CLUSTAL format seed alignment for MF_01371_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL30_ECOLI      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_SHIFL      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_SHIBS      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_SHIDS      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_ECOL5      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_ECOUT      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_ECO57      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_ECOL6      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_SHISS      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIRGMIN
RL30_SALCH      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAVRGMVN
RL30_SALPA      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAVRGMVN
RL30_SALTI      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAVRGMVN
RL30_SALTY      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAVRGMVN
RL30_PECAS      -------MAKT----IKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAVRGMVN
RL30_YERPA      -------MAKT----IKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVRGMVN
RL30_YERPE      -------MAKT----IKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVRGMVN
RL30_YERPN      -------MAKT----IKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVRGMVN
RL30_YERPS      -------MAKT----IKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVRGMVN
RL30_SODGM      -------MAQT----IKITQTRSSIGRLPKHKATLVGLGLRRIGHTVEREDTPAVRGMVN
RL30_BAUCH      -------MIKN----IRITQTRSSIGCLPKHKATLAGLGLRRIGHAVERQDNPVIQGMIN
RL30_PHOLL      -------MAKT----IKVTQIRSSIGRLPKHKATLVGLGLRRIGHTVEREDTPAIRGMIN
RL30_HAEI8      -------MAKT----IKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVRGMIN
RL30_MANSM      -------MAKT----IKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVRGMIN
RL30_PASMU      -------MAKT----IKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVRGMIN
RL30_HAEIN      -------MAKT----IKVTQVRSSIARLPKHKATLRGLGLRHIHHTVELIDTPAVRGMIN
RL30_HAES1      -------MAKT----IKVTQVRSSIARLPKHKATLRGLGLRRINHTVELIDTPAIRGMIN
RL30_HAEDU      -------MAKT----IKVTQTRSSIARLPKHKATLKGLGLRNIRHTVELIDTPAIRGMIN
RL30_PSEA6      -----MNMAKM----IKVKQTKSAIGRLPKHKATLTGLGLRRIGHVRELEDTPSVRGMIN
RL30_IDILO      ------MAKKT----IKVTQTRSSIGRLPKHKATLRGLGLRRIGHTVELEDTAAVRGMVN
RL30_CHRSD      ------MASAT----IKVTQTRSTIGILEKHKATMRGLGLRRIGHTVELEDTPAVRGMVN
RL30_SHEON      ------MATKT----VKVTQTKSGIGRLPKHRATLTGLGLRRIGHTVELEDTPSVRGMIN
RL30_SHESM      ------MATKT----VKVTQTKSAIGRLPKHRATLTGLGLRRIGHTVELEDTPSVRGMIN
RL30_SHESR      ------MATKT----VKVTQTKSAIGRLPKHRATLTGLGLRRIGHTVELEDTPSIRGMIN
RL30_SHEDO      ------MATKT----LKVTQTKSGIGRLPKHRATLTGLGLRRIGHTVELEDTPSVRGMIN
RL30_COLP3      -----MRMSKT----VKVTQLKSSIGRLPKHRATLKGLGLRRINHTVELEDTPSVRGMIN
