CLUSTAL format seed alignment for MF_01367

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RM14_PARTE            ---------------------------------------------------MIQKETQLN
RM14_TETPY            ---------------------------------------------------MIQKETNLK
RL14_DEHM1            ---------------------------------------------------MVQQYTRLN
RL14_KORVE            --------------------------------------------------MAVQMRTMLE
RL14_LEPIC            ---------------------------------------------------MIQQETLLQ
RL14_CHLCH            ---------------------------------------------------MIQKETNLV
RL14_FLAPJ            ---------------------------------------------------MVQQESRLR
RL14_SULMW            ---------------------------------------------------MLQQESRIR
RL14_RUBXD            ---------------------------------------------------MIQQETRLK
RL14_SALRD            ---------------------------------------------------MIQQETRLN
RL14_BIFLO            ---------------------------------------------------MIQQETRLH
RL14_MYCHJ            ---------------------------------------------------MLQELSRLN
RL14_MYCA5            ---------------------------------------------------MLREFSRCN
RL14_MYCS5            ---------------------------------------------------MIFELSRAN
RL14_MESFL            ---------------------------------------------------MIQTLSKLK
RL14_MYCGA            ---------------------------------------------------MIQFMTRLN
RL14_UREP2            ---------------------------------------------------MIQHMTRLK
RL14_ONYPE            ---------------------------------------------------MIQRESRLV
RL14_ACHLI            ---------------------------------------------------MLQQESRLL
RL14_OENOB            ---------------------------------------------------MIQQESRLK
RL14_CLONN            ---------------------------------------------------MIQPQTRLK
RL14_PELTS            ---------------------------------------------------MIQVQSILN
RL14_SYNWW            ---------------------------------------------------MIQQETMLQ
RL14_CORJK            ---------------------------------------------------MIQQESRLR
RL14_TROWT            ---------------------------------------------------MIQQESRLK
RL14_ROSS1            ---------------------------------------------------MVQQETRLR
RL14_THEP1            ---------------------------------------------------MIQQETYLN
RL14_FUSNN            ---------------------------------------------------MVQQQTILN
RL14_AKKM8            ---------------------------------------------------MIQMESLVQ
RL14_OPITP            ---------------------------------------------------MIQLRSVLD
RL14_RHOBA            ---------------------------------------------------MIQQESRLD
RK14_HELSJ            ---------------------------------------------------MIQAQTILQ
RK14_CYAM1            ---------------------------------------------------MIQVQTRLK
RK14_EUGLO            ---------------------------------------------------MIQTQTYLN
RK14_EUGGR            ---------------------------------------------------MIKPQTYLK
RK14_EMIHU            ---------------------------------------------------MIQPQTCLN
RK14_THAPS            ---------------------------------------------------MIYPQTMLT
RK14_CYACA            ---------------------------------------------------MISVHTRLK
RK14_BIGNA            ---------------------------------------------------MVQPQSRVK
RK14_SORBI            ---------------------------------------------------MIQPQTLLN
RK14_WELMI            ---------------------------------------------------MIQSQTYLN
RK14_PELHO            ---------------------------------------------------MIQSQTLLN
RK14_HUPLU            ---------------------------------------------------MIQPQTYLN
RK14_PSINU            ---------------------------------------------------MIQPQSYLK
RK14_ADICA            ---------------------------------------------------MIQIQSYLD
RK14_ANEMR            ---------------------------------------------------MIQPQTHSN
RK14_CHLRE            ---------------------------------------------------MIKPLSYLN
RK14_GRATL            ---------------------------------------------------MIQIQSYLN
RL14_PROMP            ---------------------------------------------------MIQQETYLT
RL14_GLOVI            ---------------------------------------------------MIQQQSRLS
RL14_DEIRA            ---------------------------------------------------MIMPQSRLD
RL14_CHLPN            ---------------------------------------------------MIQQESQLK
RL14_PARUW            ---------------------------------------------------MIQQESELE
RL14_BORBU            ---------------------------------------------------MIQMQTYLT
RL14_TREDE            ---------------------------------------------------MIQVETRLN
RL14_HELPJ            ---------------------------------------------------MIQSFTRLN
RL14_LAWIP            ---------------------------------------------------MIQVESTLQ
RL14_DESPS            ---------------------------------------------------MIQTETVLN
RL14_SORC5            ---------------------------------------------------MIQVSTHLE
RL14_PELCD            ---------------------------------------------------MIQMQTMLD
RL14_XANP2            ---------------------------------------------------MIQMQTNLD
RL14_SPHWW            ---------------------------------------------------MIQMQTNLD
RM14_RECAM            ---------------------------------------------------MIQVETMLK
RL14_PELUB            ---------------------------------------------------MIQVQTELL
RL14_BLOFL            ---------------------------------------------------MIQERTILN
RL14_SACD2            ---------------------------------------------------MIQTQSYLD
RL14_NITEC            ---------------------------------------------------MIQMQSLLK
RL14_VESOH            ---------------------------------------------------MIQVQTRLK
RL14_ORITI            ---------------------------------------------------MIQMQTILN
RL14_RICAH            ---------------------------------------------------MIQMQSILE
RL14_SULSY            ---------------------------------------------------MIQRGTYLN
RL14_AQUAE            ---------------------------------------------------MIQRQTYLN
RL14_ANAPZ            ---------------------------------------------------MIQKNAILD
RL14_WOLTR            ---------------------------------------------------MIQKNTLLE
RL14_NEOSM            ---------------------------------------------------MIKKETVLD
RM14_ACACA            ---------------------------------------------------MINVQTVLK
RL14_CARRP            ---------------------------------------------------MIQEQTYLK
RM14_DICDI            ---------------------------------------------------MIIKGSNFS
RM38_YEAST            ---------------------------------------------------MIFLKSVIK
RM38_SCHPO            -----------------------------------------MYGQVLESLAMIGLKGILK
RL14_METKA            ---------------------------------------MKAIKAK-SPHAALPVGARLV
RL14_METS3            ---------------------------------------MKALTSN-VSKA-LPIGATLQ
RL14_METM5            ---------------------------------------MKGLGST-IVRS-LPNGARLV
RL14_METJA            ---------------------------------------MKAIGSK-PVRA-LPVGARCI
RL14_THEAC            ---------------------------------------MKGIAGR-QTRG-LPLGANIT
RL14_PYRAB            -------------------------------MAKKGAGATRGITPV-RPTRAIPVGAYLT
RL14_CENSY            ---------------------------MSQGRSRGKAKGVEEFRPY-VTRA-LPVGARVT
RL14_HYPBU            -------------------------------MPK--GAAG--AGPRRHIAAGLQVGSYVK
RL14_STAMF            -------------------------------MPK--KGKGKPAFSRRRIATGLQVGSYVR
RL14_AERPE            -------------------------------MAK--KKKYGVVVSRYGVNTGLQVGSYVP
RL14_SULAC            -------------------------------MPE--KMNV--LGSRKGFTPALQHNSSVV
RL14_PYRAE            -------------------------------MAKRGGKRTVGVPYRFHVTPGIFMNSLVP
RL14_THEPD            -------------------------------MAKRGPK-TVGVSYRLGLTPGVFMESLVK
RL14_KORCO            --------------------------------MSKVARRRKVEGVKPKITHGLPVRARLK
RL14_METAC            ---------------------------------------MKGMRSN--IPRALNAGAQIA
RL14_METTP            ---------------------------------------MRGNKAK--IPRSINTGTYLE
RL14_METAR            ---------------------------------------MRAIKAK--IPRSVHTATRLE
RL14_METB6            ---------------------------------------MKAKQSK--TPRALATGTKLT
RL14_METMJ            ---------------------------------------MKAMQAK--IPRALATGSRMV
RL14_HALMA            ---------------------------------------MEALGAD--VTQGLEKGSLIT
RL14_NANEQ            ---------------------------------------MKPISAS--IVRALPVGAYLN
RL23_BOVIN            ---------------------------------MSKRGRGGSSGAKFRISLGLPVGAVIN
G3I5G8_CRIGR          ---------------------------------MSEKGHGGSFRVQIWISLGLPVEAVIN
H2Y1Y8_CIOIN          ---------------------------------MSKRGRGGAAGGKFRISLSLPVGAVVN
F6HZQ0_VITVI          ---------------------------------MSKRGRGGSAGNKFRMSLGLPVAATVN
G4V5P4_SCHMA          ---------------------------------MPKRGRGGSSGGKFRISLALPVGAIMN
L9LD00_TUPCH          ---------------------------------MSKQGRGGSSGTKFRISLGLPVGAVIN
K7N2C3_SOYBN          ---------------------------------MSKRGRGGSAGNKFRMSLGLPVAAV--
RL23_TETTS            --------------------------------MAAARGRGGQVGTKAKVSLGLPVGAVMN
RL23_DICDI            --------------------------------MSKAQA----VGSNYRVSLGLPVGAVMN
