CLUSTAL format seed alignment for MF_01374

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLO2_FRATO       ------------MQIKRWFLNNSLRNYQYLLYDK-----SHAIVIDPLKSDIFAEFI-AK
GLO2_FRATH       ------------MQIKRWFLNNSLRNYQYLLYDK-----SHAIVIDPLKSDIFAEFI-AK
GLO2_FRATW       ------------MQIKRWFLNNSLRNYQYLLYDK-----SHAIVIDPLKSDIFAEFI-AK
GLO2_FRAT1       ------------MQIKRWFLNNSLRNYQYLLYDK-----SHAIVIDPLKSDIFAEFI-AK
GLO2_FRATT       ------------MQIKRWFLNNSLRNYQYLLYDK-----SHAIVIDPLKSDIFAEFI-AK
GLO2_FRATN       ------------MQIKRWFLNNSLRNYQYLLYDK-----SHAIVIDPLKSDIFAEFI-AK
GLO2_NEIG1       --------------MKITPVKALTDNYIWMIQHG-----NHAVCVDPSEPSPVLEFL-VR
GLO2_NEIMA       --------------MKITPVKALTDNYIWMIQHG-----NHAVCVDPSEPSPVLEFL-VR
GLO2_NEIMB       --------------MKITPVKALTDNYIWMIQHG-----NHAVCVDPSEPSPVLEFL-VR
GLO2_NEIMF       --------------MKITPVKALTDNYIWMIQHG-----NHAVCVDPSEPSPVLEFL-VR
GLO2_LEGPA       --------------MTILPISAFSDNYIWTFIDKIA---GVLDCVDPGEAGPIIRFA-QS
GLO2_LEGPH       --------------MTILPISAFSDNYIWTFIDKIA---GVLDCVDPGEAAPIIRFA-QS
GLO2_LEGPL       --------------MTILPISAFSDNYIWTFIDKIA---GVLDCVDPGESAPIIRFA-QS
GLO2_ACTP2       -------------MLNITPIPALSDNYIWAIQKDN-----DVIIVDPSDAVPVLAFI-AK
GLO2_HAEDU       -------------MLKITAIPALQDNYIWAIQQGQ-----EVMIVDPAQADPVFHFL-AK
GLO2_HAEIG       ---------------MLFALPALNDNYIWLYQRENL----PLIIVDLPETDKLFAWL-DK
GLO2_HAEIN       ---------------MLFALPALNDNYIWLYQRENL----PLIIVDLPETDKLFAWL-EK
GLO2_HAEI8       ---------------MLFALPALNDNYIWLYQRENL----PLIIVDLPETDKLFAWL-DK
GLO2_MANSM       ---------------MLVPIPALNDNYIWLYGRENL----PVIAIDVAECKNLSAYL-TQ
GLO2_HAES1       ---------------MLIPIPALNDNYIWVYKRENL----SVIVIDIPEIAALSQFI-QA
GLO2_PASMU       ---------------MLVPIPALNDNYIWLYGRANL----PIIVIDIPEFTPLLDYV-QQ
GLO2_BAUCH       --------------MNLIAIPALIDNYIWLLHNKKG----ECLIVDPGDATPVLHIL-SN
GLO2_SODGM       --------------MNLISIPALADNYIWLLHNDDR----RCLVVDPGDATPVLQAL-AD
GLO2_YERPE       --------------MNLISIPAFQDNYIWLLANRQK----HCVIVDPGESAPVLATL-AQ
GLO2_YERPA       --------------MNLISIPAFQDNYIWLLANRQK----HCVIVDPGESAPVLATL-AQ
GLO2_YERPN       --------------MNLISIPAFQDNYIWLLANRQK----HCVIVDPGESAPVLATL-AQ
GLO2_YERPP       --------------MNLISIPAFQDNYIWLLANRQK----HCVIVDPGESAPVLATL-AQ
GLO2_YERPS       --------------MNLISIPAFQDNYIWLLANRQK----HCVIVDPGESAPVLATL-AQ
GLO2_YERE8       --------------MNLISIPAFQDNYIWLLADEQK----HCVIVDPGESAPVLAAL-SQ
GLO2_PHOLL       --------------MELISIPALSDNYIWLLCDENR----HVVIVDPAESQPVLDTL-ES
GLO2_PECAS       --------------MNLISIPALQDNYIWLLSNKAN----RCVIVDPGEASPVLNAL-DQ
GLO2_ECOUT       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-SA
GLO2_ECOK1       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-SA
GLO2_ECOL5       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-SA