RL30_PHOPR      -------MANT----IKVTQTKSSIGRLPKHVACLRGLGLRRINHTVELEDTACVRGMIN
RL30_ALIF1      -------MSKT----IKVTQTKSSIGRLPKHILCLKGLGLRRINHTVEVEDTPCTRGMIN
RL30_VIBCH      --------MAT----IKVTQTKSSIGRLPKHKATLRGLGLRKINHTVELEDTPCVRGMIN
RL30_VIBPA      --------MAT----IKVTQTKSSIGRLPKHKATLRGLGLRKINHTVELEDTPCVRGMIN
RL30_VIBVU      --------MAT----IKVTQTKSSIGRLPKHKATLRGLGLRRINHTVELEDTPCIRGMIN
RL30_VIBVY      --------MAT----IKVTQTKSSIGRLPKHKATLRGLGLRRINHTVELEDTPCIRGMIN
RL30_PSEHT      ------MANQT----VKVTQVKSSIGRLPKHKATLRGLGLRRINHTVELEDTACVRGMIN
RL30_BUCAI      --------MKN----IKITQIKSAIGRLPKHKKTLIGLGLRYIGHTVIREDTPSIQGMVK
RL30_BUCAP      --------MKT----IKITQIKSSIGRIPDHKKTLLGLGLRHIGHSVIRQDTPSIRGMIK
RL30_BUCBP      -------MIKL----ISITQIKSSIGRLPKHKATLSGLGLRYIGHTVLRKNTPSVRGMIK
RL30_BLOFL      ----------M----LKITQIRSSIGCIPKHKATLRGLGLRRIGNTVSKIDTPSVRGMIN
RL30_ALCBS      ------MAEK-----IKVKLVKSTNGRLEKHRACVRGLGLRRIGHTVEVEDTPSVRGMIN
RL30_SACD2      ------MAKKT----VKVTQVKSSSGRLKAHRACISGLGLRRIGHTVEVEDTPSVRGMIN
RL30_HAHCH      ----MANAAKT----IKVTLVKSTIGILPKHKDCVRGLGLRKINHTVEVEDTAAVRGMIN
RL30_PSE14      --------MAT----VKVTLIKSMTGRIPNHRLCIKGLGLRRIGHTVEVLDTPENRGMIN
RL30_PSESM      --------MAT----VKVTLIKSMTGRIPNHRLCIKGLGLRRIGHTVEVLDTPENRGMIN
RL30_PSEU2      --------MAT----VKVTLIKSMTGRIPNHRLCIKGLGLRRIGHTVEVLDTPENRGMIN
RL30_PSEF5      --------MAT----VKVTLIKSMTGRIPNHKLCVKGLGLRRIGHTVEVQDTPENRGMIN
RL30_PSEPF      --------MAT----VKVTLIKSMTGRIPNHKLCVKGLGLRRIGHTVEVQDTPENRGMIN
RL30_PSEPK      --------MAT----VKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVQDTPENRGMIN
RL30_PSEAE      --------MAT----VKVTLVKSLNGRLANHKACVKGLGLRRINHTVEVQDTPENRGMIN
RL30_FRAT1      -----MTQAKT----FKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMAN
RL30_FRATH      -----MTQAKT----FKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMAN
RL30_FRATO      -----MTQAKT----FKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMAN
RL30_FRATT      -----MTQAKT----FKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMAN
RL30_CHRVO      -----MSNAKT----VKVTLVKSLIGRLESHKACARGLGLKKIRQTVEVLDTPENRGMIN
RL30_NEIMA      -----MAEQKK----IRVTLVKSLIGTIESHRACARGLGLRRREHTVEVLDTPENRGMIN
RL30_NEIMB      -----MAEQKK----IRVTLVKSLIGTIESHRACARGLGLRRREHTVEVLDTPENRGMIN
RL30_NEIG1      -----MAEQKK----IRVTLVKSLIGTIESHRACARGLGLRRREHTVEVLDTSENRGMIN
RL30_THIDA      -----MSEQKK----IKVTLVKSLIGTKAPHRACVRGLGLRRMHHTVEVLDTPENRGMIT
RL30_COXBU      -----MVQEKK----LRVTLVKSKYGRKPGHRECIEGLGLRRMHQTVEVTDTPANRGMIE
RL30_HYDCU      -----MSDKKL----VNVTLVKSTIGRLPAHKACVAGLGLRKMHQTVAVIDTPENRGMIN
RL30_METFK      -----MAKSNKANDLIKVTLVRSTIGRIKAHRASVAGLGLRRLNQTVEVQDTPANRGMIN
RL30_ALKEH      -----MTTQKQ----LKVTQKRSTVGRIASHKACVAGLGLRRINHSVVVADTPENRGMIN
RL30_BORBR      ----MAQ--KQ----IKVTLVRSVIGTKQSHRDTIRGLGLRRINSSRVLVDTPEVRGMIH
RL30_BORPA      ----MAQ--KQ----IKVTLVRSVIGTKQSHRDTIRGLGLRRINSSRVLVDTPEVRGMIH