C4JJD1_UNCRE          ----------------------------------------------------------MN
F2S3Q1_TRIT1          ----------------------------------------------------------MN
M1D3Y4_SOLTU          ------------------------------------------------------MAATVN
RL23_TRYCR            ----------------------------------MGKEKANVKGCRFRVSLALPVGAVVN
RL23_ENCCU            ---------------------------MAAEKKTEVLEKKISIKPRYKMTRGIQVETLMK
A7ATG9_BABBO          -------------------------------------------MFASTLLYGLQKMSIVR
C5LDI6_PERM5          --------------------------------------------------MGLWQQSVVK
Q25812_PLAF7          ---------------------------------------------------MIYINSILD
RM14_BOVIN            --------------------MAFSSGLWGPCVH-MSRAFSQRCFSTTGSLGAIQKMTRVR
F7GB07_MONDO          --------------------MAFSSGPWGSLLNPVSRALSQRYFSTTGALGAIQKMTRVR
RM14_DANRE            --------------------MALS--LSGLILP---KLMQQRAFSVSSAVSAIQKLTRVR
F4W3T1_ACREC          -----------------------------MLTPFAMLNVASRNISTSTPMSQIIKLSRLR
A0A158NB27_ATTCE      -----------------------------MLTPFAVLNIASRNISTSTPMSQIIKLSRLR
E2C6B6_HARSA          -----------------------------MLLPPVILNNACRSISTSAVANHIIKLSRLR
B4JL96_DROGR          ---MSQILLRNIKRVGNAGALLTHSSVASPLTVAAAVGISHQQLHTTPACCEIRKLARLR
E0VMC0_PEDHC          -----------------------------MHCSVKNLFYFCRQFNTSCIHNHVIKLTRLR
T1F6R9_HELRO          ------------------------------MFLQNVSTLTCRYFSTTAVRHEVQKLTRLR
T1L5E8_TETUR          ---------------------MSFPGNSRLLNQISLLVNYARNFNTSQILNQARIGTFMR
T1JPY1_TETUR          --------------------<MSFPGNSRLLNQISLLVNYARNFNTSQILNQARIGTFMR
Q20430_CAEEL          MANLPSSSGMFSRLLANVFNTTVASRCSASGRWWPQPEYELSKHRSRAPSMGIHRRTRLN
RL14H_NYCOV           ---------------------------------------------------MIQKFTNLY
A7AXG7_BABBO          ---------------------------------------------------MINIHTVFK
                                                                                  

RM14_PARTE            VCDTS--------SVWVVNTFHIYRGF------------RHRIGRLGDYIKVSIRSTKPE
RM14_TETPY            PIDKC--------GVWSVRAFHLYGGS------------FRNQSTISNFLKVSVKKTRAN
RL14_DEHM1            VADNT--------GAKKIMCINVLGGS------------RKLQAKVGDVIVAAVKKSSP-
RL14_KORVE            VADNS--------GARKLQMINPLGGG------------AGHVAHLGDVVTAAVKEASP-
RL14_LEPIC            VADNS--------GIKKVMCIKVLGGS------------KKRYASVGDEIIVAVKDAQPA
RL14_CHLCH            VADNS--------GAKKVRCIHVFGGT------------GRRYASLGDQVIVSVKTAVP-
RL14_FLAPJ            VADNT--------GAKEVLTIRVLGGT------------KRRYASVGDKIVVSIKDTAP-
RL14_SULMW            VADNS--------GAKEVLLIRVLGGK------------K--YAYIGDTIIVSIKEAIA-
RL14_RUBXD            VADNS--------GARSLLCIRVLGGS------------KRRSAGIGDVIVASVKEATP-
RL14_SALRD            VADNS--------GAKEAQCIRVLGSS------------GRRYAGIGDQIVVSVKSAIP-
RL14_BIFLO            VADNT--------GAKELLAIRVLGGS------------KRRYAGIGDVIVASVKDAIP-
RL14_MYCHJ            VADNT--------GAKIVGVIRNLGGS------------VKKTSNIGDIVVVSVKKAIPN
RL14_MYCA5            VADNS--------GAKEVMIIKNLGGS------------IVRSTNIGDVVVVTVKKAIPH
RL14_MYCS5            VADNS--------GAKQVGVIRVLGGS------------KKKVAEIGDVVICSVKKALPS
RL14_MESFL            VADNS--------GAKEVRVIRNLGGS------------VRKFTGIGDIIVCSVQSATPG
RL14_MYCGA            VADNT--------GAREVGVIKVLNGS------------KRRYASVGDIVVVSVKDAIPS
RL14_UREP2            VADNT--------GAKEVGVIKVLGGS------------KKRYASVGDIVVVSVKKATPA
RL14_ONYPE            VVDNS--------GAKEVLVIGILGGT------------RRSHVNIGDIVLVTVKSGS--
RL14_ACHLI            VADNS--------GAREVLVIRVLGGT------------RRRYANIGDIVTVTVKKASPT
RL14_OENOB            VADNS--------GAREILTIKVLGGS------------GRKFANIGDMIVATVKQAIPG
RL14_CLONN            VADNT--------GAKEIMCIRVLGGS------------KRKFGNIGDVIVASVKSATPG
RL14_PELTS            VADNT--------GARRLMCIRVLGGA------------LRRYASVGDIIVCSVKEATPG
RL14_SYNWW            VGDNT--------GAKKVLCVKVLGGS------------TRRYASVGDIIVASVKEASPG
RL14_CORJK            VADNT--------GAREILVIRPLGGS------------VRRSAGIGDVVVATVKEAAPG
RL14_TROWT            VADNT--------GAKSLSVIRVLGGS------------NRRFGSLGDVVVASVKDAVPG
RL14_ROSS1            VADNT--------GAKEILCIRVLGGS------------RVRYGRVGDVIVASVKEATPG
RL14_THEP1            VADNS--------GAKKLRVIRVIGGF------------HKKYGTVGDIVVCSVREAIPN
RL14_FUSNN            VADNS--------GAKKLMVIRVLGGS------------RKRFGKIGDIVVASVKEAIPG
RL14_AKKM8            VADNT--------GARSAKMIGVIG-K------------RTRQAHIGDIITCHIRESIPT
RL14_OPITP            VADNT--------GARKAAMISRKG-Q------------ITATAGVGDIITVHIKQSSTE
RL14_RHOBA            VADNT--------GAREVMCIKVLGGS------------RRRFATVGDVIVCSVKSVIPG
RK14_HELSJ            VADNT--------GAKEIMCIRVLRGSS-----------K-KGARVGDIIVAVVKKTKKQ
RK14_CYAM1            VADNT--------GAKEVMCIRVLKAST---------------ATLGDVIIVVVKEALPN
RK14_EUGLO            VSDNS--------GAKKIMCISIISTK------------R-KYAKIGDTIIAVVKKASPN
RK14_EUGGR            IADNT--------GAQKIMCIRILGPN------------C-QYANIGDIIIAVVKEAIPN
RK14_EMIHU            VADNS--------GAKKLMCIRVLGTN------------R-RYGHVGDVIIGVVKDATPN
RK14_THAPS            VADNT--------GAKKIMCIRVLGGN------------R-KYGKIGDTIIGVVKEAIPN
RK14_CYACA            VIDNS--------GGKEIMCIRVLGTN------------R-KYATLGDVIIGVVKNAVPN
RK14_BIGNA            VVDNS--------GAKEIVCIRVLGKG------------RNQLSNIGDIIIGVVKEAIPN
RK14_SORBI            VADNS--------GARKLMCIRVIGAAG-----------NQRYARIGDVIIAVIKDAVPK
RK14_WELMI            IVDNS--------GARKIMCIRVVGAS------------YQRYAHIGNVIIAVIKEAVPN
RK14_PELHO            VADNS--------GARKLMCIRIVGAS------------NQRYAHIGDVIVAVIKEAKPT
RK14_HUPLU            VADNS--------GAKKPMCIRILKAS------------NRKYANTGNVIVAVVKEAVPN
RK14_PSINU            VTDNS--------GARKLMCIRILGTN------------NCKYANTGDTIIAVVKESVPN
RK14_ADICA            VADNS--------GARKLMCIRVLGTG------------NRKYADIGDIIIAVVKEAVPN
RK14_ANEMR            VADNS--------GAQKLMCIRVTGTN------------DREYAGIGDVIVAVVKEAVPN
RK14_CHLRE            VADNS--------GARELMCIRALGGS------------YRESANIGDVIIAVVKDALPN
RK14_GRATL            IADNS--------GARKIMCIQVLGSN------------NPHYANIGDIIIGVVKDALPN
RL14_PROMP            VADNS--------GAKRLQCIRVLGS-------------NRRYAHVGDVVVASVKDALPN
RL14_GLOVI            VADNT--------GARELLCIRVLGSTVGSKGLTKGGG-NRRYAFVGDIVVAVVKDAAPN
RL14_DEIRA            VADNS--------GAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDIIVASVKDAAPR
RL14_CHLPN            VADNT--------GAKKVKCFKVLGGS------------RRRYATVGDVIVCSVRDVEPN
RL14_PARUW            VADNS--------GAKRVKCFKVLGGS------------KRRYAHVGDIVVASVQDAHPE
RL14_BORBU            IADNT--------GGKVAQCIKVLGGS------------KRRYAKIGDIITIVVKQAIPN
RL14_TREDE            VADNS--------GAKLVECIKVIGGS------------KRRYAGIGDIIVVAVKEALPT
RL14_HELPJ            VADNS--------GAKEIMCIKVLGGS------------HKRYASVGSVIVASVKKAIPN
RL14_LAWIP            VADNS--------GAKKVACIKVLGGS------------KRRYATVGDIIVVSVKEAIPH
RL14_DESPS            VADNS--------GAKKVLCIRVLGGS------------RKRYASIGDVIVVTVKEAIPH
RL14_SORC5            VADNS--------GARIVKCIKVLGGS------------RRKYAALGDVIVVSIKEALPG
RL14_PELCD            VADNS--------GARKLCCIKVLGGS------------KRKYAGLGDIIICSVKEALPN
RL14_XANP2            VADNS--------GARRVMCIKVLGGS------------KRKYAHVGDIIVVSVKEAIPR
RL14_SPHWW            VADNS--------GAKRVQCIKVLGGS------------KRRFATVGDVIVVSIKEAAPR
RM14_RECAM            VADNS--------GAKRVQCIKVLGGS------------KRRYGSVGDTIVVAVKECMPR
RL14_PELUB            VADNT--------GAKRIECIKVLGGS------------KRRYASIGDTIVIAVKEALPK
RL14_BLOFL            VADNS--------GARFAMCIKVLGGS------------KRRYANIGDVIKVTVKEAIPK
RL14_SACD2            VADNS--------GARRVMCIKVLGGS------------HRRYAGVGDIIKVTVKEAIPR
RL14_NITEC            VADNT--------GARTVMCIKVLGGS------------KRRFAGIGDVIKVAVKDAAPR
RL14_VESOH            VADNS--------GGIKAMCIKVLGGS------------KRRYANIGDVIKVSIKEVVPR
RL14_ORITI            VADNS--------GAKEVMCIKVLGGT------------HHMIAHLGDVIVVSIKSSIPK
RL14_RICAH            VADNS--------GARKVMCIKVLGGS------------HHMVAKLGDVIVVSVKEAIPG
RL14_SULSY            TADNS--------GAKLVQCIGIPGGA------------KKMHATVGDVITVTVKSAIPS
RL14_AQUAE            VADNS--------GAKKVQVIGIPYAP------------RK-YATLGDVVTVTVKEALPQ
RL14_ANAPZ            VADNS--------GARKVLCIGFLGGK--------------KSATVGDVIVVSAKVAAPK
RL14_WOLTR            VADNS--------GAREVLCIGLLGGR--------------KSASIGDTIVVSTKSVNPK
RL14_NEOSM            VADNS--------GARKVLCIGISGSK--------------KTASIGDVITVSVKKCIPV
RM14_ACACA            VADNS--------GAVFVSCIRLLNSS------------SRVGAGVGDTITVVVKKSIIK
RL14_CARRP            VADNS--------GGKIVKCIKVLNGT------------NKKYANIGEIIKVVVKTANFK
RM14_DICDI            VMDNS--------GARKVQCIQTLEGKK-----------PTSLLRVGDKIVVVIKKME--
RM38_YEAST            VIDNS--------GAQLAECIKVIRKGS-----------PKSPAMVGDRIVCVIQKAKPL
RM38_SCHPO            VIDNS--------GATLAECIRVVRAGK-----------FAS---LGDEVVVVVKKAR--
RL14_METKA            CADNT--------GARELQIIAV--KGYKG------VRRRLPNAGIGDMVVCSVKEGTP-
RL14_METS3            CVDNT--------GAREIQIISV--KGFKG------VRRRLDVAGVGDLVVASVKKGTA-
RL14_METM5            CADNT--------GAKELEVIAV--KNYVG------TVRRLPAGGVGHMVFVSVKKGTP-
RL14_METJA            CADNT--------GAKEVEIIAV--RNYKG------VARRLPTARVGDMVIVTVKKGTP-
RL14_THEAC            CADNT--------GARSISLIDV--KAWHG------KARRIPAAGVGDMFMASVKKGTP-
RL14_PYRAB            VADNS--------GAKVIQVIGV--VEYHG------TRRRLASAGVGDMVVATVKKGRP-
RL14_CENSY            CADNS--------GAKVLEIIMV--QKAKT------RVSRLPAAAVGDYVNVVVKKGPA-
