CLUSTAL format seed alignment for MF_01368

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL17_BACHD      -----MAYAKLGRDSAARKALLRDLATDLIIN--------------ERIETTEAKAKELR
RL17_BACSK      -----MAYAKLGRTSSQRKALLRDLVTDLIIN--------------ERIETTEAKAKELR
RL17_BACSU      -----MSYRKLGRTSAQRKAMLRDLTTDLIIN--------------ERIETTETRAKELR
RL17_BACLD      -----MSYRKLGRTSAQRKAMLRDLTTDLIIN--------------ERIETTEARAKELR
RL17_GEOKA      -----MSYRKLGRTTSQRKALLRDLATDLIIN--------------ERIETTEARAKELR
RL17_BACAN      -----MAYRKLGRTSAQRKAMLRDLATDLIIN--------------ERIQTTETRAKELR
RL17_BACC1      -----MAYRKLGRTSAQRKAMLRDLATDLIIN--------------ERIQTTETRAKELR
RL17_BACCR      -----MAYRKLGRTSAQRKAMLRDLATDLIIN--------------ERIQTTETRAKELR
RL17_BACCZ      -----MAYRKLGRTSAQRKAMLRDLATDLIIN--------------ERIQTTETRAKELR
RL17_BACHK      -----MAYRKLGRTSAQRKAMLRDLATDLIIN--------------ERIQTTETRAKELR
RL17_STAAC      -----MGYRKLGRTSDQRKAMLRDLATSLIIS--------------ERIETTEARAKEVR
RL17_STAAM      -----MGYRKLGRTSDQRKAMLRDLATSLIIS--------------ERIETTEARAKEVR
RL17_STAAN      -----MGYRKLGRTSDQRKAMLRDLATSLIIS--------------ERIETTEARAKEVR
RL17_STAAR      -----MGYRKLGRTSDQRKAMLRDLATSLIIS--------------ERIETTEARAKEVR
RL17_STAAS      -----MGYRKLGRTSDQRKAMLRDLATSLIIS--------------ERIETTEARAKEVR
RL17_STAAW      -----MGYRKLGRTSDQRKAMLRDLATSLIIS--------------ERIETTEARAKEVR
RL17_STAHJ      -----MGYRKLGRTSDQRKAMLRDLATSLIVS--------------ERIETTEARAKEVR
RL17_STAEQ      -----MGYRKLGRTSDQRKAMLRDLATSLIVS--------------ERIETTEARAKEVR
RL17_STAES      -----MGYRKLGRTSDQRKAMLRDLATSLIVS--------------ERIETTEARAKEVR
RL17_STAS1      -----MGYRKLGRTSDQRKAMLRDLATSLIVS--------------ERVETTEARAKELR
RL17_OCEIH      ------MARKLGRKTDSRMALLRNLASDLIIH--------------ERIETTEAKAKELR
RL17_SHISS      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SHIDS      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_ECOLI      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_ECOL6      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SHIBS      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_ECO57      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SHIFL      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_ECOL5      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_ECOUT      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SALCH      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SALPA      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SALTI      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SALTY      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_SODGM      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_PECAS      -MRHRKSGRQLNRNSSHRQAMFRNMASSLVRH--------------EIIKTTLPKAKELR
RL17_PHOLL      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_YERPA      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_YERPE      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_YERPN      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_YERPS      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRH--------------EIIKTTLPKAKELR
RL17_HAEIN      -MRHRKSGRQLNRNSSHRQAMFRNLASALVSH--------------EIIKTTLPKAKELR
RL17_HAEI8      -MRHRKSGRQLNRNSSHRQAMFRNLASALVSH--------------EIIKTTLPKAKELR
RL17_HAES1      -MRHRKSGRQLNRNSSHRQALFRNLASALVSH--------------EIIKTTLPKAKELR
RL17_HAEDU      -MRHRKSGRQLNRNSSHRQAMFRNMASALIGH--------------EIIKTTLPKAKELR
RL17_MANSM      -MRHRKSGRQLNRNSSHRQAMFRNMASSLVSH--------------EIIKTTLPKAKELR
RL17_VIBVU      -MRHRKSGRQLNRNSSHRKAMFSNMASSLVRH--------------EVIKTTLPKAKELR
RL17_VIBVY      -MRHRKSGRQLNRNSSHRKAMFSNMASSLVRH--------------EVIKTTLPKAKELR
RL17_VIBPA      -MRHRKSGRQLNRNSSHRKAMFSNMASSLVRH--------------EVIKTTLPKAKELR
RL17_VIBCH      -MRHRKSGRQLNRNSSHRKAMFSNMASSLVRH--------------EVIKTTLPKAKELR
RL17_PHOPR      -MRHRKSGRQLNRNSSHRKAMFSNMASSLVSH--------------EIIKTTLPKAKELR
RL17_IDILO      -MRHRKSGRQLNRNSSHRQAMFRNMASSLVRH--------------EIIKTTLPKAKELR
RL17_PSEA6      -MRHRKSGRQLNRNSSHRQAMFRNMAGSLVKS--------------ELIKTTLPKAKELR
RL17_SHESM      -MRHRKSGRQLNRNSSHRQAMFRNMASSLVRH--------------EIIKTTVAKAKELR
RL17_SHESR      -MRHRKSGRQLNRNSSHRQAMFRNMASSLVRH--------------EIIKTTVAKAKELR
RL17_SHEON      -MRHRKSGRQLNRNSSHRQAMFRNMASSLVRH--------------EIIKTTVAKAKELR
RL17_BUCAI      -MRHRKSGRQLNRSSTHLNSMLKNMACSLFTH--------------EVIKTTLSKAKELR
RL17_BUCBP      -MRHRKIGRRFNKSATHVKAMLKNMVCSLFRY--------------EMIKTTVSKAKELR
RL17_BUCAP      -MRHRKIGRKLNCKSDHRNAIFKNMACSLILN--------------EIIKTTLAKAKELR
RL17_METCA      -MRHRKAGRKFNLTSSHRAALYRNLAAALVEH--------------EIIKTTLPKAKEIR
RL17_PSE14      -MRHRKSGRHLSRTSSHRKAMFQNMAVSLFEH--------------ELIKTTLPKAKELR
RL17_PSESM      -MRHRKSGRHLSRTSSHRKAMFQNMAVSLFEH--------------ELIKTTLPKAKELR
RL17_PSEU2      -MRHRKSGRHLSRTSSHRKAMFQNMAVSLFEH--------------ELIKTTLPKAKELR
RL17_PSEPK      -MRHRKSGRHLSRTSSHRKAMFQNMAVSLIEH--------------ELIKTTLPKAKELR
RL17_PSEAE      -MRHRKSGRHLSRTSAHRKAMFQNMAVSLFEH--------------ELIKTTLPKAKELR
RL17_PSEF5      -MRHRKSGRHLSRTSSHRKAMFQNMAVSLFEH--------------ELIKTTLPKAKELR
RL17_LEGPH      -MRHRNSGRSFSRTSSHRKAMFSNMCCSLIEH--------------ELIRTTLPKAKDLR
RL17_LEGPL      -MRHRNSGRSFSRTSSHRKAMFSNMCCSLIEH--------------ELIRTTLPKAKDLR
RL17_LEGPA      -MRHRNSGRSFSRTSSHRKAMFSNMCCSLIEH--------------ELIRTTLPKAKDLR
RL17_CHRSD      -MRHRKSGRHLNRTSSHRHAMFKNMCVSLVEH--------------EVIKTTLPKAKELR
RL17_SACD2      -MRHRHSGRQLNRNSSHRKAMFKNMVTSLVEH--------------ELIKTTLPKAKELR
RL17_XANCP      -MRHQKSGRKFNRTSAHREAMFRNMAASLFKH--------------ELIKTTLPKAKELR
RL17_XANC8      -MRHQKSGRKFNRTSAHREAMFRNMAASLFKH--------------ELIKTTLPKAKELR
RL17_XANAC      -MRHQKSGRKFNRTSAHREAMFRNMAASLFKH--------------ELIKTTLPKAKELR
RL17_XANOM      -MRHQKSGRKFNRTSAHREAMFRNMAASLFKH--------------ELIKTTLPKAKELR
RL17_XANC5      -MRHQKSGRKFNRTSAHREAMFRNMAASLFKH--------------ELIKTTLPKAKELR
RL17_HAHCH      -MRHRKSGRKFNRTSAHRKSMFRNMAASLVEH--------------ELIKTTVPKAKELR
RL17_NITOC      -MRHRYSGRRLNRTSAHRKAMFRNMAVSLIEH--------------EMINTTLPKAKEFR
RL17_HYDCU      -MRHRKSGRKLNRNSSHRKAMFRNMSASLFEH--------------EMIKTTVAKAKELR
RL17_ALKEH      -MRHRKSGRQLGRNSAHRKAMYRNMAASLFKH--------------EAIKTTLPKAKELR
RL17_ALCBS      -MRHRKSGRKLNRNSSHRQAMFRNMAVSLLEH--------------EAIKTTLPKAKELR
RL17_BURCA      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_BURL3      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_BURMA      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_BURP1      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_BURPS      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_BURTA      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_PARXL      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEH--------------EVIKTTLPKAKELR
RL17_AROAE      -MRHRSGLRKLNRTSSHRQAMFRNMANSLLRH--------------EVIKTTLPKAKELR
RL17_NEIG1      -MRHRNGNRKLNRTSSHRAAMLRNMANSLLTH--------------ETIVTTLPKAKELR
RL17_NEIMA      -MRHRNGNRKLNRTSSHRAAMLRNMANSLLTH--------------ETIVTTLPKAKELR
RL17_NEIMB      -MRHRNGNRKLNRTSSHRAAMLRNMANSLLTH--------------EAIVTTLPKAKELR
RL17_CHRVO      -MRHRYSNRKLNRTTSHRLAMLRNMANSLLKH--------------EVIVTTLPKAKELR
RL17_BORBR      -MRHGNGLRKLNRTSSHRLAMFRNMAVSLITH--------------EAIKTTLPKAKELR
RL17_BORPA      -MRHGNGLRKLNRTSSHRLAMFRNMAVSLITH--------------EAIKTTLPKAKELR
RL17_BORPE      -MRHGNGLRKLNRTSSHRLAMFRNMAVSLITH--------------EAIKTTLPKAKELR
RL17_BORA1      -MRHGNGLRKLNRTSSHRLAMFRNMAVSLITH--------------EAIKTTLPKAKELR
RL17_DECAR      -MRHRNGLRKLNRTSSHRLAMLRNMTVSLLKH--------------EAIKTTVPKAKELR
RL17_NITEU      -MRHRNGLRKLNRTSSHRLAMFRNLTNSLLEH--------------EIIKTTLPKAKELR
RL17_NITMU      -MRHHNGLRKLNRTSSHRSAMLRNMTNSLLRH--------------EVIKTTLPKAKELR
RL17_POLSJ      -MRHGHGLRKLNRTSEHRLAMLRNMMNSLLQH--------------EVIKTTLPKAKELR
RL17_RHOFT      -MRHGHGLRKLNRTSEHRLAMLRNMMNSLIEH--------------EVIKTTLPKAKELR
RL17_THIDA      -MRHRQSNRKLNRTTSHRLAMFRNMTNSLLKH--------------EVIKTTLPKAKDLR
RL17_CUPPJ      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLFQH--------------ELIKTTLPKAKELR
RL17_CUPMC      -MRHRHGLRKLNRTSSHRLAMLRNMSNSLFQH--------------ELIKTTLPKAKELR
RL17_RALSO      -MRHRHGLRKLNRTSAHRLAMLRNMSNSLFQH--------------ELIKTTLPKAKELR
RL17_METFK      -MRHRNSNRKLNRTSSHRQAMLRNMANSLLRH--------------EIIKTTLPKAKELR
RL17_COXBU      -MHHRKSGRHLNRTSAHRKAMLRNMAVSLFQH--------------ELIKTTLPKAKELR
RL17_RHIME      -MRHGKAGRKLNRTASHRKAMFANMAASLIEH--------------EQIVTTLPKAKEIR
RL17_AGRFC      -MRHGNSGRKLNRTASHRKAMFANMAASLITH--------------EQIVTTLPKAKEIR
RL17_RHIEC      -MRHGKAGRKLNRTASHRKAMFANMAASLITH--------------EQIVTTLPKAKEIR
RL17_RHIL3      -MRHGKAGRKLNRTASHRKAMFANMAASLITH--------------EQIVTTLPKAKEIR
RL17_BRUA2      -MRHGNGYRKLNRTASHRKAMFANMAASLIEH--------------EQIVTTLPKAKEIR
RL17_BRUAB      -MRHGNGYRKLNRTASHRKAMFANMAASLIEH--------------EQIVTTLPKAKEIR
RL17_BRUME      -MRHGNGYRKLNRTASHRKAMFANMAASLIEH--------------EQIVTTLPKAKEIR
RL17_BRUSU      -MRHGNGYRKLNRTASHRKAMFANMAASLIEH--------------EQIVTTLPKAKEIR
RL17_CHESB      -MRHGKAGRKLNRTSSHRKAMFANMAASLIEH--------------EQIVTTLPKAKELR
RL17_RHILO      -MRHGFKGRRFARSISHRKSMFANLAVSLLEH--------------EQIVTTLPKAKDLR
RL17_BARHE      -MRHSKSGRKLNRTASHRKAMFANMAISLIEH--------------EQIVTTLPKAKEIR
RL17_BARQU      -MRHSKSGRKLNRTASHRKAMFANMAISLIEH--------------EQIVTTLPKAKEIR
RL17_RHOP2      -MRHGKVHRKLNRTAEHRKAMFANMCAALIKH--------------EQIVTTLPKAKELR
RL17_RHOPS      -MRHGKVHRKLNRTAEHRKAMFANMCAALIKH--------------EQIVTTLPKAKELR
RL17_RHOPA      -MKHGKVHRKLNRTAEHRKAMFANMCAALIKH--------------EQIVTTLPKAKELR
