          EIVIDGKG--------------------------HLLGRLASYIAKQLQRGQR-------
Q245E7_TETTS          LVVIDAKG--------------------------HLLGRLASYVAKELLSGQR-------
C4M3F3_ENTHI          VTVIDCHG--------------------------HVLGRVASVVAKHLLLGQK-------
A2DGT9_TRIVA          PIVIDAKG--------------------------HIQGRLAAAVAKQLLKGRK-------
Q585J5_TRYB2          IIVIDLKD--------------------------HVLGRAAAIVAKQLLLGKK-------
A4H7Z1_LEIBR          IIVIDLKD--------------------------HVLGRAAAVVAKQLLLGKK-------
A0RXP5_CENSY          --MVDATD--------------------------HIAGRLASNVAKMLLEGNR-------
A9A5C3_NITMS          PIVVDATN--------------------------HIAGRLSSNVAKLLKQGHR-------
Q8SS16_ENCCU          HVIIDATG--------------------------QVAGKLAAKVAKLLLEGVR-------
                          .                                                       

RM13_BOVIN            -SDCGDHVVIMNTRHIAFSGNK------------WEQKVYSSHTGYPGGFKQVTAAQLHR
RM13_HUMAN            -SDCGDHVVIMNTRHIAFSGNK------------WEQKVYSSHTGYPGGFRQVTAAQLHL
RM13_MOUSE            -SDCGDHVVIINTRHIAFSGNK------------WEQKVYSSHTGYPGGFRQVTAAQLHR
A0A2H2I6R0_CAEJA      -TDCGDHVVVTNCKEIAMHAFD------------WKHTIYKFNMEYPKSKADIPAWKIHE
H3FZQ1_PRIPA          -TDCGDHVVVVNCKEIAMHGFD------------WKHTLFHFDKGYPRSKADIPAWQLHE
A0A0R3NSN0_DROPS      -NDCGDHVVLINTKEIALPGDE------------WIKRVYFHHTGYPGGASWTLAWQLHE
Q17ET7_AEDAE          -NDCGDHVVVINTAEIALPGDE------------WKKRVYFHHTGYAGGASWTLAWELHE
E0VQP7_PEDHC          -SK-LILKIVINCKHIALPGDE------------WKRRVYFHHTGYPGGASWTLAYDLHK
A0A158NPD5_ATTCE      -NNCGDHVVVINSKEIALCGDE------------WRKRVYFHHTTYHGGATWTLAWELHH
A0A088AH49_APIME      -NKCGDHVIIINSKDIALRGNE------------WQKRVYFHHTTYIGGASWTLAWELHS
B7PBT5_IXOSC          -NDCGDHVVVINTREIAMPWYE------------WKYRMYYHHTRFAGGASWTSAWELQD
G4VGE1_SCHMA          -ADFGNHVVVINSRHIAAKDNSR--Y--------WKRFLYTIHTRFPVNRVEETMEEIHR
B3S1A8_TRIAD          -ADVGDFVVIVNTQDVVFTGKK------------WNDKLYRHHTGYPGGLKEIKAKDLHA
A0A1X7VF42_AMPQE      -VDTGDYVVIINTRKVVFTGQK------------WNKKLYRHHTGYPGGLKEILSKDVHK
A7SWD2_NEMVE          -EDVGDYVVVINTKHIVLSGTK------------WDNKLYRHHTGYPGGLKEILAKDLHR
RL13_THEMA            -VDTGDYVIVVNADKVVLTGKKL-----------DQKVY-YWHSGYPGGLKSLTARQMLE
RL13_AQUAE            -VDCGDFVIVINAEKIRVTGKKL-----------EQKKY-YWHSRYPGGLKERTLKWMLE
RL13_DICTD            -VDTGDFVIVVNAKDVVLTGKKE-----------DQKIY-FFHSGYPGGHRLITARDMRA
RL13_CHLAA            -IDGGDFVIVVNAEKIVLTGRKP-----------DQKIY-YRHTGYPGGIKATPYKMMLA
RL13_GEOSL            -VDTGDFVVVVNAAKLQLTGNKL-----------ADKMY-YHHTGFPGGIKSITAGKLIE
RL13_SALRD            -VDTGDYVIVVNADKARFTGKKE-----------KQKEY-HEYSGYPGGDHSHSPEEMRA
RL13_CHLTE            -IDTGDFVVVTNAAKVALSGKKR-----------DDKTY-FSHSHYPGGVRIDSVKDLLQ
D1B6V8_THEAS          -VDTGDFVIVINAEKVGLTGKKR-----------EQSMV-HRFSGYSGGLKSIPYGKILE
Q7UEY3_RHOBA          -VDCGDFVIVTNADKIGMTGNKM-----------RDRHY-TWYTGYPG-LRLESYQDRHD
RL13_VIBCH            -VDTGDYIIVVNAEKVTVTGNKA-----------KNKMY-HRHSEFPGGLKSFSFEKLIE
RL13_ALIF1            -VDTGDYIIVINAEKVRVTGKKA-----------SDKIY-YRHSEFPGGLKSISFEKLID
RL13_SHEON            -VDTGDYIIVINAEKVTVTGNKA-----------QGKTY-YSHSGFPGGIKQISFEKLQA
RL13_YERPE            -VDTGDYIIVLNAEKVAVTGNKR-----------TDKIY-YHHTGFVGGIKQATFEEMIA
RL13_PSEAE            -VDTGDYIVVINAEQVRVTGAKT-----------TDKMY-YHHSGFPGGIKSINFEKLIA
RL13_XANCP            -VDTGDYLVVINAEKIVVTGNKL-----------KDKKY-HRFTGYIGNLKTESLEQALQ
RL13_BUCAI            -LDTGDYIIVINASKILVTGNKR-----------INKIY-YHHTGYVGGIKQSRFEEMIS
Q5NFG3_FRATT          -MDTGDYVVIVNAEKVAVTGNKR-----------KAKTY-YHHTGYIGGIKSVSFEKLIA
RL13_NEIG1            -VDTGDYIIVINADKLRVTGAKF-----------EDKKY-FRHSGFPGGIYERTFREMQD
RL13_BURPS            -VDTGDFIIVINASKLKVTGNKT-----------LDKKY-YRHSGYPGGIYETTFGKMQE
RL13_BORPE            -VDTGDYIVIINAADIVVTGNKA-----------QDKKY-FRHTTYPGGIRETNFEKMQQ
RL13_MYCS2            -VDGGDFVIVINADKIAVSGDKL-----------TKKFA-YRHSGYPGGLRKRTIGELLE
RL13_MYCTU            -VDGGDFVIVINADKVAISGDKL-----------QHKMV-YRHSGYPGGLHKRTIGELMQ
RL13_CORGL            -VDCGDHVIVINADKVAVTSNKR-----------EREMR-YRHSGYPGGLKSMTLGRSLD
RL13_STRCO            -VDTGDFVIIINADKVHLSGNKR-----------TQKMA-YRHSGYPGGLRSVRYDELLD
RL13_BIFLO            -ADSGNHVIIINADKIALTGNKM-----------GKEL--YSHSGRPGGLRRDSYAELLE
RL13_MOOTA            -VDTGDYVIIINAAKVRLTGNKL-----------QKKQY-IRHTGYPGGLRVMNYATLLR
RL13_AGRFC            -VDDGDNVIVINAEKVAFTGKKY-----------SDKKY-YWHTGHPGGIKERTARQIIE
RL13_RHOS4            -MDMGDNVIVINADKVQMTGNKR-----------ADKRY-YWHTGHPGGVKFRTAEQVLE
RL13_BRADU            -VDCGDNVIIINAQHAVLTGRKR-----------EQKTY-YKHTGYVGHVKERTARQILE
RL13_RHORT            -IDTGDHVVVINAEKVHLTGNKA-----------ANERF-FWHTGHPGGIKSRSLGQIRD
RL13_RICPR            -LDCGDNIIIINAEHIKLTGKKLNPK--------DGKVY-YRHTGFPGGIKDTTAGKILS
Q9A8H7_CAUVC          -VDCGDFVVVINADKVKFTGKKL-----------DDKVY-YRHTGHPGGIKETTPRKVLG
RL13_BACAN            -VDTGDHVIIINAEKIHLTGNKL-----------NDKIY-YRHTNHPGGLKQRTALEMRT
RL13_BACSU            -VDTGDHVIIINAEKIELTGKKL-----------TDKIY-YRHTQHPGGLKSRTALEMRT
RL13_LISMO            -IDTGDFVIIINAGKIGLTGKKA-----------TDKIY-YRHSQYPGGLKSRTAGEMRT
RL13_STAA8            -VDTGDYVIVINASKIEFTGNKE-----------TDKVY-YRHSNHPGGIKSITAGELRR
Q8CWU5_STRR6          -TDTGDFVIVINAEKVKLTGKKA-----------TDKIY-YTHSNHPGGLKQISAGELRS
Q9CDG6_LACLA          -TDTGDFVIVVNAEKIKLTGKKA-----------TDKVY-YSHSLHPGGLKSVTAGELRE
RL13_LACPL            -VDTGDNVIVINASKVALTGKKA-----------ERKIY-YHHTAYAGGLKERTAGDFLA
RL13_MESFL            -MNNGDHVIIINAEKVLFTGKKE-----------SDKTY-YHHSMHPGGLRRRTVAVQRE
RL13_MYCMS            -INNGDHVIIINAEKAIFSGKKE-----------SNKFY-YHHSMHPGGLKKRSVEVQRE
RL13_BORBU            -QDLGDNVIIINASKVKLTGKKY-----------QQKLY-YRHSRYPGGLYSDTFRTLSE
RL13_CLOAB            -VDTGDYVIVLNAEKVLLTGKKA-----------DQKMF-RHHTLYPGGLKEMSYKDAIA
A5I7H1_CLOBH          -VDTGDNVIVINVEKVVLTGKKL-----------DQKLL-RHHSLYPGGLKEIPYREAIA
RL13_SYNY3            -MDTGDFVIIINAEKIEVTGRKR-----------EQKLY-RRHSGRPGGMKEETFEKLQV
RL13_THEEB            -MDTGDFVIVINAEKVTVTGKKR-----------SQKLY-RRHSGRPGGMKIETFDQLQA
RL13_PROMA            -LDTGDFVIIVNAEKIKVTGKKG-----------MQKLY-RRHSGRPGGMKVETFNSLQE
Q7ND18_GLOVI          -LDTGDFVIVVNAEKVEVTGKKS-----------SQKLY-RRSSGRPGGMKVETFSHLQA
M1AA76_SOLTU          -VDMGAFVIVVNAEKVAVSGKKR-----------NQKLY-RRHSGRPGGMTVETFDQLQQ
K4DCX4_SOLLC          -VDMGAFVIVVNAEKVVVSGKKR-----------SQKLY-RRHSGRPGGMTVETFDQLQQ
F6H2K9_VITVI          -VDMGSFVIVVNAEKVAVSGKKR-----------TQKLY-RRHSGRPGGMKVETFDQLQQ
RK13_ARATH            -VDMGAFVIVVNAEKVAVSGKKR-----------NQKLY-RRHSGRPGGMTVETFDQLQQ
M0TW58_MUSAM          -VDMGAYVIVVNAEKVAVSGKKR-----------TQKLY-RRHSGRPGGMKVETFDQLQQ
Q94J17_ORYSJ          -VDMGAFVVVVNAEKVAVSGKKR-----------SQKLY-RRHSGRPGGMKEETFDQLQK
C5XK39_SORBI          -VDMGAFVIVVNAEKVAVSGKKR-----------SQKLY-RRHSGRPGGMKEETFDQLQK
I1MID7_SOYBN          -VDMGAFVIVVNAEKVAVSGKKR-----------TQKLY-RRHSGRPGGMTVETFAQLQN
RL13_CHLTR            -VAMGDGVIVINAEKVRLTGAKR-----------AQKVY-HYYTGFISGMREVPFENMIA
A8HWZ6_CHLRE          -MDMGAYVIVINADKVTVSGKKP-----------AAKTYFRHVTGRPGSWTIESFNELQA
RL13_THET8            -VAMGDFVVVVNADKIRVTGKKL-----------EQKIY-TRYSGYPGGLKKIPLEKMLA
RL13_DEIRA            -MIQGDFVVVINAAQVALTGKKL-----------DDKVY-TRYTGYQGGLKTETAREALS
RL13_COXBU            -VDAGDFVVVINVDKLKVTGNKT-----------QDKQY-HHHSGYPGGLKTINFADLQA
RL13_DESVH            -MDNGDFIVVVNCEKIKVTGKKL-----------DQKKY-YNHSGYVGGLRETSLEKLLA
Q8RGG9_FUSNN          -IDGGDYVVVTNVEKIVVTGKKL-----------TDKVY-YNHSGFPGGIRARKLGEILA
RL13_KORVE            -IDTGDHVVVINAEKIKITGLKA-----------DNKKY-YHYSGYPGGMKEEEFLKRLE
B5YGH9_THEYD          -VDNGDFVVVINAEKIKVTGKKL-----------TDKIY-YHHTGYMGNLKAETLKERLE
RL13_MYCPN            -QDCGDYLIIINSDQVVLTGNKK-----------ENEFW-YHHSQYIGGIKKVSGRDMLK
Q8F0T2_LEPIN          -QDCGDNIIVINASKVKVTGNKE-----------TQKKY-YHHSRYPGGMTETVFKDLIA
A6GWU4_FLAPJ          -VDCGDNVIVINSEKINLTGNKM-----------DEKTY-IRHTGYPGGQRSLTAKVLQS
Q8A0Z6_BACTN          -VDCGDNVIIINADKVKLTGNKW-----------NDRVY-LSYTGYPGGQREMTPARLIT
RL13_HELPY            -VDCGDFVVVINANKVKFSGM-KLE----------DKEY-FTHSGYFGSTKSKTLQEMLE
Q0P8D7_CAMJE          -VDCGDYVIIINASKAVFTGANKAE----------DKLY-HRHSGYFGSVKSEKFGDLLE
RM23_YEAST            -QDCGDYVVVTNCQKIRVTGKKF-----------EQKTY-WSHSGRPGQLKLQTMNKVVA
Q753Q5_ASHGO          -MDCGDYVVVTNAQDLQVTGKKW-----------EQKTY-WSHSGRPGHLKLRTMETIAT
Q5A8Y6_CANAL          -RDHGDYVVVTNCAHLKVTGNKL-----------KEKTY-WSHTTRPGTLRLVPMERMID
Q6C9L9_YARLI          -HDCGDYVVVVNADKLRFSGSKL-----------QQKEY-FVQSSQPGHSHHVAVKRVIE
Q5AQG1_EMENI          -TDCGDYVVAVGCHDLHTTGKKR-----------FQKKY-YTHTTRPGSLRSMTMDKMFE
J3KDA4_COCIM          -TDCGDYVVAVGCKNIHTTGKKR-----------FQKLY-YSHSTRPGSLKSMSMDKMFE
C0NVE7_AJECG          -TDCGDYVVAVGCHDLHTTGKKR-----------FKKLY-YTHNTRPGSLKSMTMDKMFE
D5G6J1_TUBMM          -TDCGDYVVAVGCAYLKTTGDKR-----------MKKKY-YSHSTRPGHLQEITMDRMMK
C7Z9I3_NECH7          -TDCGDYVVVTNCAALHTTGRKK-----------WQKPY-YRHTTRPGSLKTVTMDVLME
A7E481_SCLS1          -TDCGDYVVVTNCANLHTTGKKM-----------YQKKY-YRHNTRPGSLKEISMEGLME
RM23_SCHPO            -ADCGDVVVVTDCSEIGISGRKL-----------ENHKY-YSHSGQPGHLKEWTMEEMAA
I1CTI6_RHIO9          -ADCGDYVVVINAKDVLVSGKKA-----------EQKLY-RHHTMYPGGLKEINFKDLQA