RL14_HYPBU            VADNS--------GAKEAMIIGV--IGYKG------RLRRIPPAAVGDMVVVTVKKGTP-
RL14_STAMF            VADNS--------GAKLVKIIGV--PGYKG------RLRRIPPAGIGDLVVVTVKKGTP-
RL14_AERPE            VADNS--------GAKEVMIISV--PQVKT------RLRRLPSAGVGDLVVVSVKKGTP-
RL14_SULAC            VADNS--------GAKEAVIIGI--YGYRG------VLRRVPFANIADLVMVSVRKGSP-
RL14_PYRAE            VADNS--------GAKLVRVIGVVGHYSKT------VHRRIPGAGVGDMVVVVVREGKP-
RL14_THEPD            VADNS--------GATLAKVIGV--PHYKA------VWRRIPGAAVGDIVIVSIRAGKP-
RL14_KORCO            CADNT--------GAKLLMIIGV--HGYKG------RKDRVPTASVGDMVTVVVKRGKY-
RL14_METAC            CVDNT--------GAKVVEIISV--KKYRG------VKNRMPCAGIGDMCVVSVKKGTP-
RL14_METTP            CADNT--------GARTLFVVSV--KKYRG------VKNRQPCAGIGDMVVVSVKKGTP-
RL14_METAR            VADNT--------GARLVEVISV--LKYRG------RKNRMPKAGIGDIFIGSVKKGTP-
RL14_METB6            CADNT--------GARIVQIVSV--FGYHG------VRRRQPKMGLGDIATVTVKKGTP-
RL14_METMJ            CSDNT--------GARLVEVVSV--DRYHG------VRRRQPCLGLGDVATVSVKKGTP-
RL14_HALMA            CADNT--------GARELKVISV--HGYSG------TKNRHPKAGLGDKITVSVTKGTP-
RL14_NANEQ            VADNS--------GAKVVKLIAV--KGYKG------RKRRLAKAGIADLVIVSVRDGKP-
RL23_BOVIN            CADNT--------GAKNLYIISV--KGIKG------RLNRLPAAGVGDMVMATVKKGKP-
G3I5G8_CRIGR          CADNT--------GRKNLYIISV--KNIKG------RLNRLPAAGVGDMVMATVKKGKP-
H2Y1Y8_CIOIN          CADNT--------GAKNLYIIAV--KGIRG------RLNRLPAAGVGDIVLATVKKGKP-
F6HZQ0_VITVI          CADNT--------GAKNLYIISV--KGIKG------RLNRLPSACVGDMVMATVKKGKP-
G4V5P4_SCHMA          CADNS--------GAKNLYVIAT--FGVRG------RLNRLPSAATGDLIVCSVKKGKP-
L9LD00_TUPCH          CADNT--------GAKNRYIVSV--KRLKG------QLNRLPAAGMGDMVMVTVKKGKP-
K7N2C3_SOYBN          ----------------NLYIISV--KGIKG------RLNRLPYACVGDLVMATVKKGKP-
RL23_TETTS            CADNS--------GAKNLYTIAC--FGIKG------HLSKLPSASIGDMILCSVKKGSP-
RL23_DICDI            SADNS--------GAKNLYVIAV--KGIKG------RLNRLPSAGVGDMVMATVKKGKP-
C4JJD1_UNCRE          CCDNS--------GARNLYIISV--KAWGA------RLNRLPAAGVGDMVMATVKKGKP-
F2S3Q1_TRIT1          CCDNS--------GARNLYIISV--KATGA------RLNRLPAAGVGDMVMATVKKGKP-
M1D3Y4_SOLTU          CTDNT--------GAKNLYIISV--KGIKG------RLNRLSSACVGDMVTATMKKGKP-
RL23_TRYCR            CADNT--------GAKNLYIISV--KGYHG------RLNRLPAAALGDIVMASVKKGKP-
RL23_ENCCU            CADNS--------GAKILRCIGV--KRYRG------RLNRLPAAAPGDICVVSVKKGKP-
A7ATG9_BABBO          CGDTT--------GIIKGCIIGLGRNR-------------HGTGKIGDRIKVSVRAKTAE
C5LDI6_PERM5          CADNC--------GIFKAVIIGMPKWH-------------HSRGRVGYAFRMAVRDKSRE
Q25812_PLAF7          VIDNS--------GIFKFKYICTLNKY-------------KNPKYGDIVIGVVYSLYNNN
RM14_BOVIN            VVDNSALGNTPYH--RPPRCIHVYNKNG--------------VGKVGDRILLAIKGQKK-
F7GB07_MONDO          VVDNSALGNTSYH--RPPRCIHVYNKTG--------------VGKVGDRILLAIKGQKK-
RM14_DANRE            VVDNSTLGNAHHH--RPPKVIHVYNKNG--------------VGKVGDRVLLAIKGQKK-
F4W3T1_ACREC          VVDNSEIGRQAMMEGRPPRCIHVYNKLG--------------VGYIGDRILVAIRGEKK-
A0A158NB27_ATTCE      VVDNSEIGKQAMMEGRPPRCIHVYNKHG--------------VGYIGDRILVAIRGEKK-
E2C6B6_HARSA          VVDNSEIGKQAMLEGRPPRCIHVYNKKG--------------IGLIGDKILVAIKGEMR-
B4JL96_DROGR          VVDNSDLGKRAMAEGRPPRCIHVYNKRG--------------VGLIGDKVLVAIKGQMK-
E0VMC0_PEDHC          VVDNSEIGKAAMMQGKPPKCIHVYNKKG--------------IGTVGDKVLVAILGEKK-
T1F6R9_HELRO          VVDNSLIGRAAELAGKPGRIIHVYNKTG--------------IGKLGDKVLLAIQGQKK-
T1L5E8_TETUR          VVDNSALGKQAMLDGKPPKIIGIYRKPR--------------IAELGTKVIVAIKGQKK-
T1JPY1_TETUR          VVDNSALGKQAMLDGKPPKIIGIYRKPR--------------IAELGTKVIVAIKGQKK-
Q20430_CAEEL          VVDNSALGKEADTTGKLPYCIHVYKQGRRA--------KHMPHAELGDKILVAIRGQMR-
RL14H_NYCOV           VTDNS--------GAIAVRVFQTYPGN-------------RKIVPVGSIVRHSVKKIHRI
A7AXG7_BABBO          PSDNS--------GFKKAKCLGSLGNV--------------KKLHLNSICISVVKSCKKK
                                          .                                       

RM14_PARTE            C----------TIKRG------KKKKAIIVRHAFGRLKR-DGSFSKFSSNVCVLLKKR--
RM14_TETPY            N----------WVPKK------TKLKAIIVTLKKELKKI-DGSYIKFRTNNVVLLKKR--
RL14_DEHM1            ---------DAQAKSG------TVVKAVVVRITKPYARP-DGSYIKFDDNAAVILND---
RL14_KORVE            ---------DGTAKKG------TVVKAVIVRTHKEHRRK-DGTYIRFDTNAAVLIND---
RL14_LEPIC            FGLKDST--GKKVHNK------AVQRAVVVRTTKEIRRP-DGSYIRFDDNACAIIDD---
RL14_CHLCH            ---------GGIVKKK------DVCKAVVVRAVKESRRK-DGSYIRFDENAVVILNA---
RL14_FLAPJ            ---------NGSVKKG------SVSTAVVVRTKKEVRRA-DGSYIRFDDNACVLLNA---
RL14_SULMW            ---------GSSVKKG------QLYKAVVVRTKKKIRRK-DGSYIRFDDNACVLLTN---
RL14_RUBXD            ---------GGAVKKG------DVVRAVVVRTKKETRRE-DGSYIRFGENAGVLINS---
RL14_SALRD            ---------SGEINKG------DVSRAVVVRTAKETRRE-DGTYIRFDENAAVLINQ---
RL14_BIFLO            ---------GGSVKKG------DVVKAVVVRTVKESRRA-DGSYIKFDENAAVILGS---
RL14_MYCHJ            G----------MLKEG------QVVKALIVRSTYGLRRK-NGTHIKFDDNAVVIIK----
RL14_MYCA5            G----------FVKEG------QVLKAVIVRTKRGLMRE-NGSHIRFDDNAVVLIK----
RL14_MYCS5            G----------DVKAG------QVLKAVVVRTKRNTYRS-NGSYIRFDDNAVVILK----
RL14_MESFL            G----------AVKKG------QVVKAVIVRTTRELKRE-DGTYIRFSENAVVIIK----
RL14_MYCGA            G----------TVKKG------QVLFAVIVRTKKGAQRR-DGTHLAFDDNACVIIKN---
RL14_UREP2            G----------LIAKG------QMAKAVIVRTKKSIRRE-SGLLIRFDENACVLIK----
RL14_ONYPE            G----------TVKKH------DVLKAVIVRTKKGLRRK-NGSYIKFDDNAVVLLK----
RL14_ACHLI            G----------TVKKG------DVVKAVVVRTKHGIRRA-DGSTIKFDDNAAVIIK----
RL14_OENOB            G----------TVKKG------DVVKAVIVRTVSGVHRI-DGSYIKFDENAAVIVR----
RL14_CLONN            G----------VVKKG------EVVKAVIVRTKRGVRRA-DGSYIKFDENAAVVIK----
RL14_PELTS            G----------VVKKG------DVVRAVVVRTKKEVRRP-DGSYIKFDENAAVIIKD---
RL14_SYNWW            G----------VVKKG------DLVKAVVVRTKKEIRRA-DGSYIAFSENAAVIIDD---
RL14_CORJK            G----------TVKAG------DIVKAVIVRAKKETRRP-DGSYIAFDENAAVIIKAN--
RL14_TROWT            SS---------AVKKG------DVVKAVIVRSTKEVRRT-DGSYIRFDDNAAVILRP---
RL14_ROSS1            G----------AVKKG------EVVRAVIVRTAKEYGRP-DGSHIRFDDNAAVIIGK---
RL14_THEP1            S----------DVKKG------DVVRAVIVRTKKEIRRS-DGTYIRFDDNAAVLIDK---
RL14_FUSNN            G----------NVKKG------DIVKAVIVRTRKETRRD-DGSYIKFDDNAGVVINN---
RL14_AKKM8            A----------SVKKG------TVVKAVVVRTAAPIRRD-DGSVLRFDGNAVVIIDK---
RL14_OPITP            A----------TVKKG------EVHKAVVVRTKAPVRRA-DGSYLRFDSNAVVIIDP---
RL14_RHOBA            S----------EVKKK------AVVRAVIVRVKQPTRRP-DGSYIRFDSNAVVLVDK---
RK14_HELSJ            T----------SVKKS------EIVRAVIVRTRTTIHRA-NGMHLKFNENAAVLVTK---
RK14_CYAM1            M----------MVKKS------QIFRAVVVRTKQAVRRA-NGMHIRFDENAVVLIDQ---
RK14_EUGLO            K----------IIKKS------MIVKALIIRTTKPLYRKHNNMYISFNENAAIIINT---
RK14_EUGGR            M----------VVKKS------DIVKAVIVRTVKGVRRE-SGMAIRFDENAAVIINN---
RK14_EMIHU            L----------TVKRS------DVVRAVIVRTKQSIRRK-DGSRLRFDDNATVIINK---
RK14_THAPS            M----------PIKKS------DVVRAIIVRTSKTIRRA-DGMYIRFDDNAAVIVNM---
RK14_CYACA            M----------PVKKS------DVVRAVVVRIKKTINRK-NFFSVRFDDNAAVIIGS---
RK14_BIGNA            T----------PLKKS------DIVRAVVVRTRKGLKRK-NGIYIRFDDNAAVIVNK---
RK14_SORBI            M----------PLERS------EVIRAVIVRTRKEFKGD-DGIIIRYDDNAAVIIDQ---
RK14_WELMI            T----------KMEES------EIVRAVIIRTSKEFQRD-DGMRIRSDDNAAIIIDQ---
RK14_PELHO            S----------ALKRS------EVIKAVIVRTCKEFKCD-DGMIIRYDDNAAVVINK---
RK14_HUPLU            M----------PLRKS------EIVRAVVVRTCKELKRN-NGMIIQFDDNAAVIINQ---
RK14_PSINU            M----------PVKKS------EIVRAVIVRTRKEMKRD-NGIIIRFDDNAAVVINR---
RK14_ADICA            M----------FLKRS------EVVRAVVVRTRRGLKRR-NGMVLEFDDNAAVIINQ---
RK14_ANEMR            M----------PTKKS------EIVRAVIARTRKEIGRT-DGSVIKFDDNAAVTINR---
RK14_CHLRE            M----------PVKRS------DIVRAVIVRTRKGIRRE-NGMAIRFDDNAAVIINK---
RK14_GRATL            M----------PIKKS------DIIRAVIVRTKKTIRRN-DGMSIRFDDNAAVIINQ---
RL14_PROMP            M----------GVKKS------DVVKAVIVRTRHTLRRN-TGNSIRFDDNAAVLINE---
RL14_GLOVI            M----------GVKKS------EVVRAVVVRTRQAIRRD-NGMVIRFDDNAAVIIDK---
RL14_DEIRA            G----------AVKAG------DVVKAVVVRTSHAIKRA-DGSTIRFDRNAAVIINN---
RL14_CHLPN            S----------SIKKG------DVIKAVIVRTRRHITRK-DGSTLKFDTNSCVIIDD---
RL14_PARUW            G----------SVKKG------DVVKVVIIRTKSYIKRK-DGTKIRFDTNSCVLIDD---
RL14_BORBU            S----------SVKKG------DVYKAVIVRTSKEVRRK-NGTYVRFDDNACVILDA---
RL14_TREDE            S----------VIKKG------TVEKAVIVRVSKEYRRP-DGTYIRFDDNACVIVDD---
RL14_HELPJ            G----------KVKFG------LVVKTVVVRTKKEIQRK-NGSLVRFDDNAAVILDA---
RL14_LAWIP            S----------KVKKG------EVLQAVIVRTKKEVRRM-DGSYIKFDSNAAVLLSK---
RL14_DESPS            A----------KVKKG------DVMKAVVVRTAKENRRP-DDTWVKFDENAAVMLGA---
RL14_SORC5            T----------KVKKG------ETARAVVVRTAREYQRS-DGSYIKFDGNSAVLINK---
RL14_PELCD            S----------RVKKG------DVVRAVIVRTAKEVPRP-DGSAIRFDKNSAVVVNQ---
RL14_XANP2            G----------RVKKG------DVMKAVVVRTAKDIRRV-DGSVIRFDRNAAVLINNK--
RL14_SPHWW            G----------KVKKG------DVHRAVIVRTAKDIHRP-DGSTIRFDGNAAVLINKN--
RM14_RECAM            K----------KVKKG------DVKKAIIVRTKKPIYRK-DGSTISFENNAVVLINEQ--
RL14_PELUB            G----------KVKKG------SVHKAVVVRVKKGIHRE-DGSKVRFDNNAAVLVDDK--
RL14_BLOFL            A----------KVKKG------DVLQAVIVRTKKGIRRI-DGSIIRFDNNACVLLNDT--