RL17_NITHX      -MRHGKVHRKLNRTAEHRKAMFANMAASLIKH--------------EQIVTTLPKAKELR
RL17_NITWN      -MRHGKVHRKLNRTAEHRKAMFANMSASLIKH--------------EQIVTTLPKAKELR
RL17_BRADU      -MRHGKVHRKLNRTAEHRRAMFANMAAALIKH--------------EQIVTTLPKAKELR
RL17_RHOPB      -MRHGKVHRKLNRTAEHRKAMFANMCASLIKH--------------EQIVTTLPKAKELR
RL17_CAUVC      -MRHGKAHRKLGRTSAHRTAMFANMSASLIKH--------------EQIVTTLPKAKELR
RL17_HYPNA      -MRHQIAHRKLNRTASHRKAMFANMAASLIEH--------------EQIVTTLPKAKEMA
RL17_ROSDO      -MRHARGYRRLNRTHEHRKALWANMAGSLIEH--------------EQIKTTLPKAKELR
RL17_RUEST      -MRHARGYRRLNRTHEHRKALFSNMAGSLIEH--------------EQIKTTLPKAKELR
RL17_RUEPO      -MRHARGYRRLNRTHEHRKALFANMAGSLIEH--------------EQIKTTLPKAKELR
RL17_RHOS4      -MRHARGYRRLNRTHEHRKALFANMAGSLIEH--------------EQIKTTLPKAKELR
RL17_JANSC      -MRHARGYRRLNRTHEHRKAMFSNMCGSLIEH--------------EQIKTTVPKAKELR
RL17_MAGSA      -MRHGMSGRKLNRDKSARKALFVSLANALLKH--------------EQIKTTLPKAKDAR
RL17_RHORT      -MRHGMSGRKLNRTSSHRKAMFANMAASLLKH--------------EQIKTTLPKAKDLR
RL17_GLUOX      -MRHGVSGRKLNVTSSHRAAMFRNMAVALIKH--------------EQITTTLPKAKELR
RL17_NOVAD      -MRHKLGQRKLGRTSSHRIALLRNMAAALIKH--------------EQITTTLPKARELR
RL17_ZYMMO      -MRHRVGGRKLQRTSSHRLALFRNQSAALIKH--------------EQIITTLAKARELR
RL17_SPHAL      -MRHKSGGRKLQRTSAHRTAMFRNMSASLIKH--------------EQITTTVAKAKELR
RL17_RICCN      -MRHKIKGRKLNITSSHRQAMLANMAVALVTH--------------EQIKTTLPKAKELR
RL17_RICPR      -MRHRIKGRRLNVTSSHRQSMLANMAVSLVIH--------------EQIKTTLPKAKELR
RL17_RICBR      -MRHKIKGRKLNVTSSHRKAMLANMAVSLVTH--------------EQIKTTLPKAKELR
RL17_ANADE      -MKHRVVGRRLDRTTEHRTAMFKNMVTSLFRH--------------ERIVTTTPKAKELK
RL17_DEIRA      -MRHGKAGRKLNRNSSARVALARAQATALLRE--------------GRIQTTLTKAKELR
RL17_DEIGD      -MRHGKAGRKLNRNSSARVALARAQATALLRE--------------GRIQTTLTKAKELR
RL17_THET8      -MRHLKSGRKLNRHSSHRLALYRNQAKSLLTH--------------GRITTTVPKAKELR
RL17_THET2      -MRHLKSGRKLNRHSSHRLALYRNQAKSLLTH--------------GRITTTVPKAKELR
RL17_DESAG      -MRHRKSGRKLNRSSSHRSALFRNMAKSLLTY--------------GKIRTTEAKAKELR
RL17_DESVH      -MRHSNSGKKLGRTPSHRKALFRNLAKALLTH--------------GKIRTTEIKAKELR
RL17_LAWIP      -MRHKNSGKKLNRTPSHRKALFRNMANELIKH--------------GKICTTETKAKELR
RL17_MYCTU      -MPKPTKGPRLGGSSSHQKAILANLATSLFEH--------------GRITTTEPKARALR
RL17_MYCBO      -MPKPTKGPRLGGSSSHQKAILANLATSLFEH--------------GRITTTEPKARALR
RL17_MYCLE      -MPKPTKGPRLGGSSSHQKALLTNLAASLFEH--------------GRIKTTEPKARALR
RL17_STRCO      -MPKPSKGARLGGSAAHEKLLLANLAKSLFEH--------------GRITTTEAKARKLR
RL17_THEFY      -MPTPTKGPRLGGGPAHERLMLANLATALFRH--------------GRIKTTEAKAKRLR
RL17_BACFN      -MRHNKKFNHLGRTASHRSAMLSNMACSLIKH--------------KRITTTVAKAKALK
RL17_BACFR      -MRHNKKFNHLGRTASHRSAMLSNMACSLIKH--------------KRITTTVAKAKALK
RL17_BACTN      -MRHNKKFNHLGRTASHRSAMLSNMACSLIKH--------------KRITTTVAKAKALK
RL17_PORGI      -MRHNKKFNHLGRKAAHRKAMLSNMAASLILH--------------KRIFTTVAKAKALR
RL17_CYTH3      -MRHGKKDNHLGRTVTHRRALLSNMASSLILH--------------KRISTTVPKAKELR
RL17_HELPY      -MRHKHGYRKLGRTSSHRKALLKNLAIALIEH--------------NKIETGIYKAKELR
RL17_HELPJ      -MRHKHGYRKLGRTSSHRKALLKNLAIALIEH--------------NKIETGIYKAKELR
RL17_WOLSU      -MRHNHGYRKLGRTSAHRKALLKNLAIALVEN--------------QKIETTVIKAKELQ
RL17_CAMJE      -MRHKHGYRKLGRTSSHRAALLKNLTIALVNS--------------GKIETTLPKAKELR
RL17_CAMJR      -MRHKHGYRKLGRTSSHRAALLKNLTIALVNS--------------GKIETTLPKAKELR
RL17_THEMA      -MRHRVKRHKLGRYGSHRKSLLRNLSREIVEH--------------GSIVTTTAKAKALK
RL17_SALRD      -MRHRKKGKKIGRTASHRKRTLQSLSNALIEN--------------KSITTTVAKAKALR
RL17_CLOP1      ----MAGYRKLGRPTDQRKAMLRNLVTSFLKH--------------GKIETTETRAKETR
RL17_CLOPE      ----MAGYRKLGRPTDQRKAMLRNLVTSFLKH--------------GKIETTETRAKETR
RL17_CLOPS      ----MAGYRKLGRPTDQRKAMLRNLVTSFLKH--------------GKIETTETRAKETR
RL17_CLOTE      ----MAGHRKLGRPTDQRMAMLRNQVTSLLKS--------------GKIETTVTRAKETR
RL17_CLOAB      ---MASGYRKLGRPTDQRRAMLRNLVTSFLKH--------------GKIETTVTRAKETR
RL17_CLOD6      ----MAKYRKLGRETAHRNLMLRNLVTCLLRS--------------GRIETTVTRAKETR
RL17_CALS4      -----MSYRKLGRPSDQRRAMLRNLVTDFLRY--------------ERITTTEARAKEVR
RL17_SYMTH      ----MAKYQKLGRDSSARKALFRAVVTALFDK--------------ERIETTEAKAKAVQ
RL17_GEOMG      -MRHNKAGRRLGRTTSHRIAMFRNMVTSFLEH--------------ERITTTDAKAKELR
RL17_GEOSL      -MRHNKAGRRLGRTTSHRIAMFRNMVTSLFAH--------------ERITTTDAKAKELR
RL17_DESPS      -MRHRYSGRKLGRTSSHRDAMFRNMVTSLFEH--------------ERIVTTKEKAKELR
RL17_PELCD      -MRHNKSGRRLGRNSSHRAAMMRNMVTSLLEH--------------EKITTTDARAKELR
RL17_FUSNN      -MNHNKSYRKLGRRADHRKAMLKNMTISLIKA--------------ERIETTVTRAKELR
RL17_BORBU      -MKTKLGFNRLSRKSSHRRALLKNMVISFFKH--------------EKISSTKTKLFEVK
RL17_TREPA      -MRHRTGFNPLSCMAAHRRALRRNMVTSLFKF--------------ERITTTKPKAAEVR
RL17_LEPIC      -MNKRNKVKHLNRNKGHRDALINNMITSLFKY--------------ERIESTQAKLKVVR
RL17_LEPIN      -MNKRNKVKHLNRNKGHRDALINNMITSLFKY--------------ERIESTQAKLKVVR
RL17_CHLMU      -MQHARKKFRVGRTSSHNRCMLANMLKSLIHN--------------ERIETTLPKAKELR
RL17_CHLTR      -MQHARKKFRVGRTSSHNRCMLANMLKSLIHN--------------ERIETTLPKAKELR
RL17_CHLPN      -MQHARKKFRVGRTSSHNRCMLANMLKSLIHY--------------ERIETTLPKAKELR
RL17_AQUAE      -MRHRVKKKHFDRTKEQRLALYRSLARALIFD--------------ERIETTVERAKALR
RL17_BDEBA      MSSHRRRVKHFDRKSGPRKALLRGLVTSLIEH--------------GRITTTVDRAKEVR
RL17_DEHMC      -MRHKVSGRRFDRPTGQRMSLYRNLVTDLLNY--------------EEITISEPRAKEIR
RL17_SYNP6      -MRHRCNVPQLGRPADQRKALLRSLTTEIIRN--------------GTVTTTKARAKAVR
RL17_SYNE7      -MRHRCNVPQLGRPADQRKALLRSLTTEIIRN--------------GTVTTTKARAKAVR
RL17_SYNY3      -MRHRCRVPQLGKPADQRKALLRALTTELIRH--------------GQIKTTKARAKAVR
RL17_THEEB      -MRHQRRVPQLGRPADQRKALLRALTTELIRH--------------GRITTTKARAKAVR
RL17_PROMA      -MRHQLRVPQLGRPADQRKALLRGLTTQLIRE--------------GRVTTTKTRAKALR
RL17_PROMP      -MRHQLRVPLLSKPADQRKALLRALTTQLIRE--------------GRITTTKARAKALR
RL17_TRIEI      -MRHSCRVPKLGKPTDQRRALLRSLATQLIRH--------------GQIKTTKPRAKAVQ
RL17_NOSS1      -MRHRNRVKKLGKPADQRRALLRALTTELIRH--------------GRITTTLVRAKVVR
RL17_TRIV2      -MRHRNRVKKLGKPADQRRALLRALTTELIRH--------------GRITTTLVRAKVVR
RL17_SYNJA      -MRHRRRTPHLNKPADQRKALMRALTTALLRE--------------GRITTTKARAKAIR
RL17_SYNJB      -MRHRRRTPHLNKPADQRKALMRALTTALLRE--------------GRITTTKARAKAIR
RL17_RHOBA      -MRHRRKGRVLGRSPAHRKALMRNLSSALFLTERDASLDENAPKVPGRIITTLEKAKEVR
RL17_KORVE      -MRHRVGGWKLGRNTEHRRALLRNLVTSLIVE--------------ERIETTVPKAKAMR
RL17_MYCGE      ----MSYINKEGKTTAWRVMTVRQQVSAVLSY--------------GKIQTTLKKAKNTQ
RL17_MYCPN      ----MSYINKPGKTSAWRVMTVRQQVSAVLAY--------------GKIETTLKKAKNTQ
RL17_UREPA      ----MSYINKPGKTRAWRKMVSRQQVSDVISH--------------GSIVTTKTKAKESQ
RL17_MYCCT      ----MSYIQKRGQNTAWRTALMRNLTTELIIN--------------ESLEVTQTRAKELR
RL17_MYCH2      ---MANPHQIYRHDAAWDRQVFRSLATSLILH--------------GHIKTTLDRAKRLR
                                            ..                  :     :     

RL17_BACHD      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACSK      PIVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACSU      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACLD      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_GEOKA      SVMEKMITLG--------------------KRG---------------------DLHARR
RL17_BACAN      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACC1      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACCR      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACCZ      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_BACHK      SVVEKMITLG--------------------KRG---------------------DLHARR
RL17_STAAC      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAAM      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAAN      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAAR      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAAS      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAAW      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAHJ      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAEQ      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAES      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_STAS1      SVVEKLITLG--------------------KKG---------------------DLASRR
RL17_OCEIH      SIVEKMITLG--------------------KRG---------------------DLHARR
RL17_SHISS      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SHIDS      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_ECOLI      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_ECOL6      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SHIBS      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_ECO57      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SHIFL      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_ECOL5      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_ECOUT      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SALCH      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SALPA      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SALTI      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SALTY      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_SODGM      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_PECAS      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_PHOLL      RVVEPLITLA--------------------KID---------------------SVANRR
RL17_YERPA      RVVEPLITLA--------------------KTD---------------------NVANRR
RL17_YERPE      RVVEPLITLA--------------------KTD---------------------NVANRR
RL17_YERPN      RVVEPLITLA--------------------KTD---------------------NVANRR