Q5KM48_CRYNJ          -VDAGDYVIVSDALQVRLTGKKA-----------TDKVY-HHHTGFMGGLKKVPITRLRE
E3L423_PUCGT          -IDVGDYVVVTNARHVQVTGKKE-----------DQKTY-YSHSQYPGALKATPYKQLMD
F4P5H6_BATDJ          -EDMGDYVVVINAKDVALTGKKS-----------TQKEY-MWHSGYPGGQTVLKFDKFIE
F6I5K7_VITVI          -REDGDMCIVLNAKDISVTGRKL-----------TNKFY-RWHTGYIGHLKERSLKDQLA
M0RG99_MUSAM          -QEDGDMCIVLNAKDLSVTGRKM-----------TDKFY-RWHTGYIGHLRERSLKDQLV
M1CI41_SOLTU          -REEGDMCIVLNAKDICVTGRKL-----------TDKFY-RWHTGYIGHLKERSLKDQMA
C6THJ7_SOYBN          -RDDGDMCIVLNAKDICVTGRKL-----------TDKVY-YWHTGYIGHLKQRTLKDQMA
A9PG49_POPTR          -RDDGDMCVVLNAKDVCVTGRKM-----------TDKFY-RWHTGYIGHLKERSLKDQMA
Q7XA68_ARATH          -RDDGDICIVLNAKEIGFTGRKL-----------TDKFY-RWHTGYIGHLKERSLKDQMA
C5XFD0_SORBI          -VENGDMCIVLNAKDISVTGRKM-----------TDKIY-YWHTGYVGHLKERRLKDQME
I1ITW2_BRADI          -VENGDMCIVLNAKDISVTGRKM-----------TDKIY-YWHTGYIGHLKERRLKDQMA
Q7EYE3_ORYSJ          -VENGDMCVVLNAKDISVTGRKM-----------TDKIY-YWHTGYIGHLKERRLKDQME
D0N078_PHYIT          -VDCGDYVVVINAKDIVLTGNKW-----------NNKLY-RWHTGHPGGLKQRTAKEMFD
A8J810_CHLRE          -KEQGDVVIVVNASHVELTHDKW-----------NTKLY-RWHTGYPGGLRSRPAGDQWE
F0Z620_DICPU          VQECGDYVVVLNAKKVEFSGKKW-----------DQKMY-RKHSGYPGGLKETPAKEMNK
A0T0K1_PHATC          -IDIGDYVILLNADSIIINENSK--------------HYIVNKPGKPGSSLKIKNVSDCL
A0T0Z5_THAPS          -VDVGDYVILINTEYLKLDREIE--------------RFHVFEPGRPGSS--LKRLVNVA
A0A077TH32_PLACH      -RVNSSSVIVVNAIHLKFYGHTW-----------DTKIYKFPRKSHSKGHKILTCKTVFA
A5KBY1_PLAVS          -RVNGSSVIVVNAIHVKFYGHTW-----------DTKIYKFPRKSHSKGPKILTCKTVFA
O96222_PLAF7          -KVNSSSVIVVNAIHVKFYGHTW-----------DTKIYKFPRKSHSKSHKILSCKTVFA
B9PMD5_TOXGV          -TAAGDSVIVVNAIHLKMAGHTW-----------DTKVYKFDRKTHPAGPKIITAKTIMA
Q4UGV0_THEAN          -KVTGDNVIIVNAINVVMNGHSW-----------DTKVYKFDRKAHPKGPKIITAKTIMA
Q580D5_TRYB2          -MITGDHVVIVNIKDVVMVGDQW------------IRVPITWQTAYPGGKYRIRLTDMYE
A4IAD5_LEIIN          -MMTGDHVVITNIKDAVMTGDNW------------IRVPITWQTAYPGGKYRVRLSEMYE
RL13_METAC            ------KVYIINAEQAIISG--------------SRAATLREYRET----RERGATEF-G
RL13_METHJ            -------IAVVNAEKAVISG--------------NRARVLGNYKQK----RQRGSREG-G
RL13_THEKO            -------VVIVNAEKAIITG--------------NREDIFAKYKQRT-ELRTRTNPRR-G
RL13_ARCFU            -------IVVVNAEKAVITG--------------DKYMVFERYKEK----YDRGSKEK-G
RL13_THEAC            -------ITIVNASKAVITG--------------NKEFIIEKFKER----LDIGSVRK-G
RL13_METJA            -------IVIVNAEMVVITG--------------NKDWIIKTYQEER-EKKNVANPRRFG
B1L7A3_KORCO          -------VAIVNAEKAIISG--------------NPETILKKYQTRR-SIQSRINPRK-S
RL13_NANEQ            -------VKIVNAEKAIITG--------------DPNMVKKEWLQK----VKRGDYYK-G
RL13_METKA            -------IAVINTEKAIITG--------------KKNTIKEEWLQK----IQRGDPKK-G
RL13_HALSA            -------VAVVNAEQAVITG--------------TEDDVFSTYRTR----ANLGSDRG--
RL13_PYRAE            -----R-IVVVNAEKLVITG--------------DEKMVIEWFKRKISEWRTHYNPEKAG
A1RWV8_THEPD          -----R-VVVVNAEKIVITG--------------KPKRVVEKYLKRWVEWKTYYNPELRG
RL13_SACS2            -------VIIVNGEKAVISG--------------EKNRVIESYKLLL-TVKTLFNPYRNG
A2BK81_HYPBU          -------VYIVNAEKAVISG--------------DPLMVFRGYRIWW-EIKVHVNPYKWG
RL13A_CAEEL           -------VVVLRAEEIVISG--NFH---------RSKLKYMSFLRKR----CNINPARG-
E9HBC4_DAPPU          -------VRVLRAEQMESPE--LFSVHLCCLCHLRNKLKFLSFLRKR----CNVNPARG-
Q5UAS5_BOMMO          -------VVVVRCEQINISG--NFF---------RNKLKLMSFLRKR----CNVNPARG-
A0A158NDR5_ATTCE      -------VIVVRSEQLNISG--NFF---------RNKLKFMSFLRKR----CNVNPARG-
E0VX11_PEDHC          -------VTVLRCEQMHISG--NFF---------RSKLKFLSFLRKR----CNVNPARG-
Q297M7_DROPS          -------VAVVRCEELNLSG--HFY---------RNKIKFLAYLRKR----CNVNPARG-
Q16US7_AEDAE          -------VVVVRCEDLQLSG--HFF---------RNKIKFLAYLRKR----CNVNPARG-
RL16B_YEAST           -------IVVVRAEALNISG--EFF---------RNKLKYHDFLRKA----TAFNKTRG-
RL16A_YEAST           -------IVVVRAEELNISG--EFF---------RNKLKYHDFLRKA----TAFNKTRG-
Q5AB87_CANAL          -------VVVVRCEELNISG--EFF---------RNKLKYHDYLRKA----TRYNKKKG-
Q756A0_ASHGO          -------IVVVRAESLNVSG--ELF---------RNKLKYHDYLRKA----TRFNKTRG-
G5EB54_EMENI          -------IVVVRCEALNISG--EFF---------RAKLKYHAYLRKI----TRYNPTRGG
A7EPJ6_SCLS1          -------IVVVRCEALNISG--EFF---------RAKLKYHAYLRKM----TRYNPTRGG
Q0U0K4_PHANO          -------IVVVRCEALNISG--EFF---------RAKLKYSAFMRKQ----TRYNPTRGG
C7Z299_NECH7          -------IVVVRCEALNISG--EFF---------RAKLKYHAHLRKI----TRYNPTRGG
Q6CCI0_YARLI          -------IVVVRCEALNISQ--EFF---------RSKLKYAAYLRKA----TRFNRTHG-
D5G9H4_TUBMM          -------IVVVRCEDLNISG--EFF---------RSKLKYHAYLRKA----TRYNKTRG-
I1BSI4_RHIO9          -------VVVVRCEELNVSG--EFF---------RNKLKYHAYLNKR----CLVNPTRG-
RL16A_SCHPO           -------VVVVRCEELNISG--HFF---------RNKLKYLAYLRKA----CRYNPSRG-
RL16C_SCHPO           -------VVVVRCEELNISG--HFF---------RNKLKYLAYLRKA----CRYNPSRG-
B3RYA7_TRIAD          -------VVVVRCEELNISG--GFY---------RNKLKYLDFLRKR----CNVNPRRG-
A7SBZ8_NEMVE          -------VVVVRCEKICISG--NFY---------RNKLKYLDFLRKR----TNTKPSHG-
A9V9H5_MONBE          -------VVVVRSELLQISG--SFY---------RNKLKYKEFLRKR----CNVNPARG-
F4P0Q4_BATDJ          -------IVLVRCEEINMSG--PFF---------RNKLKYMAFLRKR----CVVNPRRG-
E3KWG5_PUCGT          -------VVVVRCEEINVSG--SFF---------RLKLRWADHMHKR----HLVNPKKSG
Q5K7I5_CRYNJ          -------VTVVRCEEINISG--SFF---------RNKVKYHNYLHKR----HIVNPRKSG
RL13A_BOVIN           -------VVVVRCEGINISG--NFY---------RNKLKYLAFLRKR----MNTNPSRG-
Q5RK10_RAT            -------VVVVRCEGINISG--NFY---------RNKLKYLAFLRKR----MNTNPSRG-
Q28HK3_XENTR          -------VVVVRCEGINISG--NFY---------RNKLKYLAFLRKR----MNTNPSRG-
Q1LYB7_DANRE          -------IVVVRCEGINISG--NFY---------RNKLKYLAFLRKR----MNTNPSRG-
C3ZL87_BRAFL          -------IVVVRCEGINISG--SFY---------RNKLKYLEFLRKR----TNTKPSRG-
W4XS18_STRPU          -------VVVVRCELINISG--SFY---------RNKLKYMQFMRKR----TNTKPSRG-
B7PR90_IXOSC          -------VVVVRCEGICISG--SFF---------RSKLKYLSFLRKR----CNVNPKRG-
G4VQW2_SCHMA          -------VVVVRCESINISG--SFY---------RNKLKYLDFLRKR----MNTNPSRG-
RL13A_DICDI           -------IVVVRCEELNISG--PLS---------RNKLKWADFLNLT----MNTNHARG-
F0ZPD3_DICPU          -------IVVVRCEELNISG--PLY---------RNKLKWADFLNLT----MNTNHARG-
Q7F225_ORYSJ          -------VVVVRCEEMCISG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
I1H4D4_BRADI          -------VVVVRCEEISVSG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
C5YZ01_SORBI          -------VVVVRCEEICMSG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
C6SYZ8_SOYBN          -------VVVVRCEEICISG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
F4JD96_ARATH          -------IVVVRCEEICLSG--GLV---------RQKMKYMRFLRKR----MNTKPSHG-
A5BL45_VITVI          -------VVVVRCEEICLSG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
K4CWK0_SOLLC          -------VVVVRCEEICLSG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
A9PHS9_POPTR          -------VVVVRCEEICISG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
A9P8J0_POPTR          -------VVVVRCEEICMSG--GLV---------RQKMKYLRFLRKR----MNTKPSHG-
A9SHV1_PHYPA          -------VVVVRSEEICLSG--GLV---------RQKMKYLRFLRKR----MNTKPSKG-
A8IVU0_CHLRE          -------IVVVRAEEITISG--GLV---------RQKMKYDRFLRKR----MNTNPTRG-
B7FSS8_PHATC          -------IVIVRCDEICISG--SLV---------RNRVKYAQFRRLH----MNTNPGRG-
B8C0R3_THAPS          -------IILVRCEEMIISG--SLV---------RNQTKYAQFRQKR----MNTNPGRG-
H3G8D4_PHYRM          -------VVAVRCEQLEISG--SHV---------RNKVKFFQFLNKR----TATNPKKG-
B9PT75_TOXGV          -------IICVRCEDINISG--SLH---------RNRLKYQRFLRLR----MNSNPRRG-
A5K762_PLAVS          -------VVAVRCEDINISG--SLY---------RNKLKYQEFLRLR----TNTNPKKG-
A0CIE1_PARTE          -------IVVVRTELIQQSG--SLF---------RNRVIFEEYLNKR----MAFNPRRG-
Q245E7_TETTS          -------IVVVRTEAINISG--SLF---------RNRVKFSEFLNKW----MNHNPRRG-
C4M3F3_ENTHI          -------FVLVRCEDLQVCG--TLK---------MRLVQWELYQRKR----VNTNPTRG-
A2DGT9_TRIVA          -------IVVVRAEEIVLNG--KHK---------FTVHTYERFLNKT----TNSNPRDG-
Q585J5_TRYB2          -------ITVVRCEKLTIAG--SEI---------RNKIKYLQFLRKR----KLSNPKLG-
A4H7Z1_LEIBR          -------ITVVRCEQLNIAG--TEI---------RNKIKYLQYLRKR----KLTNPTKG-
A0RXP5_CENSY          -------VSIINCEKVMISGKRA-----------SIVREYRDFLKIA----SIIHPEHG-
A9A5C3_NITMS          -------VSIVNCEKIMYSGTRS-----------NLIKEYREFLEIN----SIINPKHG-
Q8SS16_ENCCU          -------VTVVCAEEAVFVGSLE-----------RAMDKFKQYLNKR----CLVNPRRG-
                                                                                  

RM13_BOVIN            K----DPVAIVKLAIYGMLPK--NLHRRTLMQRLHLFPD--EDIPEDILKNLTEELPQPR
RM13_HUMAN            R----DPVAIVKLAIYGMLPK--NLHRRTMMERLHLFPD--EYIPEDILKNLVEELPQPR
RM13_MOUSE            K----DPVAIVKLAIYGMLPK--NLHRRTMMQRLHLFPD--EDIPEDILKNLVEELPQPR
A0A2H2I6R0_CAEJA      Y----DPCRIAFLSIYRSLGN--NILRRRHIQRLHLFPD--SEMPEFVRNNIGSQLRQVQ
H3FZQ1_PRIPA          Y----DPCRVVFLSIYKALGN--NLLRRRHIQRLHLFPD--GEMPDFVEKNIGNVMSPVQ
A0A0R3NSN0_DROPS      K----DPTMVMKKAVYNSMHG--NLQRRHTMQRLHLFSG--DSVPDEILQNVTNQIRTPR
Q17ET7_AEDAE          K----DPTQIMKKAIYRSMHG--NLQRRHTMQRLHLFKD--DNVPQEILENITNQIRQPR