RL30_BORPE      ----MAQ--KQ----IKVTLVRSVIGTKQSHRDTIRGLGLRRINSSRVLVDTPEVRGMIH
RL30_DECAR      ----MAD--KK----IKVTLVKSVIGTKQDHRATVKGLGLRKLNSSSELIDTPAVRGMIQ
RL30_NITMU      ----MTQNPKK----IKVTLVKSLIGTKQAHRATARGLGLRHVNSSVEVEDTPAVRGMIN
RL30_AROAE      ----MSE--KT----IKVTLVKSVIGTKQSHRATVRGLGLRRTNHCVELQDTPEIRGMVN
RL30_BURCA      ------MSEKT----VKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_BURL3      ------MSEKT----VKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_BURMA      ------MSEKT----VKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_BURTA      ------MSEKT----VKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_BURP1      ------MSEKT----VKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_BURPS      ------MSEKT----VKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_PARXL      ------MSDKT----VKVQLVKSLIGTRETHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_CUPPJ      ------MSQKT----VKVQLVRSLIGTREDHRATVRGLGLRRINSVSELQDTPAVRGMIN
RL30_CUPMC      ------MSQKT----VKVQLVRSLIGTREDHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_RALSO      ------MSQKI----VKVQLVRSLIGTREDHRATVRGLGLRRLNSVSELQDTPAVRGMIN
RL30_POLSJ      -----MTKEAK----VKVQLVRSPIGTKESHRATVRGLGLRGVNSVSELQDTPAVRGMIN
RL30_RHOFT      -----MTTQQT----IKVQLIRSPIGCQESHRATVRGLGLRKIRSTSELVDTPEVRGMIN
RL30_XANAC      ---MAKDTNKT----VKVRLVRGLRGTQSRHRLSVRALGLNKLNDVRELKDSPQVRGLIN
RL30_XANOM      ---MAKDTNKT----VKVRLVRGLRGTQSRHRLSVRALGLNKLNDVRELKDSPQVRGLIN
RL30_XANC8      ---MAKDTGKT----VKVRLVRGLRGTQSRHRLSVHALGLNKINDVRELKDSPQVRGLIN
RL30_XANCP      ---MAKDTGKT----VKVRLVRGLRGTQSRHRLSVHALGLNKINDVRELKDSPQVRGLIN
RL30_XYLFA      ---MVHEYDNT----LKVCLVRSLIGVPSRHRLSVRALGLRKVSDMRKVNDTPQVRGLIK
RL30_XYLFT      ---MVHEYDKT----LKVCLVRSLIGVPSRHRLSVRALGLSKVSDMRKVNDTPQVRGLIN
RL30_NITEU      -----MEKRKT----IKVTLVKSLIGTRHSHRLVIKGMGLRRLNHTVSLCDHPSIRGMIN
RL30_METCA      ------MTVKT----LRVTQVRSANGRLETHKACLRGLGLRKPHHTVEVRGTPEILGMIS
RL30_PSYA2      --------MKK----MKVTQFKSGAHRLKSHKASLKGLGLRRINHTVIVEDTPSTRGMVN
RL30_PSYCK      --------MKK----MKVTQFKSGAHRLKSHKACLKGLGLRRINHSVVVEDTPSTRGMVN
RL30_ACIAD      --------MKT----IKVTQIKSASHRLKNHKLCLQGLGLRRIGHTVEVQDTPSNRGMIN
RL30_RUEPO      -------MAKT----IVVKQIGSPIRRPADQRATLVGLGLNKMHKTRELEDTPSVRGMIR
RL30_RUEST      -------MAKT----IVVKQIGSPIRRPAEQRATLIGLGLNKMHKTRELEDTPSVRGMVN
RL30_ROSDO      -------MAKT----IVIKQIGSPIRRPAKQRATLIGLGLNKMHKTRELEDTPSVRGMIN
RL30_AGRFC      MAKKTTEAKKT----VTVEQIGSPIRRPAIQRQTLVGLGLNKMHRQRTLEDTPAVRGMIR
RL30_RHORT      ----MAETSKT----VVVTQIGSPIGRRSDQRATLIGLGLNKMNRTRELEDTPAVRGMID
RL30_ZYMMO      ----MA----T----LKVTQIGSPIRRSPDQRATLIGLGLNKMHRTRELKDTPDVRGMLR
RL30_HYPNA      ------MSQKK----VTVRQVGSPIGRKPEQRQTLQGLGLNKIGRTSELEDTPAVRGMIR
RL30_RHOPA      ----MAKAANM----IKVEQIGSPIRRHHSQRETLIGLKLNKIGRVAELQDTPEVRGMIG
RL30_RHOPS      ----MAKAANI----IKVEQIGSAIRRHHSQRATLVGLKLNKIGRVTELQDTPEVRGMIA