RL17_YERPS      RVVEPLITLA--------------------KTD---------------------NVANRR
RL17_HAEIN      RVVEPLITLA--------------------KVD---------------------SVANRR
RL17_HAEI8      RVVEPLITLA--------------------KVD---------------------SVANRR
RL17_HAES1      RVVEPLITLA--------------------KVD---------------------SVANRR
RL17_HAEDU      RVVEPLITLA--------------------KED---------------------SVANRR
RL17_MANSM      RVVEPLITLA--------------------KED---------------------SVANRR
RL17_VIBVU      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_VIBVY      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_VIBPA      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_VIBCH      RVVEPLITLA--------------------KTD---------------------SVANRR
RL17_PHOPR      RVIEPLITLA--------------------KTD---------------------SVANRR
RL17_IDILO      RVVEPLITMA--------------------KQD---------------------SVANRR
RL17_PSEA6      RVIEPLITLA--------------------KQD---------------------SVANRR
RL17_SHESM      RVVEPLITLA--------------------KSD---------------------SVANRR
RL17_SHESR      RVVEPLITLA--------------------KSD---------------------SVANRR
RL17_SHEON      RVVEPLITLA--------------------KSD---------------------SVANRR
RL17_BUCAI      RIVEPIITLS--------------------KID---------------------TVSRRR
RL17_BUCBP      RVAEPLITCA--------------------KID---------------------SVANRR
RL17_BUCAP      RIVEPMITLS--------------------KID---------------------TVAHRR
RL17_METCA      RYVEPLITLS--------------------KED---------------------SVAGRR
RL17_PSE14      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_PSESM      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_PSEU2      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_PSEPK      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_PSEAE      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_PSEF5      RVAEPLITLA--------------------KTD---------------------SLANRR
RL17_LEGPH      RYIEPLITVS--------------------KSD---------------------SVASRR
RL17_LEGPL      RYIEPLITVS--------------------KSD---------------------SVASRR
RL17_LEGPA      RYIEPLITVS--------------------KSD---------------------SVASRR
RL17_CHRSD      RHIEPLITLA--------------------KQD---------------------SVANRR
RL17_SACD2      RYAEPLITLS--------------------KSD---------------------SVANRR
RL17_XANCP      RVAEPLITIG--------------------KVD---------------------GVANRR
RL17_XANC8      RVAEPLITIG--------------------KVD---------------------GVANRR
RL17_XANAC      RVAEPLITIG--------------------KVD---------------------GVANRR
RL17_XANOM      RVAEPLITIG--------------------KVD---------------------GVANRR
RL17_XANC5      RVAEPLITIG--------------------KVD---------------------GVANRR
RL17_HAHCH      RVAEPLITLA--------------------KSD---------------------SVANRR
RL17_NITOC      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_HYDCU      GVAEPLITLA--------------------KQD---------------------SVHNRR
RL17_ALKEH      RVAEPLITMA--------------------KSD---------------------SVASRR
RL17_ALCBS      RVAEPLITLA--------------------KED---------------------SVANRR
RL17_BURCA      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_BURL3      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_BURMA      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_BURP1      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_BURPS      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_BURTA      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_PARXL      KVVEPLITLG--------------------KKP---------------------SLANRR
RL17_AROAE      RVVEPLITLG--------------------KKP---------------------SLSNRR
RL17_NEIG1      RVVEPLITLG--------------------KKP---------------------SLASRR
RL17_NEIMA      RVVEPLITLG--------------------KKP---------------------SLANRR
RL17_NEIMB      RVVEPLITLG--------------------KKP---------------------SLANRR
RL17_CHRVO      RVAEPLITLG--------------------KKP---------------------SLANRR
RL17_BORBR      RVIEPLITLG--------------------KEP---------------------TLANKR
RL17_BORPA      RVIEPLITLG--------------------KEP---------------------TLANKR
RL17_BORPE      RVIEPLITLG--------------------KEP---------------------TLANKR
RL17_BORA1      RVIEPLITLG--------------------KEP---------------------TLANKR
RL17_DECAR      RVVEPIITLG--------------------KNP---------------------TLANKR
RL17_NITEU      RVVEPVITLG--------------------KNP---------------------SLAGKR
RL17_NITMU      RVIEPMITLG--------------------KKP---------------------SLANRR
RL17_POLSJ      RVVEPMITLA--------------------KEP---------------------TVANKR
RL17_RHOFT      RVVEPMITLA--------------------KEA---------------------TVANRR
RL17_THIDA      RFVEPLITLG--------------------KES---------------------TVANQR
RL17_CUPPJ      KVVEPLITLA--------------------KKD---------------------TVANRR
RL17_CUPMC      KVVEPLITLA--------------------KKD---------------------TVANRR
RL17_RALSO      KVVEPLITLA--------------------KKD---------------------TVANRR
RL17_METFK      RVAEPLITLG--------------------KDA---------------------TLANRR
RL17_COXBU      RVVEPLITLA--------------------KED---------------------TVANRR
RL17_RHIME      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_AGRFC      PIVERLVTLG--------------------KRG---------------------DLHARR
RL17_RHIEC      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_RHIL3      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_BRUA2      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_BRUAB      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_BRUME      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_BRUSU      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_CHESB      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_RHILO      PIVEKLVTLG--------------------KRG---------------------DLHARR
RL17_BARHE      PIVERLVTLG--------------------KRG---------------------GLHARR
RL17_BARQU      PIVEKLVTLG--------------------KRG---------------------GLHARR
RL17_RHOP2      PIVEKLVTLG--------------------KKG---------------------GLDKRR
RL17_RHOPS      PIVEKLVTLG--------------------KKG---------------------GLDKRR
RL17_RHOPA      PIVEKLVTLG--------------------KKG---------------------GLDKRR
RL17_NITHX      PIVEKLVTLG--------------------KKG---------------------GLDKRR
RL17_NITWN      PIVEKLVTLG--------------------KKG---------------------GLAKRR
RL17_BRADU      PIVEKLVTLG--------------------KKG---------------------GLAMRR
RL17_RHOPB      PIVEKLVTLG--------------------KKG---------------------GLALRR
RL17_CAUVC      PIVEKLVTLA--------------------KRG---------------------DLHARR
RL17_HYPNA      PLMDKLVSLA--------------------KKG---------------------DLAARR
RL17_ROSDO      PIIEKMITLA--------------------KRG---------------------DLHARR
RL17_RUEST      PIIEKMITLA--------------------KRG---------------------DLHARR
RL17_RUEPO      PIVEKLITLG--------------------KRG---------------------DLHARR
RL17_RHOS4      PIIEKLITLA--------------------KRG---------------------DLHARR
RL17_JANSC      PIIEKMITLA--------------------KRG---------------------DLHARR
RL17_MAGSA      PIVEKLITLG--------------------KRG---------------------DLHARR
RL17_RHORT      PIAEKLITLG--------------------KGG---------------------TLHDRR
RL17_GLUOX      PVVEKLITLG--------------------KRG---------------------DLHARR
RL17_NOVAD      PYLEKLITLG--------------------KKG---------------------GLSNRR
RL17_ZYMMO      PYTEKLITLA--------------------KKG---------------------GLANRR
RL17_SPHAL      PYVEKLVTLA--------------------KRG---------------------GLANRR
RL17_RICCN      PYIETLITKA--------------------KKA---------------------DLMVRR
RL17_RICPR      PYIEALITKA--------------------KKP---------------------DLAVRR
RL17_RICBR      PYIEVLVTKA--------------------KDN---------------------NLAARR
RL17_ANADE      RFADKVITQA--------------------KRG---------------------TPHARR
RL17_DEIRA      PFVEQLITTA--------------------KGG---------------------DLHSRR
RL17_DEIGD      PYVEKLITTA--------------------KGG---------------------DLHARR
RL17_THET8      GFVDHLIHLA--------------------KRG---------------------DLHARR
RL17_THET2      GFVDHLIHLA--------------------KRG---------------------DLHARR
RL17_DESAG      GVVEPLITLA--------------------LRN---------------------DLHARR
RL17_DESVH      RVVEPLITLA--------------------LRN---------------------DLHARR
RL17_LAWIP      RIVEPLITLA--------------------LRN---------------------DLHSRR
RL17_MYCTU      PYAEKLITHA--------------------KKG---------------------ALHNRR
RL17_MYCBO      PYAEKLITHA--------------------KKG---------------------ALHNRR
RL17_MYCLE      PYAEKLITHA--------------------KKG---------------------TLHNRR
RL17_STRCO      PYAERLVTKA--------------------KKG---------------------DLHNRR
RL17_THEFY      PYAEKLITLG--------------------KRG---------------------DLHARR
RL17_BACFN      KFVEPLITKS--------------------KED---------------------TTNSRR
RL17_BACFR      KFVEPLITKS--------------------KED---------------------TTNSRR
RL17_BACTN      KFVEPLITKS--------------------KED---------------------TTNSRR
RL17_PORGI      IYVEPLLTKT--------------------KED---------------------TTHSRR
RL17_CYTH3      KYVEPLITKA--------------------KAD---------------------STHSRR
RL17_HELPY      SYIEKLTTAA--------------------RVG---------------------DFNAHR
RL17_HELPJ      SYIEKLTTVA--------------------RVG---------------------DFNAHR
RL17_WOLSU      SYIEKLITKA--------------------SEG---------------------SFNAHR
RL17_CAMJE      GYVERLITRA--------------------RLG---------------------DFNAHR
RL17_CAMJR      GYVERLITRA--------------------RLG---------------------DFNAHR