E0VQP7_PEDHC          K----DPTMIMKKAVYSSLDK--NLQRRHTMERLHLYDE--EKVPKEILENVSSQIEQLR
A0A158NPD5_ATTCE      K----DPTLIVEKAVYRALPK--SLLRRHTMQRLHIFPD--EKIPEDMLKNISNQIKQLR
A0A088AH49_APIME      K----DPTLIFKKAIYSAMDG--NLQRRYTMERLHIFPD--ENVPEDMLQNVSNQIKQLR
B7PBT5_IXOSC          K----DPTKVLWKAVYRACPG--DLRRKTKMARLHLFPD--DRLPDEVARNISGQLRQLR
G4VGE1_SCHMA          R----DPTEVIRLETKAVLRN--NESRKYQLSRLHIYPENIETIPKDIIANISGVIPQVM
B3S1A8_TRIAD          K----DPREVLRKAIYGMLAK--NNLRYTFMRRLYLYKD----KKHPYKNNITQELTGPC
A0A1X7VF42_AMPQE      K----DPTKVLYKAINGCLPK--NGMRLKRMNRLYLFPD----EEHPYAKNIYKVLDGPC
A7SWD2_NEMVE          K----DGTRILWRAVNGMLPK--NNLRPTWMKRLYLFED----EHHPYAENIFAKLEAPA
RL13_THEMA            ----KHPERLIWLAVKRMLPK--NRKGRKMLKRLKVYASPE-HPHQAQKPE---------
RL13_AQUAE            ----NKPEEVIRLAVKRMLPK--NRLGHRMLKKLKVYRGPE-HPHQAQKPQ---------
RL13_DICTD            ----KSPEKMIYLAVKGMLPK--GPLGRKMLKKLKIYAGPE-HPHQAQKPK---------
RL13_CHLAA            ----KHPDRILRLAVKRMLPK--NRMGRRLLSKLRIYAGPN-HPHAAQQPK---------
RL13_GEOSL            ----KKPEDLIRKAVKGMLPK--NKLARHMLKKLKVYAGPE-HPHEAQQPK---------
RL13_SALRD            ----DKPTYIIREAVEGMLPT--GPLGRDTFKKLKVYAGPD-HPHEAQQPE---------
RL13_CHLTE            ----KKPEKVIEHAVWGMLPH--NNLGRQLFKKLKVYAGPE-HPHAAQMPV---------
D1B6V8_THEAS          ----RNPERLIERVVKGMLPK--NRLGRAMFRKLKVYAGPS-HPHGAQKPE---------
Q7UEY3_RHOBA          ----RKPEYLLYHAVRRMLPK--NKLARQMLSKLKIYAGPE-HPHTAQQPV---------
RL13_VIBCH            ----RKPEMVLELAVKGMLPK--GPLGRAMYRKLKVYAGAE-HNHAAQQPK---------
RL13_ALIF1            ----RKPEMVIELAVKGMLPR--GPLGRAMYRKLKVYAGAE-HNHTAQQPQ---------
RL13_SHEON            ----HKPEMIIEKAVKGMLPK--GPLGRAMFRKLKVYAGAE-HNHAAQQPQ---------
RL13_YERPE            ----RRPERVIEIAVKGMLPK--GPLGRAMYRKLKVYAGTE-HNHAAQQPQ---------
RL13_PSEAE            ----KAPERVIETAVKGMLPK--NPLGRDMYRKLKVYKGAS-HPHTAQQPQ---------
RL13_XANCP            ----RHPERVIEIAVKGMLPK--GPLGRTMYRKLKVYSGAE-HPHAAQQPQ---------
RL13_BUCAI            ----SHPERVIEIAVKGMLPK--GALGRSMFKKLKVFSNEN-HEHIAQCPQ---------
Q5NFG3_FRATT          ----THPERAIEKAVRGMLPR--TPLGRTMFKKLKVYAGEA-HPHTAQQPK---------
RL13_NEIG1            ----QFPGRALEQAVKGMLPK--GPLGYAMIKKLKVYAGAE-HAHAAQQPK---------
RL13_BURPS            ----RFPGRALEKAVKGMLPK--GPLGYAMIKKLKVYAEAT-HPHSAQQPK---------
RL13_BORPE            ----RFPGRAIQKAVKGMLPK--GPLGYAMIKKLKVYAGAE-HPHTAQQPK---------
RL13_MYCS2            ----KHPTRVVENAIIGMLPH--NKLGRQIQKKLKVYAGPD-HPHAAQQPI---------
RL13_MYCTU            ----RHPDRVVEKAILGMLPK--NRLSRQIQRKLRVYAGPE-HPHSAQQPV---------
RL13_CORGL            ----LHPERTIEDSIVGMMPH--NKLTAASAKKLHVFSGSE-HPYAAQKPE---------
RL13_STRCO            ----KNPEKAVEKAIKGMLPK--NSLGRQMLSKLKVYKGDQ-HPHGAQQPQ---------
RL13_BIFLO            ----KNPERIIKNAVKGMLPK--NRLAKVQLDRLRIFRGAE-HPHTPQKPQ---------
RL13_MOOTA            ----TFPERAVEKAVKGMIPH--NSLGRKMVKKLKVYRGDS-HPHAAQQPQ---------
RL13_AGRFC            G---RFPERVVEKAIERMIPR--GPLGRRQMKNLRVYAGSN-HPHEAQQPT---------
RL13_RHOS4            G---AHPERVVLKAVERMISR--NSLGRQQMTNLRVYAGAE-HPHEAQQPT---------
RL13_BRADU            G---KHPERVLEKAVERMIPR--GPLGRVQMGNLRVYGGAD-HPHEAQQPE---------
RL13_RHORT            G---AHPERLIEKAVERMMPR--GPLARAQFKKLRVYGGEA-HPHDAQQPV---------
RL13_RICPR            G---KYPERVIKMAVKRMITR--NVLGAKQMSNLYVYANCE-HPHMAQQPT---------
Q9A8H7_CAUVC          G---RFPERVLEKAVERMLPKE-SPLARKQLTHLLIYNNGE-HPHQAQNPE---------
RL13_BACAN            ----NYPVQMLELAIKGMLPK--GRLGRQVSKKLNVYAGAE-HPHQAQKPE---------
RL13_BACSU            ----NYPEKMLELAIKGMLPK--GSLGRQMFKKLNVYRGSE-HPHEAQKPE---------
RL13_LISMO            ----NNPEKLLELSIKGMLPK--NSLGRQLFKKLHVYGGSE-HEHAAQQPE---------
RL13_STAA8            ----TNPERLIENSIKGMLPS--TRLGEKQGKKLFVYGGAE-HPHAAQQPE---------
Q8CWU5_STRR6          ----KNAVRLIEKSVKGMLPH--NTLGRAQGMKLKVFVGAE-HTHAAQQPE---------
Q9CDG6_LACLA          ----KNAVRLIEKSVKGMLPH--NTLGRAQGMKLKVFVGAE-HTHTAQKPE---------
RL13_LACPL            ----KEPTKLIETSVKGMLPH--NSLGHKMGLKLHVYAGAE-HTQQAQKPE---------
RL13_MESFL            ----LDATKILERSIRLMLPK--NVQGRNQFRALHVFVGEN-HPYAAQKPE---------
RL13_MYCMS            ----LDATKILERAIRLMLPK--NVQGSNQYRALHVFKGSN-HPFAAQKPE---------
RL13_BORBU            ----RKPCAPLEIAIKGMLPK--GPLGRNLFRNLKVFSGSE-HTLKAQNPI---------
RL13_CLOAB            ----KKADFVFYEAVRRMLPS--GVLGRKMIKKLKVYKGEE-HNNEAQKPE---------
A5I7H1_CLOBH          ----KKPEFVFEEAVRRMLPS--GVLGRKMLKKLKVYKGAE-HNQEAQKPE---------
RL13_SYNY3            ----RLPERIVESAVRGMLPK--NSLGRKLFTKLKVYAGPS-HPHAAQQPE---------
RL13_THEEB            ----RIPERIIEHAVKGMLPK--NSLGRKLFTKLKVYAGPE-HPHQAQKPQ---------
RL13_PROMA            ----RIPERIVEKAIKGMLPH--NALGRQLFRKLKVYKGSE-HPHSAQNPQ---------
Q7ND18_GLOVI          ----RLPERIVEKAIWGMLPH--TRLGRQQFTKLKVYKGPA-HPHAAQKPE---------
M1AA76_SOLTU          ----RIPERILEHAVRGMLPK--GRLGRQLFNHLKVYEGPD-HPHDAQKPI---------
K4DCX4_SOLLC          ----RIPERIIEHAVRGMLPK--GRLGRQLFTHLKVYKGPE-HPHEAQKPV---------
F6H2K9_VITVI          ----RIPERIVEHAVRGMLPK--GRLGRALFNHLKVYKGPH-HPHEAQKPI---------
RK13_ARATH            ----RIPERIVEHAVRGMLPK--GRLGRALFNHLKVYKGPD-HPHEAQKPL---------
M0TW58_MUSAM          ----RIPERIIEHAVRGMLPK--GRLGRTLFTHLKVYKGPD-HPHEAQMAI---------
Q94J17_ORYSJ          ----RIPERIIEHAVRGMLPK--GRLGRRLFTHLKVYKGAE-HPHEAQKPV---------
C5XK39_SORBI          ----RIPERIVEHAVRGMLPK--GRLGRRLFTHLKVYKGAE-HPHEAQKPV---------
I1MID7_SOYBN          ----RIPERIIEHAVRGMLPK--GRLGRRLFTHLKVYKGPD-HPHAAQKPV---------
RL13_CHLTR            ----RKPAYVIEHAVKGMLPK--TKLGRRQMKSLRVLKGSS-YAQYE-------------
A8HWZ6_CHLRE          ----RLPERIIERAVKGMLPK--GALGRDIKLHLKVYKGTK-HDHEAQQPQDITK-----
RL13_THET8            ----THPERVLEHAVKGMLPK--GPLGRRLFKRLKVYAGPD-HPHQAQRP----------
RL13_DEIRA            ----KHPERVIEHAVFGMLPK--GRQGRAMHTRLKVYAGET-HPHSAQKPQ-VLK-----
RL13_COXBU            ----KKPQRILELAIKGMLPK--GPLGRQLYRKLKIYAGDQ-HPHQAQQP----------
RL13_DESVH            ----SKPEEVLLKAVRGMLPR--NRLGRAMLTKLKVYRGTE-HPHAAQKPT---------
Q8RGG9_FUSNN          ----KKPEELLMLAVKRMLPK--NKLGRQQLTRLRVFAGAE-HSHVAQKPN---------
RL13_KORVE            ----RRPELILETAIKGMLPK--SKLGKAMGGKLKVYRGAD-HPHIAQKPE---------
B5YGH9_THEYD          ----KEPEEVIVDAVWGMLPK--TRLGRKMIKKLKVYRGSE-HPHIAQKPE---------
RL13_MYCPN            K----QSDKLVYNAVKGMLPD--NRLSRRWITKVHVFKGDK-HNMEAQKPT---------
Q8F0T2_LEPIN          K----QPEKVIYEAVKGMLPK--SKLGDKMLTHCKIFSGAE-HNLQAQKPV---------
A6GWU4_FLAPJ          K----NPALLVEKAVKGMLPK--NKLGAELFRNLNVVVGSE-HKQGAQKPK---------
Q8A0Z6_BACTN          K--PNGEERLLKKVVKGMLPK--NILGAKLLGNLYVYAGSE-HKHEAQSPK---------
RL13_HELPY            ----KAPEKLYHLAVRGMLPK--TKLGKAMIKKLKVYRDDK-HPHTAQTSKK--------
Q0P8D7_CAMJE          ----KNPAKLYKLAVRGMLPK--TNLGRAMLKKLKIYAGSE-HPHTAQIAK---------
RM23_YEAST            DK---GFGEILKKAVSGMLPK--NKLRKQRLDRLKVFDGSE-NPYKQNITAFAH------
Q753Q5_ASHGO          NK---GHSELLRKAVSGMLPK--NRLRKVRLARLKVFDGSE-HPYKQNIVAFAD------
Q5A8Y6_CANAL          NK---GYGEIIKRAVKGMIPK--NKHRLVRMDRLKLFDGDD-HPYKDNLIAFAD------
Q6C9L9_YARLI          NQ---GVSEVLRRTVAGMLPR--NKLKRGRIARLKVFEGTE-HPYKQNLVAYHD------
Q5AQG1_EMENI          KW---GGGEVLRRAVRGMLPK--NRLRDKRLARLKTFEGVD-HPYKDNIVRIGAPSNIG-
J3KDA4_COCIM          KW---GGAEVLKRAVRGMLPK--NKLREKRMARLKAFEGHA-HPYKANIVQFGGKSVLG-
C0NVE7_AJECG          KW---GGGEVLRKAVSGMLPK--NRLRDKRLARLKVFEGHA-HPYKKNILKLAGKSVLGP
D5G6J1_TUBMM          KF---GGAEVLRRAVSGMLPK--NRLREVRLGRLRAFEGFG-HPYKENLVRLGGKHYVKP
C7Z9I3_NECH7          QH---GGSEVLRKAVRGMLPK--NRLRDKRLARLKAFEGEA-HPYKQNLIRFSGVQVGKQ
A7E481_SCLS1          KL---GGAEVLRKAVSGMLPK--NRLRDGRLGRLKAFEGEA-HPYKLNLVRFEGRRRDLM
RM23_SCHPO            KR---GHKDLLRRAVGGMLPR--NKLWDRRMKRLYIYDGAE-HPYKANIFRSYHN-----
I1CTI6_RHIO9          K----DSTEPIRKAISGMLPK--NRLRQVRLDRLKIFEGSE-HPYEANIIKQHG------
Q5KM48_CRYNJ          R----RPEEIIRKAVSGMLPK--NTFRDRRLERLKIFPGAAPETYKGNVLTTWR------
E3L423_PUCGT          Q----NPTMILRKAVSGMLPK--NKLRDRRLERLHIFPDEE-HPYHGNLYKDYTRIPVTQ
F4P5H6_BATDJ          R----HPTEPLKKAVWGMMPK--GNLRKEQIHRLKLFAGSD-HPYASNIVKSYIPEPVVA
F6I5K7_VITVI          K----DPTEVIRKAVLRMLPR--NKLRDDRDRKLRIFAGDE-HPFNDRPLEPYVMPPRQV
M0RG99_MUSAM          K----DPTEVVRKAVLRMLPR--NKLRDDRDRKLRIFAGSE-HPFVDRPLEPYVMPPRKV
M1CI41_SOLTU          K----DPTEVIRKAVLRMLPR--NKLRDDRDRKLRIFTNDE-HPFADRPLESYVMPPRQV
C6THJ7_SOYBN          K----DPTEVIRKAVLRMLPR--NKLRDDRDRKLRIFPGSE-HPFVDRPLEPYVMPPRSV
A9PG49_POPTR          K----DPTEVIRKAVLRMLPR--NKLRDDRDRKLRIFPDSE-HPFGDQPVEAYVMPPRKV
Q7XA68_ARATH          K----DPTEVIRKAVWRMLPS--NNLRDDRDRKLRIFEGGE-HPFGDKPLEPFVMPPRRV
C5XFD0_SORBI          K----DPTEVIRKAVLRMLPR--NRLRDDRDRKLRIFSGNE-HPFHDRALEPFVMPPRQV
I1ITW2_BRADI          K----DPTEVIRKAVMRMLPR--NRLRDDRDRKLRIFSEGE-HPFHDRPLEPFVMPPRQV
Q7EYE3_ORYSJ          K----DPTEVIRKAVMRMLPR--NRLRDDRDRKLRIFSGSE-HPFHDRPLEPFAMPPRQV
D0N078_PHYIT          R----KPEEVLRKAVYGMLPR--NRMRALQDKKLKIFMGDE-HDFVAEVGENPIIH----
A8J810_CHLRE          K----DPRMLLRNAVSGMLPK--NKSREARMEKLKIFPEAD-HPFQGFPLVPYVPPPRRL
F0Z620_DICPU          K----DPAHIIRHAVMGMIPK--NDSKYYLAQRLKIYPDFH-NPHQSQISNIPVSPLTQN
A0T0K1_PHATC          ------PKFTIERAVKGMLSET--ETKRLM-RRLNIYSESS-HPHQAQKPI---------
A0T0Z5_THAPS          ------PKRIIESCVFNMLPNG-FPKKHLV-KRLKVYQGTE-HPHVAQAPQ---------