RL14_SACD2            G----------KVKKG------QVMNAVVVRTKKGVRRA-DGSLIRFDDNAAVILNAQ--
RL14_NITEC            G----------RIKKG------EVYNAVIVRTAKGIRRS-DGSLVKFDTNAAVILNNK--
RL14_VESOH            G----------KVKKG------DVYDAVVVRTAHGVRRS-DGSRIRFDSNAIVLLNTK--
RL14_ORITI            G----------KVKKG------EVCKALIIRTKCGVTRH-DGSNIKFDSNDVVLLNK---
RL14_RICAH            G----------KVKKG------DVYKGVIVRTKTGVVRP-DGSTIKFDKNALVLLNK---
RL14_SULSY            G----------TAKKG------KVYKAVVVRTKKEVARP-DGSYVKADDNAVVLLNN---
RL14_AQUAE            G----------NAKKG------KIYRAIIVRTAKEVRRP-DGSYIKFDDNACVLLNQ---
RL14_ANAPZ            G----------RVTKG------KVYKAVIVRVKGPIRRL-DGSIIRFSSNAVVLVND---
RL14_WOLTR            G----------KVEKG------KVYRAVVVRVKNCIRKS-DNSVIRFSSNAVVLVNN---
RL14_NEOSM            G----------KVSAG------SIHRAVVVRVK---KRS-SSSIVVFGDNAVVLLNK---
RM14_ACACA            K----------NIKKSKEVKKGQVCSAVILRTIKGVKRW-GNFFLRSSSNSVALINK---
RL14_CARRP            S----------KIKKS------QVLKAMIIRSKTGIKRL-DGTIIKFNDNSVILLNN---
RM14_DICDI            --KRKGGKYKLKVKKS------DVCYAVIVKSKQP-VRRKSGIIVNAGENGVILLTK---
RM38_YEAST            TQNITGTANTNRVKKG------DICHAIVVRSKQRNMCRKDGSTVAFGDTACVLINKN--
RM38_SCHPO            --SGSSVTAANKVKRG------DIHHAIIVRTKSP-VRRPDGRYVRFDDNACVLVNK---
RL14_METKA            -----------DMRKE-------VVNAVIVRQRKEYRRP-DGTRVKFEDNAAVIVTPD-G
RL14_METS3            -----------DMRRE-------VVNAVVIRQKKEYMRA-DGLRVKFEDNAAVIITPE-G
RL14_METM5            -----------EMRKQ-------VLPAIIIRQKKEYKRA-DGTRVKFEDNAAVIVTPE-G
RL14_METJA            -----------EMRKQ-------VLPAVVIRQRKEIRRP-DGTRVKFADNAVVIVTPD-G
RL14_THEAC            -----------EMRSK-------VVYAVVIRQKRPYRRP-DGTMVQFEDNAAVLVTPD-G
RL14_PYRAB            -----------DMRHQ-------VVRAVIIRQRKEYRRL-DGMRIKFEDNAAVIVTPE-G
RL14_CENSY            -----------ELRKQ-------VHGAVIIRQKYPVRRL-NGVRVAFEDNAAVLTTPE-G
RL14_HYPBU            -----------EMRKQ-------VVRAIVIRQRRPYRRP-DGTWIAFEDNAVVIVSPD-G
RL14_STAMF            -----------EMRKQ-------VVKAVIVRQKRPFRRP-DGTWVAFEDNAVAIVTPE-G
RL14_AERPE            -----------QMRRQ-------VVYAVVVRQRRPFRRP-DGTWVSFEDNAVVIVNPD-G
RL14_SULAC            -----------DVRKQ-------KFKAVIVRQRMPFRRP-DGTWISFEDNAVVIINPD-G
RL14_PYRAE            -----------ELRKQ-------IFRAIVVRQRRPYRRP-DGTWVAFEDNAVVIVTPE-G
RL14_THEPD            -----------ELRKQ-------VMRAIVIRQRRPYRRP-DGSWIAFEDNAVVIITPE-G
RL14_KORCO            -----------DLMHK-------PFKAIVVRQRMPYRRK-NGQWVVFEDNAAVLVNDD-G
RL14_METAC            -----------EMRKQ-------VLLAVVVRQKQEFRRP-DGLHVSFEDNAMVITDEE-G
RL14_METTP            -----------EMRKQ-------IFNAVIIRQKKEFRRP-DGLRVKFEDNAAVITDDA-G
RL14_METAR            -----------EMRKT-------IVRCVVIRQKKEYRRP-SGLRVSFEDNACVLVDDN-N
RL14_METB6            -----------DMRKK-------LVRAVVIRQKKEMRRP-NGLRVSFDDNAVVVVDEK-N
RL14_METMJ            -----------DMRRK-------LEKAVVIRQKKEIRRP-NGIRLSFEDNAMVLINER-G
RL14_HALMA            -----------EMRRQ-------VLEAVVVRQRKPIRRP-DGTRVKFEDNAAVIVDEN-E
RL14_NANEQ            -----------DMIGQ-------IFKAVVVRMKKEWRRR-DGTRIKFEDNAVALLKDDYG
RL23_BOVIN            -----------ELRKK-------VHPAVVIRQRKSYRRK-DGVFLYFEDNAGVIVNN-KG
G3I5G8_CRIGR          -----------ELRKK-------VHPAVVIRQQKSYQRK-DGVFLYFEDNAGVIVNN-KG
H2Y1Y8_CIOIN          -----------ELRKK-------VHPAVIIRQSKSYRRK-HGQMIYFEDNAGVIVNQ-KG
F6HZQ0_VITVI          -----------DLRKK-------VMPAVIVRQRKPWRRK-DGVYMYFEDNAGVIVNP-KG
G4V5P4_SCHMA          -----------ELRKK-------VLYAVVVRQRKAFRRK-NGVFIYFEDNAGVIVNN-KG
L9LD00_TUPCH          -----------ELRKK-------VHPGVNS-TTKVIPEK-RWHIFYFEDNAGVIVSN-KG
K7N2C3_SOYBN          -----------NLRKK-------VLPAVIVRQRNPWRRK-DGAYMYFEDNASVIVNSGRN
RL23_TETTS            -----------KLRKK-------VLQAIVIRQRRPWRRR-DGVFIYFEDNAGVIANP-KG
RL23_DICDI            -----------ELRKK-------VCTGLVVRQRKHWKRK-DGVYIYFEDNAGVMCNP-KG
C4JJD1_UNCRE          -----------ELRKK-------VMPAVVVRQSKPWRRP-DGIYLYFEDNAGVIVNA-KG
F2S3Q1_TRIT1          -----------ELRKK-------VMPAVVVRQSKPWKRP-DGVFLYFEDNAGVIVNA-KG
M1D3Y4_SOLTU          -----------DLRKK-------VMPAVIVRQGKPWRRK-VGVFMYFEDNAGVIVNP-KG
RL23_TRYCR            -----------ELRRK-------VLNAVIIRQRKSWRRK-DGTVIYFEDNAGVIVNS-QG
RL23_ENCCU            -----------ELRKK-------VHYAILIRQKKIWRRT-DGSHIMFEDNAAVLINN-KG
A7ATG9_BABBO          CTF--------SNKTP---------RGIIIRRRKETMRR-DGMMFKFDENAFVVIAN---
C5LDI6_PERM5          YR---------GEKLP---------RGIIVRTKQPIKRK-DGSTIKFDENAFIAISN---
Q25812_PLAF7          LYK--------KSDKC---------KGILVQQKKFLNFK-KYYSIKFNKNAVIIINN---
RM14_BOVIN            -------------------------KALIVGHRMP---GPTMTPR-FDSNNVVLIEDN--
F7GB07_MONDO          -------------------------KALIVGHRMP---GPCMTPR-FDSNNVVLIEDN--
RM14_DANRE            -------------------------KAIIVGHKMP---GARMTPR-FDSNNVVLIEDN--
F4W3T1_ACREC          -------------------------KGILVGLKQQ---QAPKVPK-FDSNNLVLIDDN--
A0A158NB27_ATTCE      -------------------------KGILVGLKQQ---QAPKVPK-FDSNNLVLIDDN--
E2C6B6_HARSA          -------------------------KGILVGLKQK---QLSKVPK-FDSNNLVLIDNN--
B4JL96_DROGR          -------------------------KGILVGLKQK---QRLKQPQ-FDSNNLVLIDDN--
E0VMC0_PEDHC          -------------------------KAIIIGCKQK---QLPFIPR-FDSNNIVLVDDY--
T1F6R9_HELRO          -------------------------RGYLVGLKQN---QDRMVPK-YDSNNVVLVEDN--
T1L5E8_TETUR          -------------------------KGVVVGLVRL---QKPFVPR-FDSNNMVLMDDK--
T1JPY1_TETUR          -------------------------KGVVVGLVRL---QKPFVPR-FDSNNMVLMDDK--
Q20430_CAEEL          -------------------------KAYVVGANTHVHYRKHGVPV-TDQNMIVLLDEE--
RL14H_NYCOV           LPWGKQLR---GRRKR-IICRSQCGRSWIVQTSYQIPYI-DGATLRFSKNRVLLVKRK--
A7AXG7_BABBO          S---------RLVRKS------DIIKTLVTHTKIYNFNK--YRGVKFHNNSLILLNKKYS
                                                                       .          

RM14_PARTE            -------------TAPLGREIKGPIFYGVK------------------------------
RM14_TETPY            -------------LTPKGKILMGPVSSNLR------------------------------
RL14_DEHM1            ---------KMEPKGTRI---FGPVARELR------------------------------
RL14_KORVE            ---------TGEPVGTRV---FGPVARELR------------------------------
RL14_LEPIC            ---------KGNPKGTRI---FGPVARELR------------------------------
RL14_CHLCH            ---------QGEPRGTRI---FGPVARELR------------------------------
RL14_FLAPJ            ---------AGEMRGTRV---FGPVARELR------------------------------
RL14_SULMW            ---------TGEMKGTRI---LGPVSRELR------------------------------
RL14_RUBXD            ---------DGSPRGTRI---FGPVARELR------------------------------
RL14_SALRD            ---------EEEPVGTRV---FGPVAREVR------------------------------
RL14_BIFLO            ---------GREPKGTRI---FGPVGRELR------------------------------
RL14_MYCHJ            --------EDGTPRGTRV---FGPIAREIR------------------------------
RL14_MYCA5            --------EDGTLRGTRV---FGPVARELR------------------------------
RL14_MYCS5            --------DDGTPVGTRV---FGPVAREIR------------------------------
RL14_MESFL            --------EDKSPRGTRI---FGPIAREIK------------------------------
RL14_MYCGA            -------REDFAPRGTRI---FGPVARELR------------------------------
RL14_UREP2            --------EDKTPRGSRI---FGPVAREIR------------------------------
RL14_ONYPE            --------EDLNIIGTRI---FGPVVRELS------------------------------
RL14_ACHLI            --------DDMNPRGTRI---FGPVARELR------------------------------
RL14_OENOB            --------DDKSPVGTRI---FGPVARELR------------------------------
RL14_CLONN            --------DDKQPRGTRI---FGPIARELRE-----------------------------
RL14_PELTS            ---------DKSPRGTRI---FGPVARELR------------------------------
RL14_SYNWW            ---------NNNPKGTRI---FGPVARELR------------------------------
RL14_CORJK            ---------DNDPRGTRI---FGPVARELR------------------------------
RL14_TROWT            ---------DNDPRGTRI---FGPVARELR------------------------------
RL14_ROSS1            ---------DNNPRGTRI---FGPVARELR------------------------------
RL14_THEP1            ---------FNAPRGTRI---FGPVARELR------------------------------
RL14_FUSNN            ---------NNEPRATRI---FGPVARELR------------------------------
RL14_AKKM8            ---------DNNPRGTRI---FGPVARELR------------------------------
RL14_OPITP            ---------TNNPRGTRI---FGPVARELR------------------------------
RL14_RHOBA            ---------DRNPRGTRI---FGAVARELR------------------------------
RK14_HELSJ            ---------ELHPKGTRL---FGPIPYECS------------------------------
RK14_CYAM1            ---------ENNPKGTRV---FGPIARELR------------------------------
RK14_EUGLO            ---------DNTLKGTNI---FGPVPRELM------------------------------
RK14_EUGGR            ---------DRSPKGTRI---FGPIARELR------------------------------
RK14_EMIHU            ---------ENNPRGTRV---FGPIARELK------------------------------
RK14_THAPS            ---------ENNPRGTRV---FGPVAREIR------------------------------
RK14_CYACA            ---------DGNPKGTRI---FGPVARELR------------------------------
RK14_BIGNA            ---------ENNPRGTRI---FGPVARELR------------------------------
RK14_SORBI            ---------KGNPKGTRV---FGAVAEELR------------------------------
RK14_WELMI            ---------KGNPKGTRV---FGPVLQELR------------------------------
RK14_PELHO            ---------DRNPVGTRI---FGAIPLELH------------------------------