RL30_RHOPB      ----MANAAKT----ITVEQIGSAIRRHHSQRATLIGLNLNKIGRTAELQDTPEVRGMIT
RL30_BRADU      ----MAKAAKT----IKLEQTGSAIRRHHSQRSTLIGLKLNKIGRTSELPDTPAVRGMIE
RL30_NITHX      ----MAKAAKT----IKVEQTRSAIRRQHSQRSTLVGLKLNKIGRVAELQDTPETRGMIA
RL30_NITWN      ----MAKAAKT----IKVEQTGSAIRRHHSQRSTLVGLKLNKIGRTSELQDTPEIRGMIA
RL30_GLUOX      ----MAENGKT----VQVTQIASVIGRKPGQAETITGLGLRGIGSTRTLEDTPAVRGMIR
RL30_LEPIC      --------MEN----IIVTQVKSSIGVKKEHKLTLHALGLRRTGQQRKHKVSPQLQGMLN
RL30_LEPIN      --------MEN----IIVTQVKSSIGVKKEHKLTLHALGLRRTGQQRKHKISPQLQGMLN
RL30_WIGBR      --------MNK----LKITQIKSSIGCLKKHKSTLYGLGLRHIGHTVIRQNSPRLLGMIN
RL30_MYCTU      -------MSQ-----LKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNAATRGLIA
RL30_MYCBO      -------MSQ-----LKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNAATRGLIA
RL30_MYCLE      -------MAS-----LKITQVRSTIGVRWKQRESLRTLGLRRIRHSVIREDNLQTRGLIA
RL30_MYCPA      -------MSQ-----LKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNPQTRGLIA
RL30_RUBXD      -------MSQ-----LRVTQVRSTIGAIEKHKRTVRALGLRRIRDSRVHRDTPQIRGMIA
RL30_STRCO      -------MAQ-----LKITQVKSYIGSKQNHRDTLRSLGLKGINTQVVKEDRPEFRGMVH
RL30_CUTAK      -------MSK-----LKITQIKSGIATKPNHRETLRSLGLKRIGDTVIKEDRPEFRGMVR
RL30_FRACC      -------MAK-----LRITQIRSGIGGTSNQRATLRTLGLRKINATTVRDDRPEIRGMIR
RL30_THEFY      -------MAK-----LKITQVRSKIGGNRKQHAALASLGLGRIGKSVIRDDRPEVRGQIN
RL30_CORDI      -------MA------LKITQHKGLVGANPKQRKNMAALGLKHINHSVVHQDTPVVRGMVN
RL30_CORJK      -------MA------LKITQVKGLVGTKPKQRDSMRSLGLKRIGQTVVREDNPIVRGQIN
RL30_COREF      -------MA------LKITQVKGTIGTKPKHRDNLRSLGLKRIRHSVVRPDTPEVRGMVQ
RL30_CORGL      -------MA------LKITQIKGTVGTKPKHRENLRSLGLKRIRHTVIRPDTPEVRGMIL
RL30_CHLTE      -------MSEKM---IKVTQVRSVIGGTKKQKDTIKALGLGRPNHKVEIKDNACTRGQIR
RL30_PELLD      -------MSDKK---LKITQVRSIIGGTKKQKATIQALGLGRPHYTVERKDNPCTRGQIR
RL30_LEGPA      -------MGKK----IKITLVKSTIGRKPKHVAIAKQLGLGKTNSSVVHSDTPAIRGLVN
RL30_LEGPH      -------MGKK----IKITLVKSTIGRKPKHVAIAKQLGLGKTNSSVVHSDTPAIRGLVN
RL30_LEGPL      -------MGKK----IKITLVKSTIGRKPKHVAIAKQLGLGKTNSSVVHSDTPAIRGLVN
RL30_CLOP1      ----------M----LKVTLVKSLIGRKKDHIATAHALGLRKIGKTVEHEGTPQIKGMIN
RL30_CLOPE      ----------M----LKVTLVKSLIGRKKDHIATAHALGLRKIGKTVEHEGTPQIKGMIN
RL30_CLOPS      ----------M----LKVTLVKSLIGRKKDHIATAHALGLRKIGKTVEHEGTPQIKGMIN
RL30_CLOAB      --------MAK----ISITLKKSLIGRKKDHIATVNALGLKKIGRTVEHEDTPQIRGMIK
RL30_BIFLO      -------MAKN----LKITLHHGIVNRTPAQRATVKTLGLNKIGKTVVREDTPANRGLVN
RL30_RICPR      ----MNNKINN----IKITQIKSAIGCKYDQRFTLIGLGLNKINKSVILKNTNSIRGMVE
RL30_BACTN      --------MST----IKIKQVKSRIGAPADQKRTLDALGLRKLNRVVEHESTSSILGMVD
RL30_DESPS      -------MTET----ITFTLVKSGIGSTDKIRATLTGLGLTKLNKTVTRKDTPEIRGMLN
RL30_SYNAS      -------MSKQ----LKITLKKSAIGRPSKQRDTLRGMGLSKINKAVVLKDCTEIRGMIN
RL30_DEIRA      ---------------MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVK
RL30_DEIGD      -----------------MTLKRSVIGRPKNQVETVKALGLKKIGDSRELADTPAIRGMIK
RL30_BACHD      -------MAKK----LEITLTRSLIGRPQDQRVTVNTLGLRKMHQTVVQEDNAAIRGMVN
RL30_BACSK      -------MAKK----LEITLTRSLIGRPSDQRVTVNTLGLRKLHQTVVQEDNAAIRGMVN
RL30_BACSU      -------MAK-----LEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMIN
RL30_GEOKA      -------MAKK----LAITLTRSVIGRPEDQRVTVRTLGLRKMHQTVIHNDNPAIRGMIN
RL30_STAAC      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAAM      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAAS      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAAW      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAA8      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAAN      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAAR      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAES      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAEQ      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_STAS1      -------MAK-----LQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQIN
RL30_BACAN      -------MAKK----LEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAILGMIN
RL30_BACC1      -------MAKK----LEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAILGMIN
RL30_BACCR      -------MAKK----LEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAILGMIN
RL30_BACCZ      -------MAKK----LEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAILGMIN
RL30_BACHK      -------MAKK----LEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAILGMIN
RL30_OCEIH      -------MSKK----LEITLNRSVIGGTGVQKKTVEALGLKKIRQSVVREDTPAVRGMVN
RL30_STRA1      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVN
RL30_STRA3      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVN
RL30_STRA5      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVN
RL30_STRP1      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRP3      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRP6      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRP8      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRPB      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRPC      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRPD      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRPF      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRPM      -------MAQ-----IKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRGMVT
RL30_STRT1      -------MAQ-----IKITLSKSPIGRKPEQRKTVAALGLGKLNSSVVKEDNAAIRGMVN
RL30_STRT2      -------MAQ-----IKITLSKSPIGRKPEQRKTVAALGLGKLNSSVVKEDNAAIRGMVN
RL30_STRMU      -------MAQ-----IKITLTKSPIGRIPAQRKTVVALGLGKLNSSVIKEDNAAIRGMVN
RL30_STRPN      -------MAQ-----IKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRGMIT
RL30_STRR6      -------MAQ-----IKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRGMIT
RL30_LACLA      -------MAQ-----IKITLVNSPIGRIPAQRKTVKALGLGKLNSSVVKEGSPAILGMVN
RL30_THEMA      -------MPKK----LKIKLVKSPIGYSWDQKDTVKRLGLKKLNQVVIKDDLPQIRGMIR
RL30_CARHZ      -------MEKK----LKITLVKSVIGQSERQKATVKSLGLRKLNQTVIKADTPEIRGMIN
RL30_THET8      -------MPR-----LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVE
RL30_BORBU      -MENNRKIISKNNINVQVFLVRSLIGKLNKKVKVLKALGLNKIGDKKVHFLNESIKGMLN
RL30_BORBP      -MEKNREIISKNNINVQVFLVRSLIGKLNKKVKVLKALGLNKIGDKKVHFLNESIKGMLN
RL30_BORAP      -MEKNREIISKNNINVEVFLIRSLIGKLNKKVKVLKALGLNKIGDKKVHFLNQSIKGMLN
RL30_BORHD      -MAINREILAKSDIKVEVELKRSLIGKLDSKVKTLKALGLKRIGDRKIHVLNKSLQGMLN
RL30_DESAG      --------------MIKVKLVRSRIGCNPNQRRTLDALGLRKIRQEKTFEDNAVVRGMIA
RL30_DESVH      --------------MIKVKLVRSLICCNPTQRATVAALGLRKVGSEKTFKDDAAIRGMIN
                                 .    .              : *                *   

RL30_ECOLI      AVSFMVKVEE-------------
RL30_SHIFL      AVSFMVKVEE-------------
RL30_SHIBS      AVSFMVKVEE-------------
RL30_SHIDS      AVSFMVKVEE-------------
RL30_ECOL5      AVSFMVKVEE-------------
RL30_ECOUT      AVSFMVKVEE-------------
RL30_ECO57      AVSFMVKVEE-------------
RL30_ECOL6      AVSFMVKVEE-------------
RL30_SHISS      AVSFMVKVEE-------------
RL30_SALCH      AVSFMVKVEE-------------
RL30_SALPA      AVSFMVKVEE-------------
RL30_SALTI      AVSFMVKVEE-------------
RL30_SALTY      AVSFMVKVEE-------------
RL30_PECAS      AVSYMVKVEE-------------
RL30_YERPA      LVSYMVKVEE-------------
RL30_YERPE      LVSYMVKVEE-------------
RL30_YERPN      LVSYMVKVEE-------------
RL30_YERPS      LVSYMVKVEE-------------
RL30_SODGM      LVSYMVKVEE-------------
RL30_BAUCH      LISYMVKVEKQ------------
RL30_PHOLL      LVSYMVKVEE-------------
RL30_HAEI8      QVSYMVKVEE-------------
RL30_MANSM      QVSYMVKVEE-------------
RL30_PASMU      QVSYMVKVEE-------------
RL30_HAEIN      QVSYMVKVEE-------------
RL30_HAES1      QVSYMVKVEE-------------
RL30_HAEDU      QVSYMVKVEE-------------
RL30_PSEA6      RVFYMVEVVEE------------
RL30_IDILO      RVNYMIKVEG-------------
RL30_CHRSD      KVNYLVRVEGE------------
RL30_SHEON      KVYYMVKVED-------------
RL30_SHESM      KVYYMVKVED-------------
RL30_SHESR      KVYYMVKVED-------------
RL30_SHEDO      KVYYMVSVEG-------------
RL30_COLP3      KVYYMVKVED-------------
RL30_PHOPR      KVHYMVKIEE-------------
RL30_ALIF1      KVYYMVKVEE-------------
RL30_VIBCH      KVYYMVKVEE-------------
RL30_VIBPA      KVYYMVKVEE-------------
RL30_VIBVU      KVYYMVKVEE-------------
RL30_VIBVY      KVYYMVKVEE-------------
RL30_PSEHT      QVSYMVKVEG-------------
RL30_BUCAI      KISYILKIQEE------------
RL30_BUCAP      KISYILKIQEE------------
RL30_BUCBP      LLSFMLRIN--------------
RL30_BLOFL      LVLYMIQVKRQD-----------
RL30_ALCBS      KVSYLVQVEGE------------
RL30_SACD2      KVYYMVQVEGE------------
RL30_HAHCH      KVNYLVKVEGE------------
RL30_PSE14      KAYYMLRVEG-------------