A0A077TH32_PLACH      R----NPSMILNLAVKRMLPN--NRLRQIYYRKLFVYPGAL-HPHWGIPQVVVPKK----
A5KBY1_PLAVS          R----NPSMVLNLAVKRMLPN--NRLRQLYYRKLFVYPGAI-HPHWGIPQVIVPKR----
O96222_PLAF7          R----NPSMILNLAVKRMLPN--NRLRQIFYRKLYVYPGAL-HPHWGIPQVVVPKK----
B9PMD5_TOXGV          R----NPAMILNLAVKRMLPP--NRLRPIMYRKLFVYAGAL-HPHWQVPQVIVPAKTPAE
Q4UGV0_THEAN          N----NPGMILNLAIKRMLPR--NKLRPFWYRRLFIYGGAI-HPHWGIPQVVVSAPSHTK
Q580D5_TRYB2          RDPCMLMWWFLKDEVNRHFVRK-LKTRIAPLEKAWLYEDSI-HPHADKNPR---------
A4IAD5_LEIIN          RDPCMVMWWYLKDEVNRHFVRK-LKTRTAPLEKAWLYEDSV-HPHAEKNPR---------
RL13_METAC            PYFPKRPDRILKRTIRGMLPY-KRARGRDAMSRLKVYVGVP-YELKG-------------
RL13_METHJ            PFFPRRPDHILKRTIRGMIPY-KRERGIEAMKRIRIYVGVP-DELSG-------------
RL13_THEKO            PFYPKRSDEIVRRTVRGMLPW-KTDRGRKAFKRLKVYVGVP-KEFEG-------------
RL13_ARCFU            PYFPRHPERIFKRTVRGMLPW-KSSRGRDAYRRLRVFMGVP-EELQG-------------
RL13_THEAC            PYYPKTPENILRRSIGDMLPK-KITKGKEALARCRVYRNTP-PDIEK-------------
RL13_METJA            PKFPRRPDDILRRTIRKMLPY-KKPKGREAFKRVKVYVGNP-KNLTV-------------
B1L7A3_KORCO          PVQPRTPDRIVWRTVRGMLPM-KKAKGREALRRLRVFIGVP-EELAN-------------
RL13_NANEQ            PFYPKRPDNILKRVIRGMLPR-KTARGRELLKNVKVYIGVP-EELKDKPKLGLNLENAKG
RL13_METKA            PFYPRRPDLIFRRVVRGMLPW-KTKRGREAFKRLRAYIGTP-RWVE--------------
RL13_HALSA            PYYPKRPDGIFKRAIRGMLPY-KQDDGREALDSVRVYVGNP-MDEDG-------------
RL13_PYRAE            PKVPRRPDRVFKRIVRGMLPK-KSETGRSALKRLRVYMSIP-IEIMQRKRLV--------
A1RWV8_THEPD          PKYPKTPDRLFKRMVRGMLPM-EKTIGRDSLKRLTVYVGLP-DEYRNAK-----------
RL13_SACS2            IRRPRSPINIVKRTIRGMLPK-S-SKGRRMLKNVKIYVGVP-KEFEG-------------
A2BK81_HYPBU          PHRPRSPIAIVKKAVYGMLPK-NKQKGREAMRRLKVYIGVP-EELKN-------------
RL13A_CAEEL           AFHYRAPGKIFWRTVRGMLPH-KTNRGNEALKNLRAYEGVP-AKYQKTK-----------
E9HBC4_DAPPU          PFHHRAPSKIFKRAVRGMLPY-KTFRGREALKRVRAFEGVP-PRYMRVK-----------
Q5UAS5_BOMMO          PFHFRAPSKILWKTVRGMIPH-KTERGKNALRRLRTYDGCP-PPFDNRR-----------
A0A158NDR5_ATTCE      PFHFRAPSKIFWKTVRGMIPH-KTQRGKDALRRLKVYEGCP-PPYDRRK-----------
E0VX11_PEDHC          PFHFRAPSRIFFRTVRGMLPH-KTYRGENALHHLKAYEGIP-PAFTKRR-----------
Q297M7_DROPS          PFHFRAPSRIFYKAVRGMIPH-KTKRGQAALARLRVFDGIP-SPYDKRR-----------
Q16US7_AEDAE          PFHFRAPSRMLWKAVRGMVPH-KTKRGHNALKRLKVYEGIP-SPFDRQK-----------
RL16B_YEAST           PFHFRAPSRILYKAIRGMVSH-KTARGKAALERLKIFEGIP-PPYDKKK-----------
RL16A_YEAST           PFHFRAPSRIFYKALRGMVSH-KTARGKAALERLKVFEGIP-PPYDKKK-----------
Q5AB87_CANAL          PFHFRAPSRILYKAIRGMIPH-KTARGKAALERLKVFEGVP-PPYDKKK-----------
Q756A0_ASHGO          PFHFRAPSRIFYKAVRGMVAH-KTARGKAAMERLKVFEGVP-PPYDKLK-----------
G5EB54_EMENI          PFHFRAPSRIFYKAVRGMIPH-KTARGAAALERLKVFEGVP-PPYDKKK-----------
A7EPJ6_SCLS1          PFHFRAPSRIFYKTVRGMIPH-KTARGAAAMERLKVFEGVP-QPYDKVK-----------
Q0U0K4_PHANO          PFHFRAPSKMFWRTVRGMIPH-KTARGNAAMERLKTFEGIP-PPYDKKK-----------
C7Z299_NECH7          PFHFRAPSRIFYKAVRGMIPH-KTARGAAALERLKVFEGVP-PPYDKKK-----------
Q6CCI0_YARLI          PFHFRAPSRIFYKAVRGMIPH-KTARGKAALERLKVFEGIP-PPYDKKK-----------
D5G9H4_TUBMM          PFHFRAPSRIFYKTVRGMVSH-KTARGQAALERLKVFEGIP-PPYDTKK-----------
I1BSI4_RHIO9          PFHFRAPSRILYKAIRGMVPH-KTARGAAALDRIKLFEGVP-APYDRVK-----------
RL16A_SCHPO           AFHFRAPSRIFQKAVRGMLPH-KTARGQAALEHLQAVEGIP-PPFDKQK-----------
RL16C_SCHPO           AFHFRAPSRIFTKAVRGMLPH-KTTRGNIALKNLQALEGIP-PPFDKQK-----------
B3RYA7_TRIAD          PFHFRAPSRILWRTVRGMVPH-KTKRGEEALNRLKTFEGIP-APYDKMK-----------
A7SBZ8_NEMVE          PFHFRAPSRIFWRTVRGMIPH-KTKKGTEAMNRMKVFDGVP-PPYDKEK-----------
A9V9H5_MONBE          PFHFRAPSRIFWRVVRGMVPH-KTPRGAEALKRLKVFEGVP-SPYDKIK-----------
F4P0Q4_BATDJ          PFHFRAPSRIFYRTVRGMIPH-KTPRGAAALERLKVFEGVP-PVYNLKK-----------
E3KWG5_PUCGT          PFHHRAPSRILYKAIRGMIPH-KTARGAAALQRLKLFEGMP-PPYDRKK-----------
Q5K7I5_CRYNJ          PFHFRAPSRILYKAIRGMIPH-KSSRGAAALKRLELYEGVP-PAQDRVK-----------
RL13A_BOVIN           PYHFRAPSRIFWRTVRGMLPH-KTKRGQAALERLKVFDGIP-PPYDKKK-----------
Q5RK10_RAT            PYHFRAPSRIFWRTVRGMLPH-KTKRGQAALERLKVLDGIP-PPYDKKK-----------
Q28HK3_XENTR          PYHFRAPSRIFWRTVRGMLPH-KTKRGQAALERLKVFDGIP-PPYDKRK-----------
Q1LYB7_DANRE          PYHFRAPSRIFWRTVRGMLPH-KTKRGQAALDRLKVFDGIP-PPYDKRK-----------
C3ZL87_BRAFL          PFHLRAPSRIFWRTVRGMLPH-KTTRGAQALERLKVFEGIP-PPYDKQK-----------
W4XS18_STRPU          PYHLRSPSRMFWRVIRGMLPH-KRTRGKDALERLKVFEGCP-APYDRKK-----------
B7PR90_IXOSC          PYHFRAPSKILWRTVRGMVPH-KTKRGALALDRLKMFEGVP-PPYDRKK-----------
G4VQW2_SCHMA          PYHFRAPAKIFWRTVRGMLPH-KLHRGKQALDKLKVFEGIP-PPYDKKK-----------
RL13A_DICDI           HRHGRSPSKIFWRAVRGMLPH-KTPRGQAALDNMKVFEGVP-APYDKVK-----------
F0ZPD3_DICPU          HRHARSPSKIFWRAVRGMLPH-KTARGQAALDNMKVFEGVP-TPYDKVK-----------
Q7F225_ORYSJ          PIHFRAPSRIFWRTVRGMIPH-KTPRGEAALANLKAFDGVP-PPYDRTK-----------
I1H4D4_BRADI          PIHFRAPSRIFWRTVRGMIPH-KTPRGEAALARLKAYEGVP-PPFDRTK-----------
C5YZ01_SORBI          PIHFRAPSKILWRTIRGMIPH-KTKRGEAALARLKTYEGVP-PPYDKTK-----------
C6SYZ8_SOYBN          PIHFRAPSKIFWRTVRGMIPH-KTKRGEAALARLKVYEGIP-PPYDKTK-----------
F4JD96_ARATH          PIHFRAPSKIFWRTVRGMIPH-KTKRGANALARLKVFEGVP-TPYDKIK-----------
A5BL45_VITVI          PIHFRAPSKILWRTIRGMIPH-KTKRGAAALARLKAYEGIP-PPYDKMK-----------
K4CWK0_SOLLC          PIHFRAPSKILWRTIRGMIPH-KTKRGAAALARLKVYEGVP-PPYDKIK-----------
A9PHS9_POPTR          PIHFRAPSKILWRTIRGMIPH-KTKRGEAALARLKVFEGVP-PPYDKTK-----------
A9P8J0_POPTR          PIHFRAPAKIFWRTVRGMIPH-KTKKGEAALARLKAYEGIP-PPYDKKK-----------
A9SHV1_PHYPA          PIHFRSPARILWRTIRGMIPH-KTKRGAAALERLKAFEGVP-APYDKMK-----------
A8IVU0_CHLRE          PFHFRAPSRIFWRTVRGMIPH-KTARGAAALERLKAFEGIP-HPYDKVK-----------
B7FSS8_PHATC          PFHFKSPAMMVWRTVRGMVHQ-KSPRGQEALKRLSTFEGIP-APYDKQK-----------
B8C0R3_THAPS          PFHFKSPARLVWRTIRGMVHQ-KTARGQAAIGRLSTFEGIP-HPYDKMK-----------
H3G8D4_PHYRM          PIHYRAPSRMLWRTIRGMLPH-KTARGAAALQRLKVFDGIP-SPYDKQK-----------
B9PT75_TOXGV          PYHLRAPSRILWRTIRGMLRH-KVERGQKALARLQVFEGVP-TMVERKK-----------
A5K762_PLAVS          PLHLREPSKILWRCVRGMLPH-KTYKGKIALKKLKVFVGMP-YPYDKKK-----------
A0CIE1_PARTE          YKHYRTPSRCFWKVVRGMLQY-KSKRGAAALERLKVFEGVP-PPYDTRK-----------
Q245E7_TETTS          VQHFRAPSRIFWRAVRGMLPH-KTPKGAAALERLKIFEGIP-TPYDRVK-----------
C4M3F3_ENTHI          AFHHRSPADMVRKAVRGMLPK-NNYRGKLALKNLKCFEGCP-APYDKMK-----------
A2DGT9_TRIVA          PFHQRAPREIFARAVRGMLPY-KTHRGAEAFENLKVFEGVP-AKYVTYK-----------
Q585J5_TRYB2          PFHHRSPSDVFIRTVRSMLPR-YTKRGQRALRQLVAYEGVP-VNVVRTGG----------
A4H7Z1_LEIBR          PFHHRAPSDVFVRAVRSMLPR-YTKRGMRALNSLVAYEGVP-ANVVRTGG----------
A0RXP5_CENSY          PYHPRRPDTIMTRMIRGMLPR-KKPSGKAAHSRLRAYIGSP-GHLKSFE-----------
A9A5C3_NITMS          PVHYRRPDTIITKMIRQMLPYDRKPSGKESIKRLRAYIGSP-KELKSLE-----------
Q8SS16_ENCCU          PFHFREPRMHLAKIIRRMISY-KKPRGKAAMSRLATYEGIP-RELEGQP-----------
                                                                                  

RM13_BOVIN            K--------------------------VPRRLDEYTQEEIEAFPRVWSPPEDYRL-----
RM13_HUMAN            K--------------------------IPKRLDEYTQEEIDAFPRLWTPPEDYRL-----
RM13_MOUSE            R--------------------------VPKRLDEYTQEEIEAFPRVWTPPDDFRM-----
A0A2H2I6R0_CAEJA      E--------------------------VVKRSDEYTAEERAAFPRVVKFAENHVVDWEKS
H3FZQ1_PRIPA          L--------------------------LVRRSDEYTAQERAAFPRLVQHRPDHVIDWERP
A0A0R3NSN0_DROPS      T--------------------------VPQRLDHIDKETLENFPTIMDYPKDYILR----
Q17ET7_AEDAE          R--------------------------VPERLDQMDPDLVKNFPKIMDYPKDYVLR----
E0VQP7_PEDHC          I--------------------------VPRKLKSYSEKEIEEFPKLANYSTDYVRK----
A0A158NPD5_ATTCE      T--------------------------VPVQLNHIPRTEVDNFPQLLKYPKNYILK----
A0A088AH49_APIME      P--------------------------VPVKLCDISQEERDKIPRLIKYPIDYQLK----
B7PBT5_IXOSC          P--------------------------VPRKLAELSDQERHSFPKLFDYPEDYIVT----
G4VGE1_SCHMA          K--------------------------VPKRLEDYSTEELNEFPKLFDWPEDYHVAPLSP
B3S1A8_TRIAD          K--------------------------PAKKLQDYTPAEIENYP-YKNLF----------
A0A1X7VF42_AMPQE      Q--------------------------PFKKLEDFTIEEIESFPNLRNDFKFKQ------
A7SWD2_NEMVE          S--------------------------IPKRLHEYSPEEISNYP---KLF----------
RL13_THEMA            ----------------------------PIEL----------------------------
RL13_AQUAE            ----------------------------PLEVKA--------------------------
RL13_DICTD            ----------------------------ELNI----------------------------
RL13_CHLAA            ----------------------------PYIPRW--------------------------
RL13_GEOSL            ----------------------------TLDI----------------------------
RL13_SALRD            ----------------------------PLDNA---------------------------
RL13_CHLTE            ----------------------------EMKINQ--------------------------
D1B6V8_THEAS          ----------------------------TLEL----------------------------
Q7UEY3_RHOBA          ----------------------------ELVRTSKKASA---------------------
RL13_VIBCH            ----------------------------VLDI----------------------------