RK14_HUPLU            ---------EGNPRGTRV---FGPVARESR------------------------------
RK14_PSINU            ---------EGNLKGTRV---HGPVDRELW------------------------------
RK14_ADICA            ---------EGNPRGTRI---FGPVARELR------------------------------
RK14_ANEMR            ---------ENNPRGTRV---FGPIARELR------------------------------
RK14_CHLRE            ---------EGNPRGTRV---FGPIARELR------------------------------
RK14_GRATL            ---------ENNPRGTRV---FGPIAKELR------------------------------
RL14_PROMP            ---------DKNPKGTRV---FGPVARELR------------------------------
RL14_GLOVI            ---------NGNPRGTRV---FGPVARELR------------------------------
RL14_DEIRA            ---------QGEPRGTRV---FGPVARELR------------------------------
RL14_CHLPN            ---------KGNPKGTRI---FGPVAREIR------------------------------
RL14_PARUW            ---------KKNPKGTRI---FGPVAREVR------------------------------
RL14_BORBU            ---------NLSPRGKRV---FGPVARELR------------------------------
RL14_TREDE            ---------NKNPKGKRI---FGPVARELR------------------------------
RL14_HELPJ            ---------KKDPVGTRI---FGPVSREVR------------------------------
RL14_LAWIP            ---------QGEPVGTRI---FGPVARELR------------------------------
RL14_DESPS            ---------SGEPVGTRI---FGPVARELR------------------------------
RL14_SORC5            ---------EKEPIGTRI---FGPVARELR------------------------------
RL14_PELCD            ---------AGEPIGTRI---FGPVARELR------------------------------
RL14_XANP2            -------R--AQSWDQTI---ALSIARRNE------------------------------
RL14_SPHWW            -------S--GEPIGTRI---FGPVVRELR------------------------------
RM14_RECAM            ----------GIPIGTRI---LGPVTKELR------------------------------
RL14_PELUB            ----------GEPVGTRI---FGPVTRELR------------------------------
RL14_BLOFL            -------N--MQPLGTRI---FGPVTRELR------------------------------
RL14_SACD2            -------N---APVGTRI---FGPVTRELR------------------------------
RL14_NITEC            -------L---EPIGTRI---FGPVTRELR------------------------------
RL14_VESOH            -------R---EPIGTRI---FGPVTRELR------------------------------
RL14_ORITI            ---------QGEPFGTRI---FGSVPRELR------------------------------
RL14_RICAH            ---------QDEPIGTRV---FGPVTRELR------------------------------
RL14_SULSY            ---------QLEPIGTRI---LGPVCRELR------------------------------
RL14_AQUAE            ---------YGEPLGTRV---LGPIAREVR------------------------------
RL14_ANAPZ            ---------QGDPLGTRV---FGPVRKFPV------------------------------
RL14_WOLTR            ---------QGEPLGTRV---FGPVKKLPS------------------------------
RL14_NEOSM            ---------QNEMIGTRV---FGPTDSLLR------------------------------
RM14_ACACA            ---------YCLPIGSRL---LGPVFREIRV-----------------------------
RL14_CARRP            ---------NEQIISTRV---FGIILRELK------------------------------
RM14_DICDI            ---------TKEPIGTRL---TGVVFKEVQ------------------------------
RM38_YEAST            ---------TGEPLGTRIMANDGCVDRTLK------------------------------
RM38_SCHPO            ---------ECEPLGTRI---LSVVANELR------------------------------
RL14_METKA            A--------------PRGSEIRGPVAKEA-------------------------------
RL14_METS3            I--------------LKGSEVRGPVAKEA-------------------------------
RL14_METM5            T--------------PKGSEIKGPVSKEA-------------------------------
RL14_METJA            N--------------PKGSDIKGPVAKEA-------------------------------
RL14_THEAC            E--------------VRGSEIKGPVAREA-------------------------------
RL14_PYRAB            V--------------PRGTEIRGPVAREA-------------------------------
RL14_CENSY            E--------------MKGTDIKGPVAAEA-------------------------------
RL14_HYPBU            T--------------PKGSEIRGPVAREA-------------------------------
RL14_STAMF            T--------------PKGSEIRGPIAKEV-------------------------------
RL14_AERPE            T--------------PRGSEVRGPIAREA-------------------------------
RL14_SULAC            T--------------PKGTEVRGPIAREA-------------------------------
RL14_PYRAE            D--------------PKGSEIHGPVAMEA-------------------------------
RL14_THEPD            E--------------PKGTEIRGPLAKEA-------------------------------
RL14_KORCO            T--------------PRGSEFRGPIAKEA-------------------------------
RL14_METAC            I--------------PKGTDIKGPVAREV-------------------------------
RL14_METTP            V--------------PKGSEIKGPVAREV-------------------------------
RL14_METAR            D--------------PKGTEIKGPVAREV-------------------------------
RL14_METB6            E--------------PKGTEIKGPVAREV-------------------------------
RL14_METMJ            E--------------PKGTEIKGAVPREI-------------------------------
RL14_HALMA            D--------------PRGTELKGPIAREV-------------------------------
RL14_NANEQ            T--------------PKGTIIKTPIAKEV-------------------------------
RL23_BOVIN            E--------------MKGSAITGPVAKEC-------------------------------
G3I5G8_CRIGR          K--------------MKGSAVTGPVAKEC-------------------------------
H2Y1Y8_CIOIN          E--------------MKG------------------------------------------
F6HZQ0_VITVI          E--------------MKAIRGHNPASSVF-------------------------------
G4V5P4_SCHMA          E--------------LKGEV----------------------------------------
L9LD00_TUPCH          E--------------RKGSAITGPVCTDL-------------------------------
K7N2C3_SOYBN          ERYEIHFSNCVDILHLTCSALTGPISKEC-------------------------------
RL23_TETTS            E--------------MKGSQITGPVAKEC-------------------------------
RL23_DICDI            E--------------VKGN-ILGPVAKEC-------------------------------
C4JJD1_UNCRE          E--------------MKGSAITGPVGKEA-------------------------------
F2S3Q1_TRIT1          E--------------MKGSAITGPVGKEA-------------------------------
M1D3Y4_SOLTU          E--------------MKGSAMTGPIGKGA-------------------------------
RL23_TRYCR            R-------------DGRVSGIAGPVAKEAG------------------------------
RL23_ENCCU            E--------------LRGAQIAGPVPREV-------------------------------
A7ATG9_BABBO          ----------NKLVASKI---RGPVL----------------------------------
C5LDI6_PERM5          ----------NKPLGNKV---KGPVTFFRLKISMTSQDNVVRFGGVPEHFNAPFQRLLQR
Q25812_PLAF7          ----------KLNFVGTK---SNNYI----------------------------------
RM14_BOVIN            ----------GNPVGTRI---KTPIPTSLR------------------------------
F7GB07_MONDO          ----------GNPVGTRI---KVPIPTSLR------------------------------
RM14_DANRE            ----------GNPTGTRI---KAPLPTHLR------------------------------
F4W3T1_ACREC          ----------GTPLGTRI---QVPIPHILRTKMKEKTH----------------------
A0A158NB27_ATTCE      ----------GTPLGTRI---QVPIPHILRTKMKEKTH----------------------
E2C6B6_HARSA          ----------GTPLGTRI---HVPIPHILRTKLKEKTH----------------------
B4JL96_DROGR          ----------GSPLGTRI---HVPIPTVLRTILKEKTL----------------------
E0VMC0_PEDHC          ----------GTPLGNRI---HVPLPHVLRTVLKEKSF----------------------
T1F6R9_HELRO          ----------GNPTGTRI---RVPIPSCLR------------------------------
T1L5E8_TETUR          ----------GNPLGTRI---LVPIPNLIR------------------------------
T1JPY1_TETUR          ----------GNPLGTRI---LVPIPNLIR------------------------------
Q20430_CAEEL          ----------GNPLGNRI---TAPIPTKLMAN----------------------------
RL14H_NYCOV           ----------RGIRIYRGRRIYGLTTRAVN------------------------------
A7AXG7_BABBO          TSYSID--DRNRFKDTSSIKLIGIIPTAVL------------------------------
                                                                                  

RM14_PARTE            ----KKKFVASF-----------PGRV---------------------------------
RM14_TETPY            ----RKRFLTSF-----------CGSI---------------------------------
RL14_DEHM1            ----DKKFTKIL---------SLAPEVL--------------------------------
RL14_KORVE            ----EKKFLKIV---------SLAPEVL--------------------------------
RL14_LEPIC            ----DKKYAKII---------SLAPEVL--------------------------------
RL14_CHLCH            ----DKRYMKIV---------SLAPEVL--------------------------------
RL14_FLAPJ            ----EKQFMKIV---------SLAPEVL--------------------------------
RL14_SULMW            ----DKEYTKIV---------SLATEVL--------------------------------
RL14_RUBXD            ----EKGYTRII---------SLAPEVL--------------------------------
RL14_SALRD            ----EKQFMRIV---------SLAPEVL--------------------------------
RL14_BIFLO            ----EHKFMKIV---------SLAPEVI--------------------------------
RL14_MYCHJ            ----EKGYLKIA---------SLAQEVL--------------------------------
RL14_MYCA5            ----DKGYLKII---------SLAPEVL--------------------------------
RL14_MYCS5            ----EK-YPKIV---------SLALEVL--------------------------------
RL14_MESFL            ----EAGFAKIA---------SLAPEVL--------------------------------
RL14_MYCGA            ----DKGFNRIV---------SLASEVL--------------------------------
RL14_UREP2            ----DRGYTKIA---------SLAPEVL--------------------------------
RL14_ONYPE            ----DKKFSKIV---------SLAQLVL--------------------------------
RL14_ACHLI            ----EKNFMKIV---------SLAPEVL--------------------------------
RL14_OENOB            ----DNNYMRIV---------SLAPEVL--------------------------------