RL30_PSESM      KAYYMLRVEG-------------
RL30_PSEU2      KAYYMLRVEG-------------
RL30_PSEF5      KAYYMLRVEG-------------
RL30_PSEPF      KAYYMLRVEG-------------
RL30_PSEPK      KAYYMLKVEG-------------
RL30_PSEAE      KAYYLLRVEG-------------
RL30_FRAT1      KIYYMVKIEG-------------
RL30_FRATH      KIYYMVKIEG-------------
RL30_FRATO      KIYYMVKIEG-------------
RL30_FRATT      KIYYMVKIEG-------------
RL30_CHRVO      KISYLLKFEG-------------
RL30_NEIMA      KISYLLKVES-------------
RL30_NEIMB      KISYLLKVES-------------
RL30_NEIG1      KISYLLKVES-------------
RL30_THIDA      KVAYLVKCEA-------------
RL30_COXBU      KVSYLLMIDEEV-----------
RL30_HYDCU      KVSYLLKVEEA------------
RL30_METFK      AVSYLLKVEA-------------
RL30_ALKEH      KVAYLLEVEEC------------
RL30_BORBR      KVGYLVSVSEA------------
RL30_BORPA      KVGYLVSVSEA------------
RL30_BORPE      KVGYLVSVSEA------------
RL30_DECAR      KVQYLVKVEG-------------
RL30_NITMU      NIYYLVKSEV-------------
RL30_AROAE      KVSYLLKCEG-------------
RL30_BURCA      KVSYLVKVIA-------------
RL30_BURL3      KVSYLVKVIA-------------
RL30_BURMA      KVSYLVKVIG-------------
RL30_BURTA      KVSYLVKVIG-------------
RL30_BURP1      KVSYLVKVIG-------------
RL30_BURPS      KVSYLVKVIG-------------
RL30_PARXL      KVSYLVKVIS-------------
RL30_CUPPJ      KVSYLVKVLA-------------
RL30_CUPMC      KVSYLVKVLA-------------
RL30_RALSO      KVSYLVKVIG-------------
RL30_POLSJ      KISYLVKVI--------------
RL30_RHOFT      KISYLIKVL--------------
RL30_XANAC      TVHYLVKVEE-------------
RL30_XANOM      TVHYLVKVEE-------------
RL30_XANC8      TVHYLVKVED-------------
RL30_XANCP      TVHYLVKVED-------------
RL30_XYLFA      KVHYLVRIQD-------------
RL30_XYLFT      KVHYLVRIQD-------------
RL30_NITEU      KTAYLLKVEE-------------
RL30_METCA      KVSYLLKVEEI------------
RL30_PSYA2      RVNYLVKVEEA------------
RL30_PSYCK      RVNYLVKVEEA------------
RL30_ACIAD      KVYYMVSVEE-------------
RL30_RUEPO      KIPHLVEIIEERG----------
RL30_RUEST      KIPHLVEIVEERD----------
RL30_ROSDO      SIPHMVEIVEEKG----------
RL30_AGRFC      AVQHLVRVVDEK-----------
RL30_RHORT      KIAHLVRVEDV------------
RL30_ZYMMO      KVAHLVKVEN-------------
RL30_HYPNA      KVSHLVEVVGE------------
RL30_RHOPA      KVQHLVRVVDEK-----------
RL30_RHOPS      KVQHLVRVVDEK-----------
RL30_RHOPB      KVQHLVRIVDEK-----------
RL30_BRADU      KVHHLVRIVDEK-----------
RL30_NITHX      KVQHLVRVIDET-----------
RL30_NITWN      KVRHIVRVIDET-----------
RL30_GLUOX      KVAHLIKVEG-------------
RL30_LEPIC      SVRHLIKVEKA------------
RL30_LEPIN      SVRHLIKVEKA------------
RL30_WIGBR      SISYLVKIKD-------------
RL30_MYCTU      VVRHLVEVEPAQTGGKT------
RL30_MYCBO      VVRHLVEVEPAQTGGKT------
RL30_MYCLE      VVRHLVEVEPATGGSTPVGGGRD
RL30_MYCPA      VVSHLVEVAPADASSAGTGGSKK
RL30_RUBXD      KVRHLVRVEEVED----------
RL30_STRCO      TVRHLVTVEEVD-----------