RL13_ALIF1            ----------------------------VLDI----------------------------
RL13_SHEON            ----------------------------VLDI----------------------------
RL13_YERPE            ----------------------------VLDI----------------------------
RL13_PSEAE            ----------------------------ELKI----------------------------
RL13_XANCP            ----------------------------VLDI----------------------------
RL13_BUCAI            ----------------------------LLNI----------------------------
Q5NFG3_FRATT          ----------------------------AHNI----------------------------
RL13_NEIG1            ----------------------------VLELK---------------------------
RL13_BURPS            ----------------------------ALEI----------------------------
RL13_BORPE            ----------------------------PLEF----------------------------
RL13_MYCS2            ----------------------------PFEIKQVAQ-----------------------
RL13_MYCTU            ----------------------------PYELKQVAQ-----------------------
RL13_CORGL            ----------------------------AYEIKKVAQ-----------------------
RL13_STRCO            ----------------------------PFEITQVAQ-----------------------
RL13_BIFLO            ----------------------------VFEIAQVSQQAK--------------------
RL13_MOOTA            ----------------------------VWEIKD--------------------------
RL13_AGRFC            ----------------------------VLDVAALNKKNVRSA-----------------
RL13_RHOS4            ----------------------------VLDVKSLNPKNTRSA-----------------
RL13_BRADU            ----------------------------KIDIAKLNRKNTRAA-----------------
RL13_RHORT            ----------------------------VLDVAALNPKNKRSA-----------------
RL13_RICPR            ----------------------------IYDFASENPKNKK-------------------
Q9A8H7_CAUVC          ----------------------------VVDFAGRNAKNIRSL-----------------
RL13_BACAN            ----------------------------VYELRG--------------------------
RL13_BACSU            ----------------------------VYELRG--------------------------
RL13_LISMO            ----------------------------VYELRG--------------------------
RL13_STAA8            ----------------------------NYELRG--------------------------
Q8CWU5_STRR6          ----------------------------VLDISGLI------------------------
Q9CDG6_LACLA          ----------------------------VLDITGLI------------------------
RL13_LACPL            ----------------------------VLDITNLI------------------------
RL13_MESFL            ----------------------------VLTFVKK-GDNK--------------------
RL13_MYCMS            ----------------------------VLEISTKKGDVK--------------------
RL13_BORBU            ----------------------------KL------------------------------
RL13_CLOAB            ----------------------------VLELKY--------------------------
A5I7H1_CLOBH          ----------------------------VLELRY--------------------------
RL13_SYNY3            ----------------------------TLVINTI-----PAGAN---------------
RL13_THEEB            ----------------------------PLTINTI-----PGA-----------------
RL13_PROMA            ----------------------------VLSITTN-----ELVK----------------
Q7ND18_GLOVI          ----------------------------VFDLSTV-----LGGHS---------------
M1AA76_SOLTU          ----------------------------ELPIRDK-----RIQKQR--------------
K4DCX4_SOLLC          ----------------------------ELPIRDK-----RIQKQR--------------
F6H2K9_VITVI          ----------------------------DLPIRDK-----RIQKER--------------
RK13_ARATH            ----------------------------DLPIRDK-----RIQLQK--------------
M0TW58_MUSAM          ----------------------------PLPIHDK-----RIQSDK--------------
Q94J17_ORYSJ          ----------------------------PLPIKDK-----RIQKSEK-------------
C5XK39_SORBI          ----------------------------PLPIRDK-----RIQKTG--------------
I1MID7_SOYBN          ----------------------------ELPIRDK-----RIHLQK--------------
RL13_CHLTR            ------------------------------AIKP------IVLDA---------------
A8HWZ6_CHLRE          ----------------------------EISIKPKNGPGAAVLKAAKAQ-----------
RL13_THET8            -----------------------------EKLEV--------------------------
RL13_DEIRA            ----------------------------TQPLEVK-------------------------
RL13_COXBU            -----------------------------ELIDL--------------------------
RL13_DESVH            ----------------------------PLELTY--------------------------
Q8RGG9_FUSNN          ----------------------------KVEL----------------------------
RL13_KORVE            ----------------------------VLANA---------------------------
B5YGH9_THEYD          ----------------------------PLKLS---------------------------
RL13_MYCPN            ----------------------------TLNWS---------------------------
Q8F0T2_LEPIN          ----------------------------KLDI----------------------------
A6GWU4_FLAPJ          ----------------------------TVNLNDLK------------------------
Q8A0Z6_BACTN          ----------------------------MIDINSYK------------------------
RL13_HELPY            ------------------------------DAK---------------------------
Q0P8D7_CAMJE          ------------------------------EGK---------------------------
RM23_YEAST            --------------------------EQSSIPEPLKESIFNQLK----------------
Q753Q5_ASHGO          --------------------------EQAEQPARPSA-----------------------
Q5A8Y6_CANAL          --------------------------ENPDMRNKLAELEKNEKNRAELREKYLSHQQ---
Q6C9L9_YARLI          --------------------------EAGVVVKKD-------------------------
Q5AQG1_EMENI          -----------------------ALPEVKAAFQEAKTSQ---------------------
J3KDA4_COCIM          -----------------------ELPEIKKAFQRTREVAAAQ------------------
C0NVE7_AJECG          TNS------------------IADSPLIKEAFAKEKGAETGSKQTTS-------------
D5G6J1_TUBMM          RP--------------------AAGYPSKTPVQDTINMEQSKPEALVS------------
C7Z9I3_NECH7          --------------------------DWEKAVEKVRNADKNRL-----------------
A7E481_SCLS1          P-------------------------DEGWGVKKVEEVRR--------------------
RM23_SCHPO            --------------------------PVSSQIAKELFSK---------------------
I1CTI6_RHIO9          -------------------------------VEQQ-------------------------
Q5KM48_CRYNJ          --------------------------ENSAKIERSPSVSSVPQTEA--------------
E3L423_PUCGT          --------------------------DQPEPQPPTQPANSNQS-----------------
F4P5H6_BATDJ          VKT------------------ETVADNSALQASLPPPVKIKFGKRAKK------------
F6I5K7_VITVI          RE--------------------MRPRARRATIRAQKKAEQQQQGTTDT-----------R
M0RG99_MUSAM          RE--------------------MRPRARRALIRAQIKAEK---GSAGP-----------I
M1CI41_SOLTU          RE--------------------LRPRTRRAMIRADKKAEQQQQGTNNT-----------S
C6THJ7_SOYBN          RE--------------------MRPRARRAMIRAQKKAEQQQQKADGM-----------K
A9PG49_POPTR          RE--------------------MRPRAQRAMIRAQKKAEQLEQAGNDK-----------R
Q7XA68_ARATH          RE--------------------MRPRARRAMIRAQKKAEQAENEGTEV-----------K
C5XFD0_SORBI          RE--------------------MRPRARRAMLRAQKKEQ----ANRAK----------EE
I1ITW2_BRADI          RE--------------------MRPRARRALIRAQKKEQDREAKAQMK----------AE
Q7EYE3_ORYSJ          RE--------------------MRPQARRALIRAQKKEQDRAAASTKDDKD-------EE
D0N078_PHYIT          ------------------------------------------------------------
A8J810_CHLRE          QDRGLGWPLPQGFEPANLERYAFRLRTSPALQAAAAPTVPASSALAAAPQPSAPVTGPGP
F0Z620_DICPU          IG---------------------KYKEAEINIPEEQFQEYYAGYKVKMDEVEGNFRVIET
A0T0K1_PHATC          ----------------------------EINISNFHSDNQFNTQMV--------------
A0T0Z5_THAPS          ----------------------------VIL-----------------------------
A0A077TH32_PLACH      ----------------------------KLENDSDQTNIKTFTIV---------------
A5KBY1_PLAVS          ----------------------------DVARSADQPTLKAFTVV---------------
O96222_PLAF7          ----------------------------NVVKKEEQQDIKTFTIL---------------
B9PMD5_TOXGV          VSF----------------------LPFSVERADPVQAAARIAALGDRMKME--------
Q4UGV0_THEAN          HLS----------------------SQVGNIQPNEMNGGPLTTKVGGPDTSLSTVQSCYT
Q580D5_TRYB2          ----------------------------PLCWTDPEVKGWKYRDPQFIRRWKPNEFMH--
A4IAD5_LEIIN          ----------------------------PLVWTDTATMGWRYKDPTFQRRWSPNQFMS--
RL13_METAC            --AETVTI-----PDADMRLLS---SSRYVELGEVSQKMG------------------SK
RL13_METHJ            --QPFETI-----EDASKKRLG---NPSHVTLGAVSTFLG------------------AK
RL13_THEKO            --KEFETI-----SEAHMSRLA---TPKYVTVGEVAKFLG------------------GK
RL13_ARCFU            --REFEKI-----EDALLEKVSK--TDKYVTLAEVSRYLG------------------FR
RL13_THEAC            --EKVEKV-----DGVVTDKVS-----GIITLGDLSKELG------------------GY
RL13_METJA            --DEK--------ISHKLNTTK------YITLAELSKHLG------------------AK
B1L7A3_KORCO          --VEKDSII-KGDVKYTIDSLKPKKSKRYITVLTLSKLLGWG----------------GE
RL13_NANEQ            YPEALIKE-----VLKAKPKFER-GNIKYIELGELSKYLG------------------AK
RL13_METKA            --EANIEP-----ERVAEADMSRLGHLWYVTLGELSEELG------------------YQ
RL13_HALSA            -----DVL-----DGTSLDRLS---TIRFVTLSEVSEELGAN----------------VT
RL13_PYRAE            ------------LYEVPEAKLRLRPLLQYTTLEEVWRSIDPEAWEKWRRAVEVWGKKLKQ