RL14_CLONN            ---KDKEFNKIL---------SLAPEVL--------------------------------
RL14_PELTS            ----DRDFMKIV---------SLAPEVI--------------------------------
RL14_SYNWW            ----EKNFMKII---------SLAPEVL--------------------------------
RL14_CORJK            ----DKKFMKIV---------SLAPEVL--------------------------------
RL14_TROWT            ----DRKFTRII---------SLAPEVV--------------------------------
RL14_ROSS1            ----ERAFMKII---------SLAPEVL--------------------------------
RL14_THEP1            ----EKGFMKIV---------SLAPEVW--------------------------------
RL14_FUSNN            ----ARNFMKIL---------SLAIEVI--------------------------------
RL14_AKKM8            ----EKKFMKIV---------SLAPEVL--------------------------------
RL14_OPITP            ----AKNFMKII---------SLAPEVL--------------------------------
RL14_RHOBA            ----ENNFMKIV---------SLANEVV--------------------------------
RK14_HELSJ            ----EAGLNSII---------SLAPYII--------------------------------
RK14_CYAM1            ----EANFMKIV---------SLAPEVI--------------------------------
RK14_EUGLO            ----NIGFTNLN---------STAKLII--------------------------------
RK14_EUGGR            ----EKEFVKIM---------SLAPEVV--------------------------------
RK14_EMIHU            ----DNGFTKIV---------SLAPEVL--------------------------------
RK14_THAPS            ----DKNFSKIV---------SLAPEVL--------------------------------
RK14_CYACA            ----DKNFSKIA---------SLAQEVV--------------------------------
RK14_BIGNA            ----DKSFMKIV---------SLAPEVI--------------------------------
RK14_SORBI            ----ELNFTKIV---------SLAPEVL--------------------------------
RK14_WELMI            ----QYNFTKII---------SLAPEVL--------------------------------
RK14_PELHO            ----Q-NFDKIV---------SLAREVI--------------------------------
RK14_HUPLU            ----EFNFTKIV---------SLAPEVL--------------------------------
RK14_PSINU            ----KKNFTKIV---------SLAPEAF--------------------------------
RK14_ADICA            ----ECNFARVV---------SLAPEVL--------------------------------
RK14_ANEMR            ----GSNFTKII---------SLAPEVL--------------------------------
RK14_CHLRE            ----DKNFTKIV---------SLAPEVL--------------------------------
RK14_GRATL            ----DKNFSKII---------SLAAEVV--------------------------------
RL14_PROMP            ----DKNFTKIV---------SLAPEVI--------------------------------
RL14_GLOVI            ----EKNFTKII---------SLAPEVL--------------------------------
RL14_DEIRA            ----DRRFMKIV---------SLAPEVL--------------------------------
RL14_CHLPN            ----DRGFIKIS---------SLAPEVI--------------------------------
RL14_PARUW            ----DRDFLKIS---------SLAPEVI--------------------------------
RL14_BORBU            ----DANFMKVV---------SLASEVI--------------------------------
RL14_TREDE            ----DHDFMKIV---------SLAPEVL--------------------------------
RL14_HELPJ            ----YANFMKII---------SLAPEVV--------------------------------
RL14_LAWIP            ----ARNFMKII---------SLAPEVL--------------------------------
RL14_DESPS            ----NQGFMKII---------SLAPEVL--------------------------------
RL14_SORC5            ----AKKFMKII---------SLAPEVL--------------------------------
RL14_PELCD            ----AQRYMKIV---------SLAPEVL--------------------------------
RL14_XANP2            ----GYTHSQHSNQREGGERIQAQPSPPHARRAVKTSFCR--------------------
RL14_SPHWW            ----AKNHMKI---------ISLAPEVL--------------------------------
RM14_RECAM            ----KKKLVRI---------VSLASNVL--------------------------------
RL14_PELUB            ----SRGQMKI---------ISLAPEVL--------------------------------
RL14_BLOFL            ----YANFVRI---------ISLAPEVL--------------------------------
RL14_SACD2            ----GEKFMKI---------ISLAPEVL--------------------------------
RL14_NITEC            ----TAKFMKI---------VSLAPEVI--------------------------------
RL14_VESOH            ----SAQFMKI---------VSLAPEVL--------------------------------
RL14_ORITI            ----VKNFSKIV---------SLAEEVL--------------------------------
RL14_RICAH            ----TKKYVRIM---------SLAEEVL--------------------------------
RL14_SULSY            ----SKGFYRIV---------SLAPEVI--------------------------------
RL14_AQUAE            ----NKGFTKIA---------SLAPEVV--------------------------------
RL14_ANAPZ            ---GE--FTKVM---------SLAVEVL--------------------------------
RL14_WOLTR            ---GS--FMKIM---------SLAVEVL--------------------------------
RL14_NEOSM            ---RNKGFAKIS---------SLSQEVFQ-------------------------------
RM14_ACACA            ----NLKFSKII---------SIAQVTL--------------------------------
RL14_CARRP            ----NEKFAKLI---------SLSNEII--------------------------------
RM14_DICDI            ----RTGLLKNV---------SISKYII--------------------------------
RM38_YEAST            ----DKGYNKIC---------SLASRVI--------------------------------
RM38_SCHPO            ----TKHHTKIA---------SLAPRTI--------------------------------
RL14_METKA            ----AERWPRIG---------SIASIIV--------------------------------
RL14_METS3            ----ADRWPSVG---------SAASILV--------------------------------
RL14_METM5            ----AERWPGVS---------RLAKIIH--------------------------------
RL14_METJA            ----AERWPGIA---------RIAKIII--------------------------------
RL14_THEAC            ----AERWPRIA---------AIASIIV--------------------------------
RL14_PYRAB            ----AERWVRIG---------SIASIIV--------------------------------
RL14_CENSY            ----SEKWPRLA---------NLASMVV--------------------------------
RL14_HYPBU            ----AERWPKVA---------NIASIII--------------------------------
RL14_STAMF            ----AERWPQLA---------NIATIVV--------------------------------
RL14_AERPE            ----AERWPRVA---------KIATMIV--------------------------------
RL14_SULAC            ----AERWPKIA---------SVATMVI--------------------------------
RL14_PYRAE            ----TLRWPTIA---------NLASIVV--------------------------------
RL14_THEPD            ----AERWPKLS---------AMASIIV--------------------------------
RL14_KORCO            ----IERWPSLS---------VISAQVV--------------------------------
RL14_METAC            ----AERFPKIG---------TTASIIV--------------------------------
RL14_METTP            ----AERFGKIA---------SSAAIIV--------------------------------
RL14_METAR            ----AERYAKIG---------STATIIV--------------------------------
RL14_METB6            ----AERYPKLG---------SMATIIV--------------------------------
RL14_METMJ            ----AERFPKIA---------SMATTIV--------------------------------
RL14_HALMA            ----AQRFGSVA---------SAATMIV--------------------------------
RL14_NANEQ            ----AERWPDLA---------KIARIIV--------------------------------
RL23_BOVIN            ----ADLWPRIA---------SNAGSIA--------------------------------
G3I5G8_CRIGR          ----ADL-----------------------------------------------------
H2Y1Y8_CIOIN          ------------------------------------------------------------
F6HZQ0_VITVI          ----RSA-----------------------------------------------------
G4V5P4_SCHMA          ------------------------------------------------------------
L9LD00_TUPCH          ----WPRTASNA---------GSIT-----------------------------------
K7N2C3_SOYBN          ----ADLWPRIA---------SAANAIV--------------------------------
RL23_TETTS            ----ADIWPKVA---------SNAGSVV--------------------------------
RL23_DICDI            ----SDLWPKVA---------TNAGTIV--------------------------------
C4JJD1_UNCRE          ----AELWPVSS---------NSLLNSWFAGFYLTRPSSSVSQVTPVW------------
F2S3Q1_TRIT1          ----AELWPICT---------G------LSGIYIRTE-----------------------
M1D3Y4_SOLTU          ----SPSLVFVP---------VYKRSQDEKRDFDTRVEMEVQKATSAMKIEMTEKMYEAK
RL23_TRYCR            ----RPSGPKIS---------SHAPAIV--------------------------------
RL23_ENCCU            ----ADMWPKIS---------SQASSIN--------------------------------
A7ATG9_BABBO          ---LETRHACRN----------MANRIF--------------------------------
C5LDI6_PERM5          QAKLDSSACAPQ----------LAWRTYPGGSGAMLKAVISKEVDCACVLTESAVAHIIK
Q25812_PLAF7          -----SKYIKYK----------LNMNKFK-------------------------------
RM14_BOVIN            --QREGEFSKVL---------AIAQNFV--------------------------------
F7GB07_MONDO          --RLEVKVYWTW---------KARFEFSRPQASH--------------------------
RM14_DANRE            --KLEGEYSKLL---------AIAQRFV--------------------------------
F4W3T1_ACREC          --SKGADYTKLI---------AIASRFV--------------------------------
A0A158NB27_ATTCE      --SKGADYTKLI---------AIASRFV--------------------------------
E2C6B6_HARSA          --TKGADYTKLL---------AIAPRFV--------------------------------
B4JL96_DROGR          --AKGADYTKVL---------AIASRYV--------------------------------
E0VMC0_PEDHC          --GKGVDYTKLL---------ALATTFV--------------------------------
T1F6R9_HELRO          --GKKGDISKIL---------ACATKFI--------------------------------
T1L5E8_TETUR          --KETYGLNKII---------AIATRFV--------------------------------
T1JPY1_TETUR          --KETYGLNKII---------AIATRFVYYSPQVQYLWNLSELRYDGYHLQFRATLEGYN
Q20430_CAEEL          --RGNVQFSKVL---------ALANKFI--------------------------------
RL14H_NYCOV           ----NERTINLF------------RICI--------------------------------