RL17_THEMA      TFMDKLVSKA--IEAATTDD----------RAR---------------------SVHLRR
RL17_SALRD      PFVEPLITRA--------------------KED---------------------TQHNRR
RL17_CLOP1      SLAEKMITLA--------------------KRG---------------------DLHARR
RL17_CLOPE      SLAEKMITLA--------------------KRG---------------------DLHARR
RL17_CLOPS      SLAEKMITLA--------------------KRG---------------------DLHARR
RL17_CLOTE      SLAEKMITLG--------------------KRG---------------------DLQARR
RL17_CLOAB      SLAEKMITLA--------------------KRG---------------------DLHARR
RL17_CLOD6      RMAEKMITLA--------------------KRG---------------------DLHARR
RL17_CALS4      KIAEKMITLG--------------------KRG---------------------DLHARR
RL17_SYMTH      SIAEEMITLA--------------------KRG---------------------DLHARR
RL17_GEOMG      SIAEKMITLG--------------------KRG---------------------DLHAQR
RL17_GEOSL      SIAEKMITLG--------------------KRG---------------------DLHAVR
RL17_DESPS      PIAEKMITLG--------------------KRG---------------------DLHARR
RL17_PELCD      KVVDRMITLG--------------------KRG---------------------DLHARR
RL17_FUSNN      KFAERMITFG--------------------KKN---------------------TLASRR
RL17_BORBU      RFAERLITRA--------------------KVD---------------------TVHNRR
RL17_TREPA      RAAERLITRS--------------------KSD---------------------SVHNRR
RL17_LEPIC      SHAEKLITRA--------------------KKNLVTDLKPEV------------QLHNKR
RL17_LEPIN      SHAEKLITRA--------------------KKNLVTDLKPEV------------QLHNKR
RL17_CHLMU      RHADKMVTLA--------------------KKN---------------------TLAARR
RL17_CHLTR      RHADKMITLA--------------------KKN---------------------TLAARR
RL17_CHLPN      RHADKMITLA--------------------KKN---------------------SLAARR
RL17_AQUAE      SFIEPLVELA--KE-----------------GT----------------------LHARR
RL17_BDEBA      RHVEKAITLG--KK-----------------GD----------------------LSTTR
RL17_DEHMC      SMAEKMITLG--KK-----------------GT----------------------LASRR
RL17_SYNP6      SEVERMVTLA--KD-----------------GS----------------------LAARR
RL17_SYNE7      SEVERMVTLA--KD-----------------GS----------------------LAARR
RL17_SYNY3      SEVDRMITLA--KD-----------------GS----------------------LAARR
RL17_THEEB      AEAERMITLA--KD-----------------GS----------------------LAARR
RL17_PROMA      DEVERMIGLA--KD-----------------GS----------------------LAARR
RL17_PROMP      NEAERMISLA--KE-----------------GT----------------------LSARR
RL17_TRIEI      SEVERMITLA--KD-----------------GS----------------------LAARR
RL17_NOSS1      SEVDKIITLA--KD-----------------GS----------------------LAARR
RL17_TRIV2      SEVDKIITLA--KD-----------------GS----------------------LAARR
RL17_SYNJA      ATTEKMITLA--KD-----------------GS----------------------LAARR
RL17_SYNJB      ATTEKMITLA--KE-----------------GS----------------------LAARR
RL17_RHOBA      PLVEKCITLA--KRALPALEEAKKYETSAERGSDEYKKWRKSEQWTQWADARAPYVNAQR
RL17_KORVE      PHVEKMITLG--KQ-----------------GN----------------------VAARR
RL17_MYCGE      KRLEKIITIAKV------------------D-----------------------NFNNRR
RL17_MYCPN      KRLDKLITLAKV------------------D-----------------------NFNNRR
RL17_UREPA      RHVDHLITLAKK------------------N-----------------------TLASRR
RL17_MYCCT      RHFDHMITLAKR------------------G-----------------------DLHSRR
RL17_MYCH2      SVVEKIITKAKK------------------N-----------------------DLAARR
                   :                                                       *

RL17_BACHD      QAAAFIRR-EVADE---------------ETGQDAIQKLFSDIAPRYEDRQGGYTRVLKV
RL17_BACSK      QAAAFVRN-EIADV---------------ESGQDAIQKLFADIAPRFAERQGGYTRILKV
RL17_BACSU      QAAAYIRN-EVANE---------------ENNQDALQKLFSDIATRYEERQGGYTRIMKL
RL17_BACLD      QAAAYIRN-EVADA---------------EKNQDALQKLFSDVAPRYEERQGGYTRIMKL
RL17_GEOKA      QAAAFIRK-EVANS---------------ETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
RL17_BACAN      QAAAFIRN-EVANA---------------ETGQDALQKLFADVAPRYAERQGGYTRIAKI
RL17_BACC1      QAAAFIRN-EVANA---------------ETGQDALQKLFADVAPRYAERQGGYTRIAKI
RL17_BACCR      QAAAFIRN-EVANA---------------ETGQDALQKLFADVAPRYAERQGGYTRIAKI
RL17_BACCZ      QAAAFIRN-EVANA---------------ETGQDALQKLFADVAPRYAERQGGYTRIAKI
RL17_BACHK      QAAAFIRN-EVANA---------------ETGQDALQKLFADVAPRYAERQGGYTRIAKI
RL17_STAAC      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKQ
RL17_STAAM      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKQ
RL17_STAAN      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKQ
RL17_STAAR      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKQ
RL17_STAAS      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKQ
RL17_STAAW      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKQ
RL17_STAHJ      NAAKTLRNVEILNED--------------ETTQTALQKLFGEIAERYTERQGGYTRILKV
RL17_STAEQ      NAAKTLRNVEILNED--------------DSTQTALQKLFGEIAERYSERQGGYTRILKV
RL17_STAES      NAAKTLRNVEILNED--------------DSTQTALQKLFGEIAERYSERQGGYTRILKV
RL17_STAS1      QAAKTLRNVEILNED--------------ETVQTALQKLFGEVAERYTERQGGYTRILKV
RL17_OCEIH      QAAAFLYNKETDED------------------NNVIQKLFDDVAARYEDRQGGYTRVLKL
RL17_SHISS      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SHIDS      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_ECOLI      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_ECOL6      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SHIBS      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_ECO57      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SHIFL      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_ECOL5      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_ECOUT      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SALCH      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SALPA      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SALTI      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SALTY      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_SODGM      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_PECAS      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_PHOLL      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_YERPA      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_YERPE      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_YERPN      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_YERPS      LAFARTR------------------------DNEIVAKLFNELGPRFASRAGGYTRILKC
RL17_HAEIN      LAFARTR------------------------NVETVAKLFNELGPRFAQRAGGYTRILKC
RL17_HAEI8      LAFARTR------------------------NVETVAKLFNELGPRFAQRAGGYTRILKC
RL17_HAES1      LAFARTR------------------------NIETVAKLFNELGPRFAQRAGGYTRILKC
RL17_HAEDU      LAFARTR------------------------NIETVAKLFNELGPRFAQRAGGYTRILKC
RL17_MANSM      LAFARTR------------------------NIETVAKLFNELGPRFAQRAGGYTRILKC
RL17_VIBVU      LAFARTR------------------------DNEVVAKLFNELGPRFAARQGGYTRILKA
RL17_VIBVY      LAFARTR------------------------DNEVVAKLFNELGPRFAARQGGYTRILKA
RL17_VIBPA      LAFARTR------------------------DNEVVAKLFNELGPRFAARQGGYTRILKA
RL17_VIBCH      LAFARTR------------------------DNEVVAKLFNELGPRFAARQGGYTRILKC
RL17_PHOPR      LAFARTR------------------------DNAVVAKLFTELGPRFAKRPGGYTRIMKC
RL17_IDILO      LAFARTR------------------------DKEVVGKLFNELGPRYEERPGGYTRIMKC
RL17_PSEA6      LAFARTG------------------------DKEVVGKLFNELGPRYEERPGGYIRILKC
RL17_SHESM      LAFARTR------------------------DAEVVGKLFTELGPRYQERPGGYTRILKC
RL17_SHESR      LAFARTR------------------------DAEVVGKLFTELGPRYQERPGGYTRILKC
RL17_SHEON      LAFARTR------------------------DAEVVGKLFTELGPRYQERPGGYTRILKC
RL17_BUCAI      LVFSRIR------------------------DNAIVAKLFKKLGPCFFSRLGGYTRILKC
RL17_BUCBP      LVFSRIR------------------------DNKIVFKLFRDLGPHFLGQFGGYTRILRC
RL17_BUCAP      LLFSRIR------------------------NNEVIAKLFKKIGPIFYNRSGGYTRILKC
RL17_METCA      LAFARLR------------------------NREAVTKLFNDLGPRFKTRPGGYTRILKC
RL17_PSE14      LAFDRTR------------------------SKEIVGKLFNDLGKRYATRQGGYLRILKC
RL17_PSESM      LAFDRTR------------------------SKEIVGKLFNDLGKRYATRQGGYLRILKC
RL17_PSEU2      LAFDRTR------------------------SKEIVGKLFNDLGKRYATRQGGYLRILKC
RL17_PSEPK      LAFDRTR------------------------SKSAVGKLFNDLGKRYATRQGGYLRILKC
RL17_PSEAE      LAFDRTR------------------------SKAAVGKLFNDLGKRYANRPGGYLRILKC
RL17_PSEF5      LAFDRTR------------------------SKAIVGKLFNDLGKRYATREGGYLRILKC
RL17_LEGPH      RAFDILR------------------------SKSAVGKLFTDLGPRFAKRPGGYIRIIKC
RL17_LEGPL      RAFDILR------------------------SKSAVGKLFTDLGPRFAKRPGGYIRIIKC
RL17_LEGPA      RAFNILR------------------------SKSAVGKLFTDLGPRFAKRPGGYIRIIKC
RL17_CHRSD      LAFNRTR------------------------SKEAVGKLFNELGPRYVERPGGYVRILKC
RL17_SACD2      LAFARLG------------------------NKATVGKLFNELGPRYEGRPGGYLRIMKC
RL17_XANCP      LAFARLR------------------------DKEAVGKLFVELGPRYATRPGGYLRILKA
RL17_XANC8      LAFARLR------------------------DKEAVGKLFVELGPRYATRPGGYLRILKA
RL17_XANAC      LAFARLR------------------------DKEAVGKLFVELGPRYATRPGGYLRILKA
RL17_XANOM      LAFARLR------------------------DKEAVGKLFVELGPRYATRPGGYLRILKA
RL17_XANC5      LAFARLR------------------------DKEAVGKLFVELGPRYATRPGGYLRILKA
RL17_HAHCH      LAFSRLR------------------------SRDAVTKLFEEIGPRYKDRPGGYLRILKC
RL17_NITOC      LVFSRLR------------------------DRKAVTKLFNELGPRYQARPGGYLRILKR
RL17_HYDCU      IAFSRLR------------------------DKAAVGKLFSELGPRYESRPGGYVRILKC
RL17_ALKEH      KAFDRLR------------------------DKEVVGKLFEELGPRYQERPGGYLRILKC