A1RWV8_THEPD          ------------LVKVEEALFK-NELVPYITLGELYKSLTN-----------------RE
RL13_SACS2            --RQFIKFP-----DSDVSRLK----GKYVTVEVVSKELGWSG-----------------
A2BK81_HYPBU          --KQFIRFG-----FADARRLG----HKFIRVGELAQRLGWKGVRSRS------------
RL13A_CAEEL           ----------SLHAPSASR-FRLQPRRKFCVVGRLSHEVGWQFQDVVA-KLEAKRKVKGA
E9HBC4_DAPPU          ----------KQIAPNALRVICLSPGRKYCRLGRLSHEVGWKYQDIVA-TLEAKRKIKAS
Q5UAS5_BOMMO          ----------RVVVPAALRVFCLKPGRNYCHVGRLSHEIGWKYRDVVR-KLEDKRKGKAV
A0A158NDR5_ATTCE      ----------RVVVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKDVVR-TLENKRRARAI
E0VX11_PEDHC          ----------RVVVPSAMSVLCLRPGRKYCHLGRLSHEVGWKYQNVVR-VLEAKRKAKEF
Q297M7_DROPS          ----------RVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIK-SLERKRKAKLR
Q16US7_AEDAE          ----------RLCVPTAMRQLCLRPDRKFCDVGRVAHEVGWKYRDVVN-NLEAKRKIKSR
RL16B_YEAST           ----------RVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVA-KLEDKRKVRSA
RL16A_YEAST           ----------RVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVA-KLEAKRKVSSA
Q5AB87_CANAL          ----------RVVVPQALRVLRLKPGRKYTTVGKLSSAVGWKYESVVE-KLEEKRKVQSA
Q756A0_ASHGO          ----------RVVVPQALRVLRLKPGRKFTTLGKLSSTVGWKYENVVA-KLEEKRKVRSA
G5EB54_EMENI          ----------RVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVA-RLEERRKVKSS
A7EPJ6_SCLS1          ----------RVVVPQALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVA-RLEERRKVKSA
Q0U0K4_PHANO          ----------RVVVPQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVA-RLEERRKVKGA
C7Z299_NECH7          ----------KMVVPQALRVLRLQPGRKYCTVGRLSHEVGWKYQDIVG-RLEDRRKAKAA
Q6CCI0_YARLI          ----------RMVVPQALRVLRLKPGRKYCTVGRVSHEFGWKYQDVVA-NLEEKRKVKSA
D5G9H4_TUBMM          ----------RMVVPQALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVE-RLEERRKAKST
I1BSI4_RHIO9          ----------RMVVPDALRVLRLKPGRKYTTIGRISHEVGWKYQDIVA-KLEEKRKAKSA
RL16A_SCHPO           ----------RVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYSDIVS-KLEERRKVKSA
RL16C_SCHPO           ----------RLVVPAALRVLRLKPSRKYCTIGRLSSEVGWKYKNIVS-KLEERRKIKSA
B3RYA7_TRIAD          ----------RLVVPAALRVVQLKPRRKFTVVGKLSSEVGWKYNDIIS-TLEEKRKAKAK
A7SBZ8_NEMVE          ----------RMVVPSALKVIRLKPGRKFCVLGRLSHEVGWKYQDILE-TLEEKRKAKSK
A9V9H5_MONBE          ----------KMVVPEALKVIRLKPERKFCTVQRLSAEFGWRYKDIVE-TLEDKRRAKAA
F4P0Q4_BATDJ          ----------RVVVPAALRVLRLAPGRKFCTLKRLSSEFGWKYNDVIT-RLEEKRKAKGE
E3KWG5_PUCGT          ----------KMVVPQALRVLRLKPGRKWCTIKRLSHEYGWGYKDVVD-TLEAKRKVKAQ
Q5K7I5_CRYNJ          ----------KMVVPAALRVLRLKPGRKYCTVKRISAEVGWNYKDVVD-RLEEKRKVKGQ
RL13A_BOVIN           ----------RMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTA-TLEEKRKEKAK
Q5RK10_RAT            ----------RMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTA-TLEEKRKEKAK
Q28HK3_XENTR          ----------RMVVPAALKIVRLKPTRKFAFLGRLAHEVGWKYQAVTA-TLEEKRKEKAK
Q1LYB7_DANRE          ----------RMVVPAALKIVRLKPTRKFALLGRLAHEVGWKYQAITA-TLEEKRKEKAK
C3ZL87_BRAFL          ----------RLVVPSALRVIRLMPNRRFCSLGRLSHEVGWKYKEVVD-TLEAKRSARAK
W4XS18_STRPU          ----------RFVVPSALRVMRLKPNRKFCVLGRLAHEVGWKYKNIIE-ALEEKRKARAH
B7PR90_IXOSC          ----------RMVVPSALRVLRLNPRRKYCTLGRLGHEVGWKYQNVIE-SLEMKRKAKAA
G4VQW2_SCHMA          ----------RMVVPSALRAIRLKPGRKFSVLSRLSNDVGWKYKNIIE-KMENRRKAKAA
RL13A_DICDI           ----------RVVVPSALRVVKLNTTRKYTVLSRLSQEVGWKYRAVVA-KLEVQRKQRSS
F0ZPD3_DICPU          ----------RVVVPSALRVVKLNTTRKYTNLGRLAQEVGWKYRSVVA-KLEVQRKQRSS
Q7F225_ORYSJ          ----------RMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIR-ELEEKRKEKAK
I1H4D4_BRADI          ----------RMVIPDALKVLRLQAGHKYCQLGELSKEVGWNYQDTIR-ELEEKRKEKAK
C5YZ01_SORBI          ----------RVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIR-ELEEKRKEKAK
C6SYZ8_SOYBN          ----------RMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIR-ELEKKRKEKAA
F4JD96_ARATH          ----------RMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQ
A5BL45_VITVI          ----------RMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIK-ELEKKRKERAE
K4CWK0_SOLLC          ----------RMVIPDALKVLRLRAGHKYCLLGKLSSEVGWNHYDTIR-DLENKRKERAQ
A9PHS9_POPTR          ----------RMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIK-ELETKRKERAQ
A9P8J0_POPTR          ----------RMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDIIR-ELEEKRKERSQ
A9SHV1_PHYPA          ----------RMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIK-ELEEKRKAKSK
A8IVU0_CHLRE          ----------RLVVPDALKVLRLQHGHRNCKLGDLSASVGWKHQAAVA-ELEEKRKAKAK
B7FSS8_PHATC          ----------RVVVPAALRVMRLKPGRQFTVVGELADSVGWKHKELLG-RLEGKRKAEAK
B8C0R3_THAPS          ----------RKVVPAALRVVRLKPGRKYTKMGDLANNVGWKHKELVD-QLEDKRRAKAE
H3G8D4_PHYRM          ----------RMVVPAALRVLRLKANRRYTVLGALASEVGWRHAELVK-RLEAKRVLKSD
B9PT75_TOXGV          ----------RMVVPSALRIVRLKPKRNFCRLGDLSSQVGWSHGDLVA-RLEEKRKTRSS
A5K762_PLAVS          ----------KYVLPSALRAFRLKKHRRYCRLGTLSSRVGWNYDELVK-KNEISRKKLSK
A0CIE1_PARTE          ----------RQVVPDALKLIRLKNHRPFCSLGDLCASVGWNQQSIVN-RLEEKRKIRGA
Q245E7_TETTS          ----------KQVVVDALKVQRLRNSRPVCKLGDLSASVGWGKQTLIE-KLEEKRRARAK
C4M3F3_ENTHI          ----------KSSIPEAAAIYSFNPTRKRTLLGELGTAVGWKYADVVA-KNEAERKERAA
A2DGT9_TRIVA          ----------RVVIPYALRCVSIHTDRPTTKLGELSTTMGWKYGKVVA-DLEQKRKAESA
Q585J5_TRYB2          ----------RVVIPKAQRHNCYRNERRFTVLGNMCKHVGWKYSDVVE-KLEAARIEKSG
A4H7Z1_LEIBR          ----------RVVIPRAQRHACYRSERPYTVLGNMCKHVGWKYSDVVA-KLEQARVEKAS
A0RXP5_CENSY          -----------KRKLKGAEITRP--TANYTTMADLGETVGWTK-----------------
A9A5C3_NITMS          -----------KIQFEKAKIKKS--PSNYTTMGELCRVIGWTE-----------------
Q8SS16_ENCCU          -----------RYKVTCAFVKYTGNPNRYVTLGKLLSMFGWKHAEAAKSLTDELKERESL
                                                                                  

RM13_BOVIN            ------------------------------------------------------------
RM13_HUMAN            ------------------------------------------------------------
RM13_MOUSE            ------------------------------------------------------------
A0A2H2I6R0_CAEJA      LPNPGRHVKPAPGQKNK-------------------------------------------
H3FZQ1_PRIPA          FSNPGRHPRSRWRKDCS-------------------------------------------
A0A0R3NSN0_DROPS      ------------------------------------------------------------
Q17ET7_AEDAE          ------------------------------------------------------------
E0VQP7_PEDHC          ------------------------------------------------------------
A0A158NPD5_ATTCE      ------------------------------------------------------------
A0A088AH49_APIME      ------------------------------------------------------------
B7PBT5_IXOSC          ------------------------------------------------------------
G4VGE1_SCHMA          MAMKLKTGESK-------------------------------------------------
B3S1A8_TRIAD          ------------------------------------------------------------
A0A1X7VF42_AMPQE      ------------------------------------------------------------
A7SWD2_NEMVE          ------------------------------------------------------------
RL13_THEMA            ------------------------------------------------------------
RL13_AQUAE            ------------------------------------------------------------
RL13_DICTD            ------------------------------------------------------------
RL13_CHLAA            ------------------------------------------------------------
RL13_GEOSL            ------------------------------------------------------------
RL13_SALRD            ------------------------------------------------------------
RL13_CHLTE            ------------------------------------------------------------
D1B6V8_THEAS          ------------------------------------------------------------
Q7UEY3_RHOBA          ------------------------------------------------------------
RL13_VIBCH            ------------------------------------------------------------
RL13_ALIF1            ------------------------------------------------------------
RL13_SHEON            ------------------------------------------------------------
RL13_YERPE            ------------------------------------------------------------
RL13_PSEAE            ------------------------------------------------------------
RL13_XANCP            ------------------------------------------------------------
RL13_BUCAI            ------------------------------------------------------------
Q5NFG3_FRATT          ------------------------------------------------------------
RL13_NEIG1            ------------------------------------------------------------
RL13_BURPS            ------------------------------------------------------------
RL13_BORPE            ------------------------------------------------------------
RL13_MYCS2            ------------------------------------------------------------
RL13_MYCTU            ------------------------------------------------------------
RL13_CORGL            ------------------------------------------------------------
RL13_STRCO            ------------------------------------------------------------