RL30_CUTAK      TVRHLVTMEEVD-----------
RL30_FRACC      TVTHLVRVEEVDS----------
RL30_THEFY      VVAHLVTVEEVSS----------
RL30_CORDI      VVRHMVSVEEVAGE---------
RL30_CORJK      TVRHMVEVEEVAGE---------
RL30_COREF      AVRHLIVVEEVAGE---------
RL30_CORGL      AVRHLIVVEEVAGE---------
RL30_CHLTE      VVQHLVKVEEL------------
RL30_PELLD      VVQHLVKVEEV------------
RL30_LEGPA      EINYLLLVEESA-----------
RL30_LEGPH      EINYLLLVEESA-----------
RL30_LEGPL      EINYLLLVEESA-----------
RL30_CLOP1      KISYLLKVEEA------------
RL30_CLOPE      KISYLLKVEEA------------
RL30_CLOPS      KISYLLKVEEA------------
RL30_CLOAB      KVDYLLEVK--------------
RL30_BIFLO      AVRHLVTVEEVD-----------
RL30_RICPR      KVKHLLKIENM------------
RL30_BACTN      KVKHLVAIVK-------------
RL30_DESPS      KVKHLVRIDEA------------
RL30_SYNAS      KVSHLVSCEEVEGVE--------
RL30_DEIRA      TVKHLLEVQE-------------
RL30_DEIGD      TVQHLVEVEA-------------
RL30_BACHD      KVSHLVTVKEIEA----------
RL30_BACSK      KVKHLITVNEIDA----------
RL30_BACSU      KVSHLVSVKEQ------------
RL30_GEOKA      KVAHLVKVKEIEE----------
RL30_STAAC      KVKHLVTVEEK------------
RL30_STAAM      KVKHLVTVEEK------------
RL30_STAAS      KVKHLVTVEEK------------
RL30_STAAW      KVKHLVTVEEK------------
RL30_STAA8      KVKHLVTVEEK------------
RL30_STAAN      KVKHLVTVEEK------------
RL30_STAAR      KVKHLVTVEEK------------
RL30_STAES      KVKHLLTIEEK------------
RL30_STAEQ      KVKHLLTIEEEK-----------
RL30_STAS1      KVSHLVTVEEK------------
RL30_BACAN      KVSHLVTVKEA------------
RL30_BACC1      KVSHLVTVKEA------------
RL30_BACCR      KVSHLVTVKEA------------
RL30_BACCZ      KVSHLVTVKEA------------
RL30_BACHK      KVSHLVTVKEA------------
RL30_OCEIH      RVSHLLTVKEV------------
RL30_STRA1      AISHLVTVEEA------------
RL30_STRA3      AISHLVTVEEA------------
RL30_STRA5      AISHLVTVEEA------------
RL30_STRP1      AISHLVTVEDVK-----------
RL30_STRP3      AISHLVTVEDVK-----------
RL30_STRP6      AISHLVTVEDVK-----------
RL30_STRP8      AISHLVTVEDVK-----------
RL30_STRPB      AISHLVTVEDVK-----------
RL30_STRPC      AISHLVTVEDVK-----------
RL30_STRPD      AISHLVTVEDVK-----------
RL30_STRPF      AISHLVTVEDVK-----------
RL30_STRPM      AISHLVTVEDVK-----------
RL30_STRT1      AVSHLVTVEDVK-----------
RL30_STRT2      AVSHLVTVEDVK-----------
RL30_STRMU      AVSHLVTVEDVK-----------
RL30_STRPN      AVSHLVTVEEVN-----------
RL30_STRR6      AVSHLVTVEEVN-----------
RL30_LACLA      SISHLVKVEEA------------
RL30_THEMA      KVKHLVEVEEIEEGGSNA-----
RL30_CARHZ      KVSHLLKVEEI------------
RL30_THET8      KVAHLVRVEVVE-----------
RL30_BORBU      ETINMILLSEVM-----------
RL30_BORBP      ETINMILLSEVNNV---------
RL30_BORAP      ETINMILLSEVSNV---------
RL30_BORHD      SVISMVLLSEVKNG---------
RL30_DESAG      KVVHLVEVTE-------------
RL30_DESVH      KVKHLIEVSE-------------
                    ::