RL17_ALCBS      LAFDRTR------------------------SKEMVGKLFNELGPRYQERPGGYIRILKM
RL17_BURCA      LAFNRLR------------------------DRDSVAKLFDVLGPRFANRPGGYLRVLKF
RL17_BURL3      LAFNRLR------------------------DRDSVAKLFDVLGPRFANRPGGYLRVLKF
RL17_BURMA      LAFNRLR------------------------DRDSVAKLFDVLGPRFANRPGGYLRILKF
RL17_BURP1      LAFNRLR------------------------DRDSVAKLFDVLGPRFANRPGGYLRILKF
RL17_BURPS      LAFNRLR------------------------DRDSVAKLFDVLGPRFANRPGGYLRILKF
RL17_BURTA      LAFNRLR------------------------DRDSVAKLFDVLGPRFANRPGGYLRILKF
RL17_PARXL      LAFNRLR------------------------DRDSVTKLFEVLGPRYATRPGGYLRVLKF
RL17_AROAE      LAFNRMR------------------------DREMVVKLFDVLGPRFAERNGGYLRILKF
RL17_NEIG1      LAFDRTR------------------------DRDVVVKLFGDLGPRFTARNGGYVRVLKY
RL17_NEIMA      LAFDRTR------------------------DRDVVVKLFGDLGPRFTARNGGYVRVLKY
RL17_NEIMB      LAFDRTR------------------------DRDVVVKLFGDLGPRFTARNGGYVRVLKY
RL17_CHRVO      LAFDRTR------------------------DREIVVKLFDVLGARYATRNGGYVRILKY
RL17_BORBR      LAFARLR------------------------DRDAVVKLFAEIGPRYANRNGGYTRVLKM
RL17_BORPA      LAFARLR------------------------DRDAVVKLFAEIGPRYANRNGGYTRVLKM
RL17_BORPE      LAFARLR------------------------DRDAVVKLFAEIGPRYANRNGGYTRVLKM
RL17_BORA1      LAFARLR------------------------DRDAVVKLFAEIGPRFANRNGGYTRVLKM
RL17_DECAR      LAFDRLR------------------------DRDIVVKLFAEIGPRYATRPGGYLRILKC
RL17_NITEU      LAFDRLR------------------------NRDNVIKIFSELGPRYQNRNGGYIRILKC
RL17_NITMU      LAFDRLR------------------------DRDMVGKLFSELGPRYQTRNGGYLRILKF
RL17_POLSJ      LAFDRLR------------------------DRDMVVKLFAELGPRYKARPGGYTRILKM
RL17_RHOFT      LAFDRLR------------------------DRDSVVKLFNDLGPRFKARPGGYTRILKM
RL17_THIDA      LAFDRLR------------------------DREMVVKLFGELGPRYQARPGGYLRILKY
RL17_CUPPJ      LAFARLR------------------------DRDMVTKLFTELGPRYNARPGGYTRILKF
RL17_CUPMC      LAFARLR------------------------DRDMVTKLFTELGPRYATRPGGYTRILKF
RL17_RALSO      LAFARLR------------------------DRDMVTKLFTELGPRYATRPGGYTRILKF
RL17_METFK      LAFSRLR------------------------DRDIVGKLFNELGPRYQTRNGGYLRILKC
RL17_COXBU      LAFNRLR------------------------DDAIVAKLFKEIAPRHKERPGGYCRVLKY
RL17_RHIME      QAISQIR------------------------DVAVVSKLFDAIASRYATRNGGYLRIMKA
RL17_AGRFC      QAISQIK------------------------DQDAVRKLFDAIASRYATRNGGYLRIMKA
RL17_RHIEC      QAISQIR------------------------DAAVVSKLFDTIATRYATRNGGYLRIMKA
RL17_RHIL3      QAISQIR------------------------DAAVVSKLFDTIATRYATRNGGYLRIMKA
RL17_BRUA2      QAISAIR------------------------DVRLVAKLFDTLAARYATRNGGYIRIMKA
RL17_BRUAB      QAISAIR------------------------DVRLVAKLFDTLAARYATRNGGYIRIMKA
RL17_BRUME      QAISAIR------------------------DVRLVAKLFDTLAARYATRNGGYIRIMKA
RL17_BRUSU      QAISAIR------------------------DVKLVAKLFDTLAARYATRNGGYIRIMKA
RL17_CHESB      QAIAAIR------------------------SETLVRRLFDTLAPRYASRNGGYTRIMKA
RL17_RHILO      QVIAQIG------------------------NEGVVKRLFDTIAPRYANRNGGYLRIMKA
RL17_BARHE      QAIASLR------------------------DAGKVAKLFDTLAPRYASRNGGYLRIMKA
RL17_BARQU      QAIAALR------------------------DAGKVAKLFDTLAPRYASRNGGYLRIMKA
RL17_RHOP2      QAISEMR------------------------DLDQVRKLFDVLAKRYADRQGGYTRIIKA
RL17_RHOPS      QAISEMR------------------------DLDQVRKLFGVLAPRYKDRNGGYTRIIKA
RL17_RHOPA      QAIAEMR------------------------DIEQVKKLFDVLAPRYKDRNGGYTRIIKA
RL17_NITHX      QAISEMR------------------------DIDQVKKLFAVLAPRYKDRQGGYTRIIKA
RL17_NITWN      QAISEMR------------------------DIDQVKKLFDVLAPRYKDRHGGYTRIIKA
RL17_BRADU      QAISEMR------------------------DKDQVKKLFDVLATRYKDRQGGYTRIIKA
RL17_RHOPB      QAISEMK------------------------DQDQVRKLFDVLAKRYADRQGGYTRIIKA
RL17_CAUVC      QAISSVR------------------------DVEQVGKLFAVLGPRYKERQGGYIRVLKA
RL17_HYPNA      AALSQVR------------------------NETAVRKLFDVFGDRYKDRNGGYTRVVKA
RL17_ROSDO      QAASKLK------------------------EDQYVAKLFDVLGPRYKDRQGGYVRVLKA
RL17_RUEST      QAASKLK------------------------EDKDVAKLFDVLGPRYKDRQGGYVRILKA
RL17_RUEPO      QAAAQLK------------------------EDKDVAKLFDVLAERYKDRQGGYVRILKA
RL17_RHOS4      QAAAQLK------------------------EDRHVARLFEILGPRYAERAGGYVRVLKA
RL17_JANSC      QAASQLK------------------------QDKDVAKLFEVLGPRYAERQGGYVRIMKA
RL17_MAGSA      QAYAFLR------------------------DDKVVAKLFAVIGPRYKERQGGYCRVLKA
RL17_RHORT      QAHAILR------------------------DDAVVAKLFAVLGPRYKDRQGGYSRILKA
RL17_GLUOX      QAFAQLR------------------------DDAVVTKLFSAVAERYKGRAGGYSRVLKA
RL17_NOVAD      LAHARLL------------------------DEAQEQKLFTTLAERYADRNGGYTRIIKA
RL17_ZYMMO      LAHSRLL------------------------DDTQLKKLFDVLAERYKDRNGGYTRIIKA
RL17_SPHAL      LAMSRLM------------------------DEAQLAKLFDVLAARYKDRNGGYTRIIKA
RL17_RICCN      SVLSKIK------------------------DKTAVEKLINILGTRYKDRPGGYTRIIKA
RL17_RICPR      SVLSKIK------------------------DKRAVEKIINILGVRYKDRPGGYTRIVKS
RL17_RICBR      NILSKIK------------------------DKKAIEKLIDVLGVRYKDRPGGYTRIVKA
RL17_ANADE      LAHRNVR------------------------DVEVLNKLFDTLAERFKARPGGYTRIVRV
RL17_DEIRA      LVAQDIH------------------------DKDVVRKVMDEVAPKYAERPGGYTRILRV
RL17_DEIGD      LIARDIH------------------------DKDVVRKVMNEVAPRYAERQGGYTRILRV
RL17_THET8      LVLRDLQ------------------------DVKLVRKLFDEIAPRYRDRQGGYTRVLKL
RL17_THET2      LVLRDLQ------------------------DVKLVRKLFDEIAPRYRDRQGGYTRVLKL
RL17_DESAG      QAYKVLG------------------------SHQLVKRLFDEIGPKFVGVPGGYTRVLKL
RL17_DESVH      QAYSVLG------------------------SHQLVKRLFDEIGPAFVGVPGGYTRVVKL
RL17_LAWIP      LAFQSMG------------------------DHQLVKHLFNNVAPAFVNVPGGYTRITRL
RL17_MYCTU      EVLKKLR------------------------DKDVVHTLFAEIGPFFADRDGGYTRIIKI
RL17_MYCBO      EVLKKLR------------------------DKDVVHTLFAEIGPFFADRDGGYTRIIKI
RL17_MYCLE      EVLKKLP------------------------DKDVVHALFAEIGPFFSDRDGGYTRIIKV
RL17_STRCO      QVLQVIT------------------------DKSIVHTLFTEIGPRYENRPGGYTRITKI
RL17_THEFY      QVLTKIR------------------------DKAVVHELFTEIGPRYENRNGGYTRITKI
RL17_BACFN      VVFSNLQ------------------------DKLAVTELFKEISVKIADRPGGYTRIIKT
RL17_BACFR      VVFSNLQ------------------------DKLAVTELFKEISVKIADRPGGYTRIIKT
RL17_BACTN      VVFSNLQ------------------------DKIAVTELFKEISVKIADRPGGYTRIIKT
RL17_PORGI      IAFSYLQ------------------------NKYALKELFGDVAAKIADRPGGYTRILKT
RL17_CYTH3      TVFSYLQ------------------------NKDSVKELFDNVVEKIAARPGGYTRILKT
RL17_HELPY      HVFAYLQ------------------------NKEATHKLVTEIAPKYAQRNGGYTRIQRT
RL17_HELPJ      HVFAYLQ------------------------NKEATHKLVTEIAPKYAQRNGGYTRIQRT
RL17_WOLSU      AVFAHLQ------------------------DKNATNKLVVEIAPKYSDRKGGYTRIVRT
RL17_CAMJE      AVFASLQ------------------------DKNATNKLVTEIAPKFKDRNGGYTRIIKT
RL17_CAMJR      AVFASLQ------------------------DKNATNKLVTEIAPKFKDRNGGYTRIIKT
RL17_THEMA      QINAVLG------------------------DRRLTNKLVDEIAKNYVGRRGGYVRVLRI
RL17_SALRD      EVFRHLQ------------------------SNDAIDELFGEVSERVGDRPGGYTRIIKL
RL17_CLOP1      QVLAFVT------------------------EEEVVKNLFDNIAPKYAERNGGYTRMYKV
RL17_CLOPE      QVLAFVT------------------------EEEVVKNLFDNIAPKYAERNGGYTRMYKV
RL17_CLOPS      QVLAFVT------------------------EEEVVKNLFDNIAPKYAERNGGYTRMYKV
RL17_CLOTE      QALSFVT------------------------EEEVVKRLFDDIAPKYAERNGGYTRMYKV
RL17_CLOAB      QVLSFVT------------------------EETVVKKLFDEVAPKYSERNGGYTRIYKM
RL17_CLOD6      QVLAYVM------------------------DETVVNNLFTDLAPKYAERNGGYTRIIKI
RL17_CALS4      QALAYIL------------------------DESVVKKLFDDIAPRYKERNGGYTRIFKL
RL17_SYMTH      QALAYIY------------------------DESVVTKLFNQIAPRYADRNGGYTRVIRT
RL17_GEOMG      QAASYIR------------------------DKKVVTKLFSTIAPRYKERDGGYTRIIKL
RL17_GEOSL      QAASYIR------------------------DKKVVTKLFSTIAPRYKERDGGYTRIIKL
RL17_DESPS      QALSYVR------------------------CAGVVHKLFGEIAEQFADRKGGYTRIIQT
RL17_PELCD      QAIKVIQ------------------------DRKVVGKLFELIAPRYTDRPGGYTRIIKL
RL17_FUSNN      NAFAFLR------------------------DEEVVAKIFNEIAPKYAERNGGYTRIIKT
RL17_BORBU      ELSKFIH------------------------DKHILNKLFTKISPVFRQRSGGYTRMIKL
RL17_TREPA      QVARFIW------------------------DKAVLHKLFADIGPRMREREGGYTRILKL
RL17_LEPIC      EVMKRIK------------------------DREVVVKLFEDIAKRFETKNGGYTRVLKL
RL17_LEPIN      EVMKRIK------------------------DREVVVKLFEDIAKRFETKNGGYTRVLKL
RL17_CHLMU      LAVGRLMVRYNTLTGKEARQVKAGDLSAYNVDRRVIGKLFDVLATRFSSRNGGYTRILKL
RL17_CHLTR      LAVGRLMVRYNTLTSKEARQVKAGDLSAYNVDRRVIGKLFDVLATRFSSRNGGYTRILKL
RL17_CHLPN      IAIGRLMVRYNKLTSKEARQAKGGDTSVYNVDRLVVNKLFDELGNRFVERKGGYTRILKL
RL17_AQUAE      QALSRLP------------------------DKPAIKKLFEDIAPRFEGRNGGYVRIIKL
RL17_BDEBA      LLLSRFP------------------------NKEAVATIMKDLSPRFKTRPGGYTRIIKI
RL17_DEHMC      RALAFVY------------------------MPGIVEKVFEDLSKRYAERPGGYTRMTKL
RL17_SYNP6      QALGYIY------------------------DKQLVHLLFEQAPERYAKRQGGYTRILRT
RL17_SYNE7      QALGYIY------------------------DKQLVHLLFEQAPERYAKRQGGYTRILRT
RL17_SYNY3      RALGYMY------------------------DKPTVHALFADAPSRYKDRDGGYTRIIRT
RL17_THEEB      RALGYLY------------------------DKQLVHSLFAQAPERYGDRQGGYTRIIRS
RL17_PROMA      RAIGYIY------------------------DKKLVHSLFEKAQERYGDRQGGYTRIVRT
RL17_PROMP      RALGYIY------------------------DKKLVHSLFEKAQERYGERNGGYTRIVRT
RL17_TRIEI      RALGYLY------------------------DKKLVHSLFNEAQERYGSRNGGYTRVLRT
RL17_NOSS1      RALGYIY------------------------DKQLVHALFEQVSSRYGNRQGGYTRILHT
RL17_TRIV2      RALGYIY------------------------DKQLVHALFEQVSSRYGNRQGGYTRILHT
RL17_SYNJA      QALAYIY------------------------DKELVRSLFEQAPERYRDRPGGYTRILRT
RL17_SYNJB      QALAYIY------------------------DKELVRSLFEQAPERYRDRPGGYTRILRT