A7AXG7_BABBO          -----KNLIKFK--------TNLKKAIFI-------------------------------
                                                                                  

RM14_PARTE            ------------------------------------------------------------
RM14_TETPY            ------------------------------------------------------------
RL14_DEHM1            ------------------------------------------------------------
RL14_KORVE            ------------------------------------------------------------
RL14_LEPIC            ------------------------------------------------------------
RL14_CHLCH            ------------------------------------------------------------
RL14_FLAPJ            ------------------------------------------------------------
RL14_SULMW            ------------------------------------------------------------
RL14_RUBXD            ------------------------------------------------------------
RL14_SALRD            ------------------------------------------------------------
RL14_BIFLO            ------------------------------------------------------------
RL14_MYCHJ            ------------------------------------------------------------
RL14_MYCA5            ------------------------------------------------------------
RL14_MYCS5            ------------------------------------------------------------
RL14_MESFL            ------------------------------------------------------------
RL14_MYCGA            ------------------------------------------------------------
RL14_UREP2            ------------------------------------------------------------
RL14_ONYPE            ------------------------------------------------------------
RL14_ACHLI            ------------------------------------------------------------
RL14_OENOB            ------------------------------------------------------------
RL14_CLONN            ------------------------------------------------------------
RL14_PELTS            ------------------------------------------------------------
RL14_SYNWW            ------------------------------------------------------------
RL14_CORJK            ------------------------------------------------------------
RL14_TROWT            ------------------------------------------------------------
RL14_ROSS1            ------------------------------------------------------------
RL14_THEP1            ------------------------------------------------------------
RL14_FUSNN            ------------------------------------------------------------
RL14_AKKM8            ------------------------------------------------------------
RL14_OPITP            ------------------------------------------------------------
RL14_RHOBA            ------------------------------------------------------------
RK14_HELSJ            ------------------------------------------------------------
RK14_CYAM1            ------------------------------------------------------------
RK14_EUGLO            ------------------------------------------------------------
RK14_EUGGR            ------------------------------------------------------------
RK14_EMIHU            ------------------------------------------------------------
RK14_THAPS            ------------------------------------------------------------
RK14_CYACA            ------------------------------------------------------------
RK14_BIGNA            ------------------------------------------------------------
RK14_SORBI            ------------------------------------------------------------
RK14_WELMI            ------------------------------------------------------------
RK14_PELHO            ------------------------------------------------------------
RK14_HUPLU            ------------------------------------------------------------
RK14_PSINU            ------------------------------------------------------------
RK14_ADICA            ------------------------------------------------------------
RK14_ANEMR            ------------------------------------------------------------
RK14_CHLRE            ------------------------------------------------------------
RK14_GRATL            ------------------------------------------------------------
RL14_PROMP            ------------------------------------------------------------
RL14_GLOVI            ------------------------------------------------------------
RL14_DEIRA            ------------------------------------------------------------
RL14_CHLPN            ------------------------------------------------------------
RL14_PARUW            ------------------------------------------------------------
RL14_BORBU            ------------------------------------------------------------
RL14_TREDE            ------------------------------------------------------------
RL14_HELPJ            ------------------------------------------------------------
RL14_LAWIP            ------------------------------------------------------------
RL14_DESPS            ------------------------------------------------------------
RL14_SORC5            ------------------------------------------------------------
RL14_PELCD            ------------------------------------------------------------
RL14_XANP2            ------------------------------------------------------------
RL14_SPHWW            ------------------------------------------------------------
RM14_RECAM            ------------------------------------------------------------
RL14_PELUB            ------------------------------------------------------------
RL14_BLOFL            ------------------------------------------------------------
RL14_SACD2            ------------------------------------------------------------
RL14_NITEC            ------------------------------------------------------------
RL14_VESOH            ------------------------------------------------------------
RL14_ORITI            ------------------------------------------------------------
RL14_RICAH            ------------------------------------------------------------
RL14_SULSY            ------------------------------------------------------------
RL14_AQUAE            ------------------------------------------------------------
RL14_ANAPZ            ------------------------------------------------------------
RL14_WOLTR            ------------------------------------------------------------
RL14_NEOSM            ------------------------------------------------------------
RM14_ACACA            ------------------------------------------------------------
RL14_CARRP            ------------------------------------------------------------
RM14_DICDI            ------------------------------------------------------------
RM38_YEAST            ------------------------------------------------------------
RM38_SCHPO            ------------------------------------------------------------
RL14_METKA            ------------------------------------------------------------
RL14_METS3            ------------------------------------------------------------
RL14_METM5            ------------------------------------------------------------
RL14_METJA            ------------------------------------------------------------
RL14_THEAC            ------------------------------------------------------------
RL14_PYRAB            ------------------------------------------------------------
RL14_CENSY            ------------------------------------------------------------
RL14_HYPBU            ------------------------------------------------------------
RL14_STAMF            ------------------------------------------------------------
RL14_AERPE            ------------------------------------------------------------
RL14_SULAC            ------------------------------------------------------------
RL14_PYRAE            ------------------------------------------------------------
RL14_THEPD            ------------------------------------------------------------
RL14_KORCO            ------------------------------------------------------------
RL14_METAC            ------------------------------------------------------------
RL14_METTP            ------------------------------------------------------------
RL14_METAR            ------------------------------------------------------------
RL14_METB6            ------------------------------------------------------------
RL14_METMJ            ------------------------------------------------------------
RL14_HALMA            ------------------------------------------------------------
RL14_NANEQ            ------------------------------------------------------------
RL23_BOVIN            ------------------------------------------------------------
G3I5G8_CRIGR          ------------------------------------------------------------
H2Y1Y8_CIOIN          ------------------------------------------------------------
F6HZQ0_VITVI          ------------------------------------------------------------
G4V5P4_SCHMA          ------------------------------------------------------------
L9LD00_TUPCH          ------------------------------------------------------------
K7N2C3_SOYBN          ------------------------------------------------------------