RL13_BIFLO            ------------------------------------------------------------
RL13_MOOTA            ------------------------------------------------------------
RL13_AGRFC            ------------------------------------------------------------
RL13_RHOS4            ------------------------------------------------------------
RL13_BRADU            ------------------------------------------------------------
RL13_RHORT            ------------------------------------------------------------
RL13_RICPR            ------------------------------------------------------------
Q9A8H7_CAUVC          ------------------------------------------------------------
RL13_BACAN            ------------------------------------------------------------
RL13_BACSU            ------------------------------------------------------------
RL13_LISMO            ------------------------------------------------------------
RL13_STAA8            ------------------------------------------------------------
Q8CWU5_STRR6          ------------------------------------------------------------
Q9CDG6_LACLA          ------------------------------------------------------------
RL13_LACPL            ------------------------------------------------------------
RL13_MESFL            ------------------------------------------------------------
RL13_MYCMS            ------------------------------------------------------------
RL13_BORBU            ------------------------------------------------------------
RL13_CLOAB            ------------------------------------------------------------
A5I7H1_CLOBH          ------------------------------------------------------------
RL13_SYNY3            ------------------------------------------------------------
RL13_THEEB            ------------------------------------------------------------
RL13_PROMA            ------------------------------------------------------------
Q7ND18_GLOVI          ------------------------------------------------------------
M1AA76_SOLTU          ------------------------------------------------------------
K4DCX4_SOLLC          ------------------------------------------------------------
F6H2K9_VITVI          ------------------------------------------------------------
RK13_ARATH            ------------------------------------------------------------
M0TW58_MUSAM          ------------------------------------------------------------
Q94J17_ORYSJ          ------------------------------------------------------------
C5XK39_SORBI          ------------------------------------------------------------
I1MID7_SOYBN          ------------------------------------------------------------
RL13_CHLTR            ------------------------------------------------------------
A8HWZ6_CHLRE          ------------------------------------------------------------
RL13_THET8            ------------------------------------------------------------
RL13_DEIRA            ------------------------------------------------------------
RL13_COXBU            ------------------------------------------------------------
RL13_DESVH            ------------------------------------------------------------
Q8RGG9_FUSNN          ------------------------------------------------------------
RL13_KORVE            ------------------------------------------------------------
B5YGH9_THEYD          ------------------------------------------------------------
RL13_MYCPN            ------------------------------------------------------------
Q8F0T2_LEPIN          ------------------------------------------------------------
A6GWU4_FLAPJ          ------------------------------------------------------------
Q8A0Z6_BACTN          ------------------------------------------------------------
RL13_HELPY            ------------------------------------------------------------
Q0P8D7_CAMJE          ------------------------------------------------------------
RM23_YEAST            ------------------------------------------------------------
Q753Q5_ASHGO          ------------------------------------------------------------
Q5A8Y6_CANAL          ------------------------------------------------------------
Q6C9L9_YARLI          ------------------------------------------------------------
Q5AQG1_EMENI          ------------------------------------------------------------
J3KDA4_COCIM          ------------------------------------------------------------
C0NVE7_AJECG          ------------------------------------------------------------
D5G6J1_TUBMM          ------------------------------------------------------------
C7Z9I3_NECH7          ------------------------------------------------------------
A7E481_SCLS1          ------------------------------------------------------------
RM23_SCHPO            ------------------------------------------------------------
I1CTI6_RHIO9          ------------------------------------------------------------
Q5KM48_CRYNJ          ------------------------------------------------------------
E3L423_PUCGT          ------------------------------------------------------------
F4P5H6_BATDJ          ------------------------------------------------------------
F6I5K7_VITVI          KKRK-KEVEPEVSVRGVQVISDLTYKNQA-------------------------------
M0RG99_MUSAM          VKKK-K------------------------------------------------------
M1CI41_SOLTU          KRKKNKDVEEEAVST---------------------------------------------
C6THJ7_SOYBN          KGKNGEAQEESA------------------------------------------------
A9PG49_POPTR          KGKK-REVEADLTE----------------------------------------------
Q7XA68_ARATH          KGKKRTLSEVPA------------------------------------------------
C5XFD0_SORBI          EDAKNATAEVTA------------------------------------------------
I1ITW2_BRADI          GEAKNAKAEVTA------------------------------------------------
Q7EYE3_ORYSJ          EDKGKKMLEVKGKARKKATLGDRKERLIFNKHGIA-------------------------
D0N078_PHYIT          ------------------------------------------------------------
A8J810_CHLRE          AASAPAAAAAAAGTAGASGSGSGRQQRQRPTVPIDDLLTEEERAALAAVEGGKGKSGASS
F0Z620_DICPU          MTRNHKESLKRERRLLRKKRVGELKPLKGQTVKKDKF-----------------------
A0T0K1_PHATC          ------------------------------------------------------------
A0T0Z5_THAPS          ------------------------------------------------------------
A0A077TH32_PLACH      ------------------------------------------------------------
A5KBY1_PLAVS          ------------------------------------------------------------
O96222_PLAF7          ------------------------------------------------------------
B9PMD5_TOXGV          ------------------------------------------------------------
Q4UGV0_THEAN          FCWACFSPNPSFKFKNWGIIE---------------------------------------
Q580D5_TRYB2          ------------------------------------------------------------
A4IAD5_LEIIN          ------------------------------------------------------------
RL13_METAC            F-----------------------------------------------------------
RL13_METHJ            Y-----------------------------------------------------------
RL13_THEKO            F-----------------------------------------------------------
RL13_ARCFU            GV----------------------------------------------------------
RL13_THEAC            ------------------------------------------------------------
RL13_METJA            F-----------------------------------------------------------
B1L7A3_KORCO          YVSES-------------------------------------------------------
RL13_NANEQ            FT----------------------------------------------------------
RL13_METKA            MPGGQ-------------------------------------------------------
RL13_HALSA            W-----------------------------------------------------------
RL13_PYRAE            VASG--------------------------------------------------------
A1RWV8_THEPD          VVSNA-------------------------------------------------------
RL13_SACS2            ------------------------------------------------------------
A2BK81_HYPBU          ------------------------------------------------------------
RL13A_CAEEL           AYFEQKKKMDKLAVQAKKNAAP-KIAQY-QKIIEALGYN---------------------
E9HBC4_DAPPU          IAYGKKKVEQRTKGLAKKKVYE-RIVRH-QKLLQSMGHK---------------------
Q5UAS5_BOMMO          KRVAYEKKLKRITKDAGEKVSK-ATTPF-TTIIQSYGYN---------------------
A0A158NDR5_ATTCE      LEVQKRNKLKKLTKQAGESVAK-ATAPY-TAIINNFGYN---------------------
E0VX11_PEDHC          VRVRKVERKQHFTRLATKNLGR-KVKRY-QKIIESYGYK---------------------
Q297M7_DROPS          VTLKHNRELKKLTVQARENIAK-AAEPF-NKIIKSYGYEV--------------------
Q16US7_AEDAE          LSYLHSKKLK-------------VSASC-NSGMKVFADK---------------------
RL16B_YEAST           EYYAKKRAFTK-KVSSASAA-ASE-SDV-AKQLASFGY----------------------
RL16A_YEAST           EYYAKKRAFTK-KVASANAT-AAE-SDV-AKQLAALGY----------------------
Q5AB87_CANAL          EYYAKKKALTK-KLNAAKAS-TAE-SEA-AQKLAAFGY----------------------
Q756A0_ASHGO          EYYSKKRAFNK-TAAAVKAKYDAK-SEI-AEDLAKLGY----------------------