RL17_RHOBA      RVLQLIG------------------------DREAVAVLFDTIAERFTDRPGGYTRIMRL
RL17_KORVE      QAAAYLM------------------------TSEAVDKLFNTISPRFGDREGGYLRIVRT
RL17_MYCGE      AVKKWLLNTNSLD------------------VDQLTNHLFKKVAPRFLKRNGGYSRVLKL
RL17_MYCPN      QVKKWLLNTNLFD------------------VDQLMDHLFSKVAPKYEKTPGGYSRVLKL
RL17_UREPA      AAAAILLGTNQHS------------------ADDLLRKLFNELGPKYANRAGGYTRVIKL
RL17_MYCCT      QAASWLRDIDADK------------------KETALQKLFNKLAKKYENRNGGYTSILKL
RL17_MYCH2      QILSFLYAQKTKA------------------GIKVMPYLFNKVAPRYQERNGGYTRIVRI
                                                      :.           ***  : : 

RL17_BACHD      GPRR-GDGAPMAIIELV-------------------------------------------
RL17_BACSK      GPRR-GDGAPMAIIEFV-------------------------------------------
RL17_BACSU      GPRR-GDGAPMAIIELV-------------------------------------------
RL17_BACLD      GPRR-GDGAPMAIIELV-------------------------------------------
RL17_GEOKA      GPRR-GDGAPMVIIELV-------------------------------------------
RL17_BACAN      GPRR-GDAAPMVIIELV-------------------------------------------
RL17_BACC1      GPRR-GDAAPMVIIELV-------------------------------------------
RL17_BACCR      GPRR-GDAAPMVIIELV-------------------------------------------
RL17_BACCZ      GPRR-GDAAPMVIIELV-------------------------------------------
RL17_BACHK      GPRR-GDAAPMVIIELV-------------------------------------------
RL17_STAAC      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAAM      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAAN      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAAR      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAAS      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAAW      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAHJ      GPRR-GDGAESVIIELVD------------------------------------------
RL17_STAEQ      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAES      GPRR-GDGAESVIIELV-------------------------------------------
RL17_STAS1      GPRR-GDGAESVIIELV-------------------------------------------
RL17_OCEIH      NERQ-GDGAKMAIIELV-------------------------------------------
RL17_SHISS      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_SHIDS      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_ECOLI      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_ECOL6      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_SHIBS      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_ECO57      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_SHIFL      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_ECOL5      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_ECOUT      GFRA-GDNAPMAYIELVDRSEK---AEAAAE-----------------------------
RL17_SALCH      GFRA-GDNAPMAYIELVDRSEK---TEAAAE-----------------------------
RL17_SALPA      GFRA-GDNAPMAYIELVDRSEK---TEAAAE-----------------------------
RL17_SALTI      GFRA-GDNAPMAYIELVDRSEK---TEAAAE-----------------------------
RL17_SALTY      GFRA-GDNAPMAYIELVDRSEK---TEAAAE-----------------------------
RL17_SODGM      GFRA-GDNAPMAYIEFVDHAEA---TAPAAEATAE-------------------------
RL17_PECAS      GFRA-GDNAPMAYIELVDRSVSQTEEVATAE-----------------------------
RL17_PHOLL      GFRA-GDNAPMAYIELVDRATEPQTEVATAE-----------------------------
RL17_YERPA      GFRA-GDNAPMAYIELVDRAAS-QAEVVAAE-----------------------------
RL17_YERPE      GFRA-GDNAPMAYIELVDRAAS-QAEVVAAE-----------------------------
RL17_YERPN      GFRA-GDNAPMAYIELVDRAAS-QAEVVAAE-----------------------------
RL17_YERPS      GFRA-GDNAPMAYIELVDRAAS-QAEVVAAE-----------------------------
RL17_HAEIN      GFRA-GDNAPMAYIELVDRPEV---AEATTEE----------------------------
RL17_HAEI8      GFRA-GDNAPMAYIELVDRPEV---AEATTEE----------------------------
RL17_HAES1      GFRA-GDNAPMAYIELVDRPAL---AEEAKTE----------------------------
RL17_HAEDU      GFRA-GDNAPMAYIELVDRPEV---AEVTAE-----------------------------
RL17_MANSM      GFRA-GDNAPMAYIELVDRPET---AAAVEE-----------------------------
RL17_VIBVU      GFRA-GDKAPMAYIELVDRP---AAEEAAAE-----------------------------
RL17_VIBVY      GFRA-GDKAPMAYIELVDRP---AAEEAAAE-----------------------------
RL17_VIBPA      GFRA-GDKAPMAYIELVDRP---AAEEAAE------------------------------
RL17_VIBCH      GFRA-GDKAPMAYIELVDRPE--AAVEAAAE-----------------------------
RL17_PHOPR      GFRT-GDKAPMAYIELVDRP---AQEAASAE-----------------------------
RL17_IDILO      GFRT-GDNAPMAYIELVGRPEVEEVEEVAEEAAE--------------------------
RL17_PSEA6      GFRT-GDNAPMAYVELVDRPEVEEVVETEDAAAE--------------------------
RL17_SHESM      GLRA-GDKAPMAYIELVGRPEAAQAVEVEAAE----------------------------
RL17_SHESR      GLRA-GDKAPMAYIELVGRPEAAQAVEVEAAE----------------------------
RL17_SHEON      GLRA-GDKAPMAYIELVGRPEAAQAVDVEAAE----------------------------
RL17_BUCAI      GFRS-GDKAPMAYIELVDRVKNNKKNEILKK-----------------------------
RL17_BUCBP      GFRS-GDQAPMAYIQLINRVKN-KKELVYKK-----------------------------
RL17_BUCAP      GFRF-GDKAPMAYIELVDRVRKSKEKKKLSSNNNLIKNK---------------------
RL17_METCA      GFRA-GDASPMAYVELVDRT----------------------------------------
RL17_PSE14      GFRA-GDNAPMAYVELVDRP--VGGSV-EPAE----------------------------
RL17_PSESM      GFRT-GDNAPMAYVELVDRP--VGGSV-EAAE----------------------------
RL17_PSEU2      GFRA-GDNAPMAYVELVDRP--IGGSV-EAAE----------------------------
RL17_PSEPK      GFRA-GDNAPMAYVELVDRP--VGGAV-EAAE----------------------------
RL17_PSEAE      GFRA-GDNAPMAYVELVDRP--VGGEVVEAAE----------------------------
RL17_PSEF5      GFRA-GDNAPMAYVELVDRA--VGGEA-VSAE----------------------------
RL17_LEGPH      GYRD-GDNAPMAIVELMDRP--VSSDD--TEE----------------------------
RL17_LEGPL      GYRD-GDNAPMAIVELMDRP--VISDD--TEE----------------------------
RL17_LEGPA      GYRD-GDNAPMAIVELMDRP--VSSDD--TEE----------------------------
RL17_CHRSD      GFRA-GDNAPMAYVELVDRP--VVEEA--AEE----------------------------
RL17_SACD2      GFRA-GDKAPMAYVELVDRPAPVAAEPVESSED---------------------------
RL17_XANCP      GFRA-GDNAPMAYVELVDRP--VVAEEVSE------------------------------
RL17_XANC8      GFRA-GDNAPMAYVELVDRP--VVAEEVSE------------------------------
RL17_XANAC      GFRA-GDNAPMAYVELVDRP--VVAEEVAE------------------------------
RL17_XANOM      GFRA-GDNAPMAYVELVDRP--VVAEEVAE------------------------------
RL17_XANC5      GFRA-GDNAPMAYVELVGRP--VVAEEVAE------------------------------
RL17_HAHCH      GLRP-GDSAPMAFVELVDRP--VVEAEGDNEE----------------------------
RL17_NITOC      GFRA-GDNAPMAIVELLERP--LPDSQ---EE----------------------------
RL17_HYDCU      GFRP-GDNAPMAYVELVDRP--QVESTE-SED----------------------------
RL17_ALKEH      GFRP-GDNAPMAFVELVDRP--LPVEEVEDEDEEEAAETN--------------------
RL17_ALCBS      GFRA-GDNAPMAYVELVDRP----ELVDADEE----------------------------
RL17_BURCA      GFRV-GDNAPMALVELLDRP---EVDETENVQEAE-------------------------
RL17_BURL3      GFRV-GDNAPMALVELLDRP---EVDETENVQEAE-------------------------
RL17_BURMA      GFRV-GDNAPMALVELLDRP---EVEETENVQEAE-------------------------
RL17_BURP1      GFRV-GDNAPMALVELLDRP---EVEETENVQEAE-------------------------
RL17_BURPS      GFRV-GDNAPMALVELLDRP---EVEETENVQEAE-------------------------
RL17_BURTA      GFRV-GDNAPMALVELLDRP---EVEETENVQEAE-------------------------
RL17_PARXL      GFRV-GDNAPMALVELLDRP---EVEEVE-VQEAE-------------------------
RL17_AROAE      GFRD-GDNAPLALIELLDRPD--EGEEGANVSEAAAA-----------------------
RL17_NEIG1      GFRK-GDNAPLALVELVDKP----------AAE---------------------------
RL17_NEIMA      GFRK-GDNAPLALVELVDKP----------AAE---------------------------
RL17_NEIMB      GFRK-GDNAPLALVELVDKP----------AAE---------------------------
RL17_CHRVO      GFRK-GDNAPMALVELVDRPED-AVAVEDNSAE---------------------------
RL17_BORBR      GFRQ-GDNAPMAFMELVDRPEV-DASEADSDAE---------------------------
RL17_BORPA      GFRQ-GDNAPMAFMELVDRPEV-DASEADSDAE---------------------------
RL17_BORPE      GFRQ-GDNAPMAFMELVDRPEV-DASEADSDAE---------------------------
RL17_BORA1      GFRQ-GDNAPMAYMELVDRPEV-DASEADGAAE---------------------------
RL17_DECAR      GFRV-GDNAPMAFVELLDRPEVTEAVEIEDAAE---------------------------
RL17_NITEU      GFRR-GDNAPMAIVELLDRPEA-GIISNDSAD----------------------------
RL17_NITMU      GFRK-GDNAPMALVELMDRPEQ-PATDTESKAG---------------------------
RL17_POLSJ      GFRV-GDNAPMALVELVDRPEI-EDTTADAAKAE--------------------------
RL17_RHOFT      GFRV-GDNAPMALVELVDRAEL-AEAPTDEKSED--------------------------
RL17_THIDA      GFRK-GDNAPMALVELVDRPES-DAAPVDAE-----------------------------
RL17_CUPPJ      GFRQ-GDNAPMALVELVDRPEITEAPAEEAAE----------------------------
RL17_CUPMC      GFRQ-GDNAPMALVELVDRPEITEAPAEEAAE----------------------------
RL17_RALSO      GFRQ-GDNAPMALVELVDRPEVAEAVEAEAAAE---------------------------
RL17_METFK      GFRV-GDNAPMALVELVDRPELATDGEVVTAE----------------------------
RL17_COXBU      GFRN-GDSAPMAIVELVDRE-----ESESSED----------------------------
RL17_RHIME      GFRQ-GDNAPLAVIEFVDRDVDAKGSKDRARVSAEAEAAEAA------------------
RL17_AGRFC      GYRQ-GDNAALAVVEFVERDVDAKGAADKARVAAEAAAAEAA------------------
RL17_RHIEC      GFRQ-GDNAAMAVIEFVDRDTYAKGAADKARVAAEEQAVAA-------------------
RL17_RHIL3      GFRQ-GDNAAMAVIEFVDRDAYAKGAADKARVAAEEQAVAA-------------------
RL17_BRUA2      GFRA-GDNAPLAVVEFVERDVDAKGKADRARVEAEAAAEADAA-----------------
RL17_BRUAB      GFRA-GDNAPLAVVEFVERDVDAKGKADRARVEAEAAAEADAA-----------------
RL17_BRUME      GFRA-GDNAPLAVVEFVERDVDAKGKADRARVEAEAAAEADAA-----------------
RL17_BRUSU      GFRA-GDNAPLAVVEFVERDVDAKGKADRARVEAEAAAEADAA-----------------