RL23_TETTS            ------------------------------------------------------------
RL23_DICDI            ------------------------------------------------------------
C4JJD1_UNCRE          ------------------------------------------------------------
F2S3Q1_TRIT1          ------------------------------------------------------------
M1D3Y4_SOLTU          KEMEAMDENLLEAKEEAKENNDVMERKLLEAKMDMEEIIADKVKEGIQAYVESLGINIDA
RL23_TRYCR            ------------------------------------------------------------
RL23_ENCCU            ------------------------------------------------------------
A7ATG9_BABBO          ------------------------------------------------------------
C5LDI6_PERM5          NSGKDARDQVRILGKIRR------------------------------------------
Q25812_PLAF7          ------------------------------------------------------------
RM14_BOVIN            ------------------------------------------------------------
F7GB07_MONDO          ------------------------------------------------------------
RM14_DANRE            ------------------------------------------------------------
F4W3T1_ACREC          ------------------------------------------------------------
A0A158NB27_ATTCE      ------------------------------------------------------------
E2C6B6_HARSA          ------------------------------------------------------------
B4JL96_DROGR          ------------------------------------------------------------
E0VMC0_PEDHC          ------------------------------------------------------------
T1F6R9_HELRO          ------------------------------------------------------------
T1L5E8_TETUR          ------------------------------------------------------------
T1JPY1_TETUR          VLVARDESEVDEEGDKECDLVKEKEEDIKPPLIE--------------------------
Q20430_CAEEL          ------------------------------------------------------------
RL14H_NYCOV           ------------------------------------------------------------
A7AXG7_BABBO          ------------------------------------------------------------
                                                                                  

RM14_PARTE            -------------------------------
RM14_TETPY            -------------------------------
RL14_DEHM1            -------------------------------
RL14_KORVE            -------------------------------
RL14_LEPIC            -------------------------------
RL14_CHLCH            -------------------------------
RL14_FLAPJ            -------------------------------
RL14_SULMW            -------------------------------
RL14_RUBXD            -------------------------------
RL14_SALRD            -------------------------------
RL14_BIFLO            -------------------------------
RL14_MYCHJ            -------------------------------
RL14_MYCA5            -------------------------------
RL14_MYCS5            -------------------------------
RL14_MESFL            -------------------------------
RL14_MYCGA            -------------------------------
RL14_UREP2            -------------------------------
RL14_ONYPE            -------------------------------
RL14_ACHLI            -------------------------------
RL14_OENOB            -------------------------------
RL14_CLONN            -------------------------------
RL14_PELTS            -------------------------------
RL14_SYNWW            -------------------------------
RL14_CORJK            -------------------------------
RL14_TROWT            -------------------------------
RL14_ROSS1            -------------------------------
RL14_THEP1            -------------------------------
RL14_FUSNN            -------------------------------
RL14_AKKM8            -------------------------------
RL14_OPITP            -------------------------------
RL14_RHOBA            -------------------------------
RK14_HELSJ            -------------------------------
RK14_CYAM1            -------------------------------
RK14_EUGLO            -------------------------------
RK14_EUGGR            -------------------------------
RK14_EMIHU            -------------------------------
RK14_THAPS            -------------------------------
RK14_CYACA            -------------------------------
RK14_BIGNA            -------------------------------
RK14_SORBI            -------------------------------
RK14_WELMI            -------------------------------
RK14_PELHO            -------------------------------
RK14_HUPLU            -------------------------------
RK14_PSINU            -------------------------------
RK14_ADICA            -------------------------------
RK14_ANEMR            -------------------------------
RK14_CHLRE            -------------------------------
RK14_GRATL            -------------------------------
RL14_PROMP            -------------------------------
RL14_GLOVI            -------------------------------
RL14_DEIRA            -------------------------------
RL14_CHLPN            -------------------------------
RL14_PARUW            -------------------------------
RL14_BORBU            -------------------------------
RL14_TREDE            -------------------------------
RL14_HELPJ            -------------------------------
RL14_LAWIP            -------------------------------
RL14_DESPS            -------------------------------
RL14_SORC5            -------------------------------
RL14_PELCD            -------------------------------
RL14_XANP2            -------------------------------
RL14_SPHWW            -------------------------------
RM14_RECAM            -------------------------------
RL14_PELUB            -------------------------------
RL14_BLOFL            -------------------------------
RL14_SACD2            -------------------------------
RL14_NITEC            -------------------------------
RL14_VESOH            -------------------------------
RL14_ORITI            -------------------------------
RL14_RICAH            -------------------------------
RL14_SULSY            -------------------------------
RL14_AQUAE            -------------------------------
RL14_ANAPZ            -------------------------------
RL14_WOLTR            -------------------------------
RL14_NEOSM            -------------------------------
RM14_ACACA            -------------------------------
RL14_CARRP            -------------------------------
RM14_DICDI            -------------------------------
RM38_YEAST            -------------------------------
RM38_SCHPO            -------------------------------
RL14_METKA            -------------------------------
RL14_METS3            -------------------------------
RL14_METM5            -------------------------------
RL14_METJA            -------------------------------
RL14_THEAC            -------------------------------
RL14_PYRAB            -------------------------------
RL14_CENSY            -------------------------------
RL14_HYPBU            -------------------------------
RL14_STAMF            -------------------------------
RL14_AERPE            -------------------------------
RL14_SULAC            -------------------------------
RL14_PYRAE            -------------------------------
RL14_THEPD            -------------------------------
RL14_KORCO            -------------------------------
RL14_METAC            -------------------------------
RL14_METTP            -------------------------------
RL14_METAR            -------------------------------
RL14_METB6            -------------------------------
RL14_METMJ            -------------------------------
RL14_HALMA            -------------------------------
RL14_NANEQ            -------------------------------
RL23_BOVIN            -------------------------------
G3I5G8_CRIGR          -------------------------------
H2Y1Y8_CIOIN          -------------------------------
F6HZQ0_VITVI          -------------------------------
G4V5P4_SCHMA          -------------------------------
L9LD00_TUPCH          -------------------------------
K7N2C3_SOYBN          -------------------------------
RL23_TETTS            -------------------------------
RL23_DICDI            -------------------------------
C4JJD1_UNCRE          -------------------------------
F2S3Q1_TRIT1          -------------------------------
M1D3Y4_SOLTU          NLKSKQVPDNPLEDCQQPSAFVPGVHTRKLV
RL23_TRYCR            -------------------------------
RL23_ENCCU            -------------------------------
A7ATG9_BABBO          -------------------------------
C5LDI6_PERM5          -------------------------------
Q25812_PLAF7          -------------------------------
RM14_BOVIN            -------------------------------
F7GB07_MONDO          -------------------------------
RM14_DANRE            -------------------------------
F4W3T1_ACREC          -------------------------------
A0A158NB27_ATTCE      -------------------------------
E2C6B6_HARSA          -------------------------------
B4JL96_DROGR          -------------------------------
E0VMC0_PEDHC          -------------------------------
T1F6R9_HELRO          -------------------------------
T1L5E8_TETUR          -------------------------------
T1JPY1_TETUR          -------------------------------
Q20430_CAEEL          -------------------------------
RL14H_NYCOV           -------------------------------
A7AXG7_BABBO          -------------------------------