G5EB54_EMENI          AYYERKKAARR-QLAHAQKSASVP-ENT-KSQLAEYGF----------------------
A7EPJ6_SCLS1          AYYERKKAARK-QLSEAQKSAKID-DKT-KSELAALGY----------------------
Q0U0K4_PHANO          AYYERKKAARR-QLAEAKKSASVD-GKI-VESLTSLGY----------------------
C7Z299_NECH7          AYYERKKIAAR-QLSDAKKTAAVK-DET-TKALAAFGY----------------------
Q6CCI0_YARLI          AYYAKKSALSK-KTKAAHAQIA-D-SEA-AKALAALGY----------------------
D5G9H4_TUBMM          AFYARKKALVK-KLAIAADKTS-T-NK---EELVKLGY----------------------
I1BSI4_RHIO9          AYYQRKVALAAIQKKAVESKADSV-KEV-NTAIAALGY----------------------
RL16A_SCHPO           AFYQAKLAKQK-KIASAKAA-----SSV-NGKLAEFGY----------------------
RL16C_SCHPO           AFYQAKSANQK-HINVAKTK-----SSV-NEKLAVFGY----------------------
B3RYA7_TRIAD          AFYENKRRLQKFKREAEADKADQL-KSV-NETLAALGHN---------------------
A7SBZ8_NEMVE          LYFEHKKKVQKLKQTAELNKADEL-KSV-NKTLAGYGY----------------------
A9V9H5_MONBE          EYYTQKKKLAALRRKAEANVADKV-KSH-TETLAQYGF----------------------
F4P0Q4_BATDJ          LFHQKKLAFLRRRTAAIAASADAL-EPV-TKALASYGY----------------------
E3KWG5_PUCGT          AFHERKVALLKARKQVATDPAT---QTV-QSKLSALGY----------------------
Q5K7I5_CRYNJ          AYFERKQAALKLR---AKAEAS---APK-DAKLVEFGY----------------------
RL13A_BOVIN           IHYRKKKQLMRLRKQAEKNIEKKI-GKF-TEVLKTHGFLV--------------------
Q5RK10_RAT            IHYRKKKQLLRLRKQAEKNVEKKI-CKF-TEVLKTNGLLV--------------------
Q28HK3_XENTR          IHYNKKKIIVKLRKQAEKNVESKI-SKY-TDVLKQYGILV--------------------
Q1LYB7_DANRE          LRYSKKKVEMKLTKQAEKNVESKI-AVY-TDVLKKYGVLV--------------------
C3ZL87_BRAFL          LYWQNKKKTMKMRTQAMQNLSKKL-EPL-NKQIEEAGHYVA-------------------
W4XS18_STRPU          LHYQKELRKSALRRKAVKSVGDKI-APY-QKIIEAYGFN---------------------
B7PR90_IXOSC          LYYKDKKRDRKLFAEAKVQLAKQI-EPM-QKVIQSYGYRA--------------------
G4VQW2_SCHMA          VWYKRKKLLKKPSEAARGRAKEAI-APY-QAILKQYGYS---------------------
RL13A_DICDI           TYYRKAALVKAYRTQALKKFSA--------------------------------------
F0ZPD3_DICPU          TYYRKAALIKSYRAQALKKFTA--------------------------------------
Q7F225_ORYSJ          VAYERRKQLTRLRVKAEKAAEEKL-GSQ-IDILAPIKY----------------------
I1H4D4_BRADI          VSYDRRKQLAKLRVKAEKAAEEKL-GSQ-LDILAPIKY----------------------
C5YZ01_SORBI          VAYERRKQLAKLRVKAEKTAEEKL-GSQ-LEILAPIKY----------------------
C6SYZ8_SOYBN          VVYERKKQLNKLRVKAEKVAEEKL-GSQ-LDVLAPVKY----------------------
F4JD96_ARATH          AVYERKKQLSKLRAKAEKVAEEKL-GSQ-LDVLAPVKY----------------------
A5BL45_VITVI          LAYERKKQLNKLRVKAEKAAVDKL-GSQ-LDVIAPIKY----------------------
K4CWK0_SOLLC          VTYERRKQLAKLRVKAEKAAEEKL-GPQ-LAVIAPINLFLVRGCTLHF------------
A9PHS9_POPTR          LVYERKKQLAKLRLKAEKTAEEKL-GPQ-QEIIAPLKY----------------------
A9P8J0_POPTR          VRYERKKQLNKLRAKAEVTAEEKL-GPQ-VDILAPVKY----------------------
A9SHV1_PHYPA          VFYQRKKQLLQLRLKAAKRVEEQL-GSL-QETLAPITYAS--------------------
A8IVU0_CHLRE          AFYVAKKKLVALRSKAAAQVKA--------------------------------------
B7FSS8_PHATC          DFYEKKKEKAALRKKAEAAAAGEL-AKV-NEVLAASGY----------------------
B8C0R3_THAPS          TFYAKKKAAAALRAKAEEAAAGDL-AKV-NEVLAASGY----------------------
H3G8D4_PHYRM          AFYKKKVAQQKRLGEAESKVFAEN-SEL-KPTLAKYGHAL--------------------
B9PT75_TOXGV          AYYQKKKERTKMQAEAKSFAQTTLPKDQ-VAFLQQYGHA---------------------
A5K762_PLAVS          LYYKKKVSVLNEKKELKTEALNMINPEE-RKVLENFGYA---------------------
A0CIE1_PARTE          TYYKRKITRENLRRKAIGAKELTA---I-NAELEKLGY----------------------
Q245E7_TETTS          TYHDKKVKQADARKKELAAPALKA---I-KDKLAQFGY----------------------
C4M3F3_ENTHI          KWYAAKQLKQKAVAEAKEKILADEKYKAKVAILKKFGYA---------------------
A2DGT9_TRIVA          KYYEAKKAAQDKKAAAIEKANKQLGAQA-VKFLETFAE----------------------
Q585J5_TRYB2          RHHKKMEKVRVAWKNARKEALKKMPQKN-VEVLKKFGLA---------------------
A4H7Z1_LEIBR          RHHKKQAKLRDAWKAARKEALAKMPKHN-VAVLKKFGYS---------------------
A0RXP5_CENSY          ------------------------------------------------------------
A9A5C3_NITMS          ------------------------------------------------------------
Q8SS16_ENCCU          ASLQKKDLDKKIEELKTDKNFENEVNRRLAMLA---------------------------
                                                                                  

RM13_BOVIN            -
RM13_HUMAN            -
RM13_MOUSE            -
A0A2H2I6R0_CAEJA      -
H3FZQ1_PRIPA          -
A0A0R3NSN0_DROPS      -
Q17ET7_AEDAE          -
E0VQP7_PEDHC          -
A0A158NPD5_ATTCE      -
A0A088AH49_APIME      -
B7PBT5_IXOSC          -
G4VGE1_SCHMA          -
B3S1A8_TRIAD          -
A0A1X7VF42_AMPQE      -
A7SWD2_NEMVE          -
RL13_THEMA            -
RL13_AQUAE            -
RL13_DICTD            -
RL13_CHLAA            -
RL13_GEOSL            -
RL13_SALRD            -
RL13_CHLTE            -
D1B6V8_THEAS          -
Q7UEY3_RHOBA          -
RL13_VIBCH            -
RL13_ALIF1            -
RL13_SHEON            -
RL13_YERPE            -
RL13_PSEAE            -
RL13_XANCP            -
RL13_BUCAI            -
Q5NFG3_FRATT          -
RL13_NEIG1            -
RL13_BURPS            -
RL13_BORPE            -
RL13_MYCS2            -
RL13_MYCTU            -
RL13_CORGL            -
RL13_STRCO            -
RL13_BIFLO            -
RL13_MOOTA            -
RL13_AGRFC            -
RL13_RHOS4            -
RL13_BRADU            -
RL13_RHORT            -
RL13_RICPR            -
Q9A8H7_CAUVC          -
RL13_BACAN            -
RL13_BACSU            -
RL13_LISMO            -
RL13_STAA8            -
Q8CWU5_STRR6          -
Q9CDG6_LACLA          -
RL13_LACPL            -
RL13_MESFL            -
RL13_MYCMS            -
RL13_BORBU            -
RL13_CLOAB            -
A5I7H1_CLOBH          -
RL13_SYNY3            -
RL13_THEEB            -
RL13_PROMA            -
Q7ND18_GLOVI          -
M1AA76_SOLTU          -
K4DCX4_SOLLC          -
F6H2K9_VITVI          -
RK13_ARATH            -
M0TW58_MUSAM          -
Q94J17_ORYSJ          -
C5XK39_SORBI          -
I1MID7_SOYBN          -
RL13_CHLTR            -
A8HWZ6_CHLRE          -
RL13_THET8            -
RL13_DEIRA            -
RL13_COXBU            -
RL13_DESVH            -
Q8RGG9_FUSNN          -
RL13_KORVE            -
B5YGH9_THEYD          -
RL13_MYCPN            -
Q8F0T2_LEPIN          -
A6GWU4_FLAPJ          -
Q8A0Z6_BACTN          -
RL13_HELPY            -
Q0P8D7_CAMJE          -
RM23_YEAST            -
Q753Q5_ASHGO          -
Q5A8Y6_CANAL          -
Q6C9L9_YARLI          -
Q5AQG1_EMENI          -
J3KDA4_COCIM          -
C0NVE7_AJECG          -
D5G6J1_TUBMM          -
C7Z9I3_NECH7          -
A7E481_SCLS1          -
RM23_SCHPO            -
I1CTI6_RHIO9          -
Q5KM48_CRYNJ          -
E3L423_PUCGT          -
F4P5H6_BATDJ          -
F6I5K7_VITVI          -
M0RG99_MUSAM          -
M1CI41_SOLTU          -
C6THJ7_SOYBN          -
A9PG49_POPTR          -
Q7XA68_ARATH          -
C5XFD0_SORBI          -
I1ITW2_BRADI          -
Q7EYE3_ORYSJ          -
D0N078_PHYIT          -
A8J810_CHLRE          S
F0Z620_DICPU          -
A0T0K1_PHATC          -
A0T0Z5_THAPS          -
A0A077TH32_PLACH      -
A5KBY1_PLAVS          -
O96222_PLAF7          -
B9PMD5_TOXGV          -
Q4UGV0_THEAN          -
Q580D5_TRYB2          -
A4IAD5_LEIIN          -
RL13_METAC            -
RL13_METHJ            -
RL13_THEKO            -
RL13_ARCFU            -
RL13_THEAC            -
RL13_METJA            -
B1L7A3_KORCO          -
RL13_NANEQ            -
RL13_METKA            -
RL13_HALSA            -
RL13_PYRAE            -
A1RWV8_THEPD          -
RL13_SACS2            -
A2BK81_HYPBU          -
RL13A_CAEEL           -
E9HBC4_DAPPU          -
Q5UAS5_BOMMO          -
A0A158NDR5_ATTCE      -
E0VX11_PEDHC          -
Q297M7_DROPS          -
Q16US7_AEDAE          -
RL16B_YEAST           -
RL16A_YEAST           -
Q5AB87_CANAL          -
Q756A0_ASHGO          -
G5EB54_EMENI          -
A7EPJ6_SCLS1          -
Q0U0K4_PHANO          -
C7Z299_NECH7          -
Q6CCI0_YARLI          -
D5G9H4_TUBMM          -
I1BSI4_RHIO9          -
RL16A_SCHPO           -
RL16C_SCHPO           -
B3RYA7_TRIAD          -
A7SBZ8_NEMVE          -
A9V9H5_MONBE          -
F4P0Q4_BATDJ          -
E3KWG5_PUCGT          -
Q5K7I5_CRYNJ          -
RL13A_BOVIN           -
Q5RK10_RAT            -
Q28HK3_XENTR          -
Q1LYB7_DANRE          -
C3ZL87_BRAFL          -
W4XS18_STRPU          -
B7PR90_IXOSC          -
G4VQW2_SCHMA          -
RL13A_DICDI           -
F0ZPD3_DICPU          -
Q7F225_ORYSJ          -
I1H4D4_BRADI          -
C5YZ01_SORBI          -
C6SYZ8_SOYBN          -
F4JD96_ARATH          -
A5BL45_VITVI          -
K4CWK0_SOLLC          -
A9PHS9_POPTR          -
A9P8J0_POPTR          -
A9SHV1_PHYPA          -
A8IVU0_CHLRE          -
B7FSS8_PHATC          -
B8C0R3_THAPS          -
H3G8D4_PHYRM          -
B9PT75_TOXGV          -
A5K762_PLAVS          -
A0CIE1_PARTE          -
Q245E7_TETTS          -
C4M3F3_ENTHI          -
A2DGT9_TRIVA          -
Q585J5_TRYB2          -
A4H7Z1_LEIBR          -
A0RXP5_CENSY          -
A9A5C3_NITMS          -
Q8SS16_ENCCU          -