RL17_CHESB      GFRH-GDNAAMAVIEFVDRDPSVKGAADRARVEAEAANEEAEAA----------------
RL17_RHILO      GFRH-GDNAAMAVIEFVDRDTSAKGAGDRARLEAEGTDAEAAAA----------------
RL17_BARHE      GFRT-GDNAPMAVIEFVDRDVDAKGAVDRVRTESSANEKEASS-----------------
RL17_BARQU      GFRT-GDNAPMAVIEFVDRDVDAKGAVDRARAESAANEKEASSL----------------
RL17_RHOP2      GFRY-GDNAPMAVIEFVDRDEDAKGK-DSGPSQDGA-AEAA-------------------
RL17_RHOPS      GFRY-GDNAPMAVIEFVDRDEDAKGK-DSGPTQE---SEAA-------------------
RL17_RHOPA      GFRY-GDNAAMAVIEFVDRDEDAKGR-DSGPTQDNSEAEAA-------------------
RL17_NITHX      GFRY-GDNAPMAVIEFVDRDVDAKGQ-DSGPVQEKA-TEAA-------------------
RL17_NITWN      GFRY-GDNAPMAVIEFVDRDVEAKGQ-DSGPVQNEA-SEAA-------------------
RL17_BRADU      GFRY-GDNAAMAVIEFVDRDVDAKGQ-DSGPVQEKE-AEAA-------------------
RL17_RHOPB      GFRY-GDNAPMAVIEFVDRDENAKGL-DSGQAEE----KAA-------------------
RL17_CAUVC      GFRY-GDNAPMAVIEFVDRDVSEKGK-DSGPVYVND-AED--------------------
RL17_HYPNA      GFRP-GDNAPIAVLELVDRDESAKGAADKARHAAELEAAEG-------------------
RL17_ROSDO      GFRY-GDMAPMAIIEFVDRDRDAKGAADRARLAAEENAEEA-------------------
RL17_RUEST      GFRY-GDMAPMAIIEFVDRDVSAKGAADKARLAEIEAVEDEE------------------
RL17_RUEPO      GFRY-GDMAPMAIIEFVDRDVDAKGAADKARLAEEEAAAEE-------------------
RL17_RHOS4      GFRY-GDMAPMAIIEFVDRDPNAKGAADKARTAAEEALEE--------------------
RL17_JANSC      GFRY-GDMAPMAIIEFVDRDVDAKGAADRARVEAEADAE---------------------
RL17_MAGSA      GFRY-GDCAPMAIIELVDRDLAAKGT-DSGPTADKKADADEE------------------
RL17_RHORT      GFRY-GDAAPMAVIELVDRDPAAKGL-DSGPTAEANDDDSEE------------------
RL17_GLUOX      GVRY-GDNADMAVIELVDRDVAAKGQ-DSGPKQNVAEEQEAA------------------
RL17_NOVAD      GYRA-SDAAPLAVIELVDRDTSAKGQ-DSGPVLTADEDEFEAA-----------------
RL17_ZYMMO      GIRA-SDAAQMAVIELVDRDTTAKGQ-DSGPVQVEEQENEEA------------------
RL17_SPHAL      GIRA-SDAAPIAIIEFVDRDMGAKGQ-DSGPVTTDEELEDA-------------------
RL17_RICCN      GFRY-GDLAPIAYIEFVDRDINAKGNIQQD-ANEEIKN----------------------
RL17_RICPR      GFRY-GDLAPIAYIEFVDRDINAKGNVHQD-ANEEIKN----------------------
RL17_RICBR      GFRY-GDLAPIAYIEFVDRDINAKGNIPQDNSKEDIKSNKGTK-----------------
RL17_ANADE      GRRA-GDNAEMSVIELVDRAPAAAPEAEEKGEKKAAGKAEKAPKAAKAPKAEKKPAKKAA
RL17_DEIRA      GTRR-GDGVTMALIELV-------------------------------------------
RL17_DEIGD      GTRR-GDGVTMALIELV-------------------------------------------
RL17_THET8      AERRRGDGAPLALVELVE------------------------------------------
RL17_THET2      AERRRGDGAPLALVELVE------------------------------------------
RL17_DESAG      GAPRPGDNAPMAVIELTRLGDAEAAAKEAPAKEVAEEKAAKPAKKAAPKKAEKEEAEDAA
RL17_DESVH      GQPRRGDCAPLAIIEFTRTVAASEAA-------------------AAPAEAE--------
RL17_LAWIP      ALRRKGDCAPMAMIEFTCQKIDEKSI----------------------------------
RL17_MYCTU      EARK-GDNAPMAVIELVREKTVTSEANRARRVAAAQAKAKKAAAMPTEESEAKPAEEGDV
RL17_MYCBO      EARK-GDNAPMAVIELVREKTVTSEANRARRVAAAQAKAKKAAAMPTEESEAKPAEEGDV
RL17_MYCLE      EARK-GDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEEVEATSD-EV
RL17_STRCO      GNRR-GDNAPMAVIELVEALTVAQQATGEA---EAATKRAAKDAEGSAEVSEAKVDTTKA
RL17_THEFY      GNRK-GDNAPMAVIELVEALNKPATGSKRAQTEEAASQEPAAEAGKQPAEGATSVQTAEA
RL17_BACFN      GNRL-GDNAEMCFIELVDYNENMAKEKVAKKATRTRRSKKTTEAAP--AAEVPATEEPKA
RL17_BACFR      GNRL-GDNAEMCFIELVDYNENMAKEKVAKKATRTRRSKKTTEAAP--AAEVPATEEPKA
RL17_BACTN      GNRL-GDNAEMCFIELVDYNENMAKEKVAKKATRTRRSKKSAEAAAPAAVEAPATEEPKA
RL17_PORGI      GYRL-GDNAAMCFIELVDYNENMLGE-AAKKATKTRRSRK-RKSADVVVEAAPAEETPKA
RL17_CYTH3      GARI-GDNADMCIIELVDYNETYVKDSEVKVAAKRTRRSTAAKKDD---SSESTGAEPQA
RL17_HELPY      TFRR-GDASTLATIEFV-------------------------------------------
RL17_HELPJ      TFRR-GDASTLATIEFV-------------------------------------------
RL17_WOLSU      RLRK-GDAAPLAFIELI-------------------------------------------
RL17_CAMJE      RIRR-GDAAEMAFIEFVA------------------------------------------
RL17_CAMJR      RIRR-GDAAEMAFIEFVA------------------------------------------
RL17_THEMA      GFRR-GDAAEMSLVQLVEASSQEG------------------------------------
RL17_SALRD      GQRS-GDGAELALIELVDYNDVPPADTGQGGSGGTRRGSGKGRRTSTEEEQADASSSGDS
RL17_CLOP1      GPRR-GDGAEVVILELV-------------------------------------------
RL17_CLOPE      GPRR-GDGAEVVILELV-------------------------------------------
RL17_CLOPS      GPRR-GDGAEVVILELV-------------------------------------------
RL17_CLOTE      GPRR-GDGAEIVILELV-------------------------------------------
RL17_CLOAB      GPRR-GDGAEIVILELV-------------------------------------------
RL17_CLOD6      GPRK-GDAAEMAFIELV-------------------------------------------
RL17_CALS4      GPRR-GDGAPLAVIELV-------------------------------------------
RL17_SYMTH      GVRK-GDAAPMAILELV-------------------------------------------
RL17_GEOMG      GIRP-GDNAPLSVIELVEEQVNKKEKKAKP-AKAAIVATAPAVEQAAVLTSPADEPVVAE
RL17_GEOSL      GIRP-GDCAPLSVIELVEEQFEKKVKKSKPTAPAQAVATKPAVEE----TREAAAAQPQE
RL17_DESPS      GVRR-GDNASMAIIELVGYDETVAAATTEA------------------------------
RL17_PELCD      GNRL-GDNAPQVIIELVEEEFTPRVRKAADDKAVAESVATEVAEATEAAADTKQAE----
RL17_FUSNN      SVRK-GDSAEMAIIELV-------------------------------------------
RL17_BORBU      GKRY-GDAAEMAILELV----EKPLKVE--------------------------------
RL17_TREPA      GLRQ-GDAAHVVVLELVDYTFEKSLKKRARTDSVPARKGAGKKDASRVSGTVPDGQSQKI
RL17_LEPIC      VNRI-SDNSEVGILELTSRKERSTLLKERIEKREIQTKAREEKRATRKSNSAPVSKETTS
RL17_LEPIN      VNRI-SDNSEVGILELTSRKERSTLLKERIEKREIQTKAREEKRATRKSNSAPVNKETTS
RL17_CHLMU      QNRV-GDNAQKCIIEFLAD-----------------------------------------
RL17_CHLTR      QNRV-GDNAQKCIIEFLA------------------------------------------
RL17_CHLPN      QNRI-GDNAQKCIIEFLAS-----------------------------------------
RL17_AQUAE      PYRRRGDGAEMAIIEWVE------------------------------------------
RL17_BDEBA      G-RRPGDTAEMAFLEFVDYDFEAKTADTAEKSEKSAKTAKAAKAPAKKATAKKASTKAVA
RL17_DEHMC      G-PRQGDGAEMVKLELIK------------------------------------------
RL17_SYNP6      VRRR-GDNAEMAIIELT-------------------------------------------
RL17_SYNE7      VRRR-GDNAEMAIIELT-------------------------------------------
RL17_SYNY3      LRRR-GDNAEMAVIELV-------------------------------------------
RL17_THEEB      VRRR-GDNAELAVIELV-------------------------------------------
RL17_PROMA      VPRR-GDNAEMAIIELV-------------------------------------------
RL17_PROMP      VARK-GDNAQMAIIELV-------------------------------------------
RL17_TRIEI      IRRR-GDNAEMAIIELI-------------------------------------------
RL17_NOSS1      VPRR-GDNAEMAIIELV-------------------------------------------
RL17_TRIV2      VPRR-GDNAEMAIIELV-------------------------------------------
RL17_SYNJA      VRRR-GDGAEMAVIELV-------------------------------------------
RL17_SYNJB      VHRR-GDGAEMAVIELV-------------------------------------------
RL17_RHOBA      AKPRLGDGGTRAILELVGKNDRVTRSAQRPAFEQDAPESDSAPEAEAKTEEETASAN---
RL17_KORVE      GFRP-GDGGEKAFIELLGSEKIIDEKREKRAAARAKRAEDNRKALEAQQAQAEAETTGET
RL17_MYCGE      GVRR-GDSTEMAILQLIDATN---------------------------------------
RL17_MYCPN      GPRR-GDATEMAILQLTDAKYK--------------------------------------
RL17_UREPA      GNRP-GDNTEEAVLQLV-------------------------------------------
RL17_MYCCT      DNRK-GDNAPMVIIKLI-------------------------------------------
RL17_MYCH2      PSRL-GDNSKMAIIELV-------------------------------------------
                     .*      ::                                             

RL17_BACHD      --------------------------------------
RL17_BACSK      --------------------------------------
RL17_BACSU      --------------------------------------
RL17_BACLD      --------------------------------------
RL17_GEOKA      --------------------------------------
RL17_BACAN      --------------------------------------
RL17_BACC1      --------------------------------------
RL17_BACCR      --------------------------------------
RL17_BACCZ      --------------------------------------
RL17_BACHK      --------------------------------------
RL17_STAAC      --------------------------------------
RL17_STAAM      --------------------------------------
RL17_STAAN      --------------------------------------
RL17_STAAR      --------------------------------------
RL17_STAAS      --------------------------------------
RL17_STAAW      --------------------------------------
RL17_STAHJ      --------------------------------------
RL17_STAEQ      --------------------------------------
RL17_STAES      --------------------------------------
RL17_STAS1      --------------------------------------
RL17_OCEIH      --------------------------------------
RL17_SHISS      --------------------------------------
RL17_SHIDS      --------------------------------------
RL17_ECOLI      --------------------------------------
RL17_ECOL6      --------------------------------------
RL17_SHIBS      --------------------------------------
RL17_ECO57      --------------------------------------
RL17_SHIFL      --------------------------------------
RL17_ECOL5      --------------------------------------
RL17_ECOUT      --------------------------------------
RL17_SALCH      --------------------------------------
RL17_SALPA      --------------------------------------
RL17_SALTI      --------------------------------------
RL17_SALTY      --------------------------------------
RL17_SODGM      --------------------------------------
RL17_PECAS      --------------------------------------
RL17_PHOLL      --------------------------------------
RL17_YERPA      --------------------------------------
RL17_YERPE      --------------------------------------
RL17_YERPN      --------------------------------------
RL17_YERPS      --------------------------------------
RL17_HAEIN      --------------------------------------
RL17_HAEI8      --------------------------------------
RL17_HAES1      --------------------------------------
RL17_HAEDU      --------------------------------------
RL17_MANSM      --------------------------------------
RL17_VIBVU      --------------------------------------
RL17_VIBVY      --------------------------------------
RL17_VIBPA      --------------------------------------
RL17_VIBCH      --------------------------------------
RL17_PHOPR      --------------------------------------
RL17_IDILO      --------------------------------------
RL17_PSEA6      --------------------------------------
RL17_SHESM      --------------------------------------
RL17_SHESR      --------------------------------------
RL17_SHEON      --------------------------------------
RL17_BUCAI      --------------------------------------
RL17_BUCBP      --------------------------------------
RL17_BUCAP      --------------------------------------
RL17_METCA      --------------------------------------
RL17_PSE14      --------------------------------------
RL17_PSESM      --------------------------------------
RL17_PSEU2      --------------------------------------
RL17_PSEPK      --------------------------------------
RL17_PSEAE      --------------------------------------
RL17_PSEF5      --------------------------------------
RL17_LEGPH      --------------------------------------
RL17_LEGPL      --------------------------------------
RL17_LEGPA      --------------------------------------
RL17_CHRSD      --------------------------------------
RL17_SACD2      --------------------------------------
RL17_XANCP      --------------------------------------
RL17_XANC8      --------------------------------------
RL17_XANAC      --------------------------------------
RL17_XANOM      --------------------------------------
RL17_XANC5      --------------------------------------
RL17_HAHCH      --------------------------------------
RL17_NITOC      --------------------------------------
RL17_HYDCU      --------------------------------------
RL17_ALKEH      --------------------------------------
RL17_ALCBS      --------------------------------------
RL17_BURCA      --------------------------------------
RL17_BURL3      --------------------------------------
RL17_BURMA      --------------------------------------
RL17_BURP1      --------------------------------------
RL17_BURPS      --------------------------------------
RL17_BURTA      --------------------------------------
RL17_PARXL      --------------------------------------
RL17_AROAE      --------------------------------------
RL17_NEIG1      --------------------------------------
RL17_NEIMA      --------------------------------------
RL17_NEIMB      --------------------------------------
RL17_CHRVO      --------------------------------------
RL17_BORBR      --------------------------------------
RL17_BORPA      --------------------------------------
RL17_BORPE      --------------------------------------
RL17_BORA1      --------------------------------------
RL17_DECAR      --------------------------------------
RL17_NITEU      --------------------------------------
RL17_NITMU      --------------------------------------
RL17_POLSJ      --------------------------------------
RL17_RHOFT      --------------------------------------
RL17_THIDA      --------------------------------------
RL17_CUPPJ      --------------------------------------
RL17_CUPMC      --------------------------------------
RL17_RALSO      --------------------------------------
RL17_METFK      --------------------------------------
RL17_COXBU      --------------------------------------
RL17_RHIME      --------------------------------------
RL17_AGRFC      --------------------------------------
RL17_RHIEC      --------------------------------------
RL17_RHIL3      --------------------------------------
RL17_BRUA2      --------------------------------------
RL17_BRUAB      --------------------------------------
RL17_BRUME      --------------------------------------
RL17_BRUSU      --------------------------------------
RL17_CHESB      --------------------------------------
RL17_RHILO      --------------------------------------
RL17_BARHE      --------------------------------------
RL17_BARQU      --------------------------------------
RL17_RHOP2      --------------------------------------
RL17_RHOPS      --------------------------------------
RL17_RHOPA      --------------------------------------
RL17_NITHX      --------------------------------------
RL17_NITWN      --------------------------------------
RL17_BRADU      --------------------------------------
RL17_RHOPB      --------------------------------------
RL17_CAUVC      --------------------------------------
RL17_HYPNA      --------------------------------------
RL17_ROSDO      --------------------------------------
RL17_RUEST      --------------------------------------
RL17_RUEPO      --------------------------------------
RL17_RHOS4      --------------------------------------
RL17_JANSC      --------------------------------------
RL17_MAGSA      --------------------------------------
RL17_RHORT      --------------------------------------
RL17_GLUOX      --------------------------------------
RL17_NOVAD      --------------------------------------
RL17_ZYMMO      --------------------------------------
RL17_SPHAL      --------------------------------------
RL17_RICCN      --------------------------------------
RL17_RICPR      --------------------------------------
RL17_RICBR      --------------------------------------
RL17_ANADE      KAE-----------------------------------
RL17_DEIRA      --------------------------------------
RL17_DEIGD      --------------------------------------
RL17_THET8      --------------------------------------
RL17_THET2      --------------------------------------
RL17_DESAG      EA------------------------------------
RL17_DESVH      --------------------------------------
RL17_LAWIP      --------------------------------------
RL17_MYCTU      VGASEPDAKAPEEPPAEAPEN-----------------
RL17_MYCBO      VGASEPDAKAPEEPPAEAPEN-----------------
RL17_MYCLE      AYTSEPD-KAAEH-------------------------
RL17_STRCO      DDEAAAEESKDA--------------------------
RL17_THEFY      ADASQAEGEAEEK-------------------------
RL17_BACFN      ESAE----------------------------------
RL17_BACFR      ESAE----------------------------------
RL17_BACTN      ESAE----------------------------------
RL17_PORGI      AEE-----------------------------------
RL17_CYTH3      --------------------------------------
RL17_HELPY      --------------------------------------
RL17_HELPJ      --------------------------------------
RL17_WOLSU      --------------------------------------
RL17_CAMJE      --------------------------------------
RL17_CAMJR      --------------------------------------
RL17_THEMA      --------------------------------------
RL17_SALRD      SDEESESVEEDEATAEEASADAEQGEAEEEEESEEDNT
RL17_CLOP1      --------------------------------------
RL17_CLOPE      --------------------------------------
RL17_CLOPS      --------------------------------------
RL17_CLOTE      --------------------------------------
RL17_CLOAB      --------------------------------------
RL17_CLOD6      --------------------------------------
RL17_CALS4      --------------------------------------
RL17_SYMTH      --------------------------------------
RL17_GEOMG      ENAPQSAVKDAVDECEGKAD------------------
RL17_GEOSL      PEVEISEVKDPAEECEAKAD------------------
RL17_DESPS      --------------------------------------
RL17_PELCD      --------------------------------------
RL17_FUSNN      --------------------------------------
RL17_BORBU      --------------------------------------
RL17_TREPA      GKKKE---------------------------------
RL17_LEPIC      KKK-----------------------------------
RL17_LEPIN      KKK-----------------------------------
RL17_CHLMU      --------------------------------------
RL17_CHLTR      --------------------------------------
RL17_CHLPN      --------------------------------------
RL17_AQUAE      --------------------------------------
RL17_BDEBA      AKKKAVKKAQKKDRAASAARA-----------------
RL17_DEHMC      --------------------------------------
RL17_SYNP6      --------------------------------------
RL17_SYNE7      --------------------------------------
RL17_SYNY3      --------------------------------------
RL17_THEEB      --------------------------------------
RL17_PROMA      --------------------------------------
RL17_PROMP      --------------------------------------
RL17_TRIEI      --------------------------------------
RL17_NOSS1      --------------------------------------
RL17_TRIV2      --------------------------------------
RL17_SYNJA      --------------------------------------
RL17_SYNJB      --------------------------------------
RL17_RHOBA      --------------------------------------
RL17_KORVE      KA------------------------------------
RL17_MYCGE      --------------------------------------
RL17_MYCPN      --------------------------------------
RL17_UREPA      --------------------------------------
RL17_MYCCT      --------------------------------------
RL17_MYCH2      --------------------------------------