GLO2_ECOL6       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-AA
GLO2_ECOLI       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-AA
GLO2_ECO57       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-AA
GLO2_SHISS       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-AA
GLO2_SHIDS       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-AA
GLO2_SHIBS       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-TA
GLO2_SHIFL       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-TA
GLO2_SHIF8       --------------MNLNSIPAFDDNYIWVLNDEAG----RCLIVDPGDAEPVLNAI-TA
GLO2_SALCH       --------------MNLNSIPAFQDNYIWVLTNDEG----RCVIVDPGEAAPVLKAI-AE
GLO2_SALPA       --------------MNLNSIPAFQDNYIWVLTNDEG----RCVIVDPGEAAPVLKAI-AE
GLO2_SALTY       --------------MNLNSIPAFQDNYIWVLTNDEG----RCVIVDPGEAAPVLKAI-AE
GLO2_SALTI       --------------MNLNSIPAFQDNYIWVLTNDEG----RCVIVDPGEAAPVLKAI-AA
GLO2_BUCAI       --------------MILKKISILSDNYVWVLLNTSG----SCIIIDPGLSEPIIQEI-ER
GLO2_BUCAP       --------------MILTSISVLKDNYVWILYNDNC----SCIIIDPGVSEDIIKKI-EK
GLO2_WIGBR       --------------MNLVSISINEDNYIWLLYNNDK----NCIIVDPGEFISIHNIC-KK
GLO2_BLOFL       --------------MNIIKCISLQTNYIWIIYNHIR----QCIIIDPGESLKVIKML-NH
GLO2_BUCBP       --------------MKIIFTKVLFDNYVWIMFNSSK----DCIIIDPGESNSVIKKI-KK
GLO21_VIBVY      ------------MSLSITHEKSLIDNYIWILFDKSK-----AIVIDPGESEKIINFL-DK
GLO2_AERHH       -------------MYPVITVPAFNDNYIWLIRHE-----NHCLVVDPGDAEPVLERL-AA
GLO2_RHOFT       --------------MQLIPLPAFTDNYIWMVHDE-----RHALVVDPGDAQPVLEAL-QQ
GLO2_PSEPF       -------------MIQISALPAFTDNYIWLLQDH---ATQRCAVVDPGDAAPVQAWLDAH
GLO2_PHOPR       -------------MLTVQSIPAFNDNYIWLIHNS----HNHCVVVDPGDATPVLKVL-EE
GLO2_ALIF1       -------------MLSVKSIPAFNDNYIWLIHNN----DNHCVVVDPGDATPVLECI-KE
GLO2_VIBVU       -------------MLEIKSIPAFNDNYIWLIQNS----DQRCAVVDPGDAKPVLHYI-EQ
GLO22_VIBVY      -------------MLEIKSIPAFNDNYIWLIQNS----DQRCAVVDPGDAKPVLHYI-EQ
GLO2_VIBPA       -------------MLEIKSIPAFNDNYIWLIQNS----DKRCAVVDPGDAQPVLDYL-QA
GLO2_VIBCH       -------------MLQIKSIPAFDDNYIWLIQNR----DRDCAVVDPGSAEPVLAYL-KQ
GLO2_PSEHT       -------------MVQVKAIKAFSDNYIWCLTT--SN-NTQAWVVDPGQAEPVLDYL-AQ
GLO2_HYDCU       --------------MKIVGLPTLSDNYTWVIQSENAD-DKRAWIVDPGESQKVIHYF-EE
GLO2_SACD2       ------MNMQLGSPVSVHPIPIYQGNYVWVMRHTS---QNSVVVVDPGSASEVIEYI-TQ
GLO2_RHIEC       -----------MKPLELDVFLCRTDNFGVLVHDP---ETGFTAAIDAPEEAPILEAA-TR
GLO2_RHIL3       -----------MKPLELDVFLCRTDNFGVLVHDP---ETGFTAAIDAPEEAPILEAA-TR
GLO2_AGRFC       -----------MKPLEIDVFLCRSDNFGVLLHDP---ESGATAAIDAPEEGPILRAL-DG
GLO2_RHIME       -----------MAALELDLFLCRTDNYGVLLHDR---LSGATASIDAPEERPILDAL-ER
GLO2_BRUAB       ----------MEQRLEIEQFICRSDNYGVLIHDP---ESALTATIDAPDAYAIEAAL-ER
GLO2_BRUO2       ----------MEQRLEIEQFICRSDNYGVLIHDP---ESALTATIDAPDAYAIEAAL-ER
GLO2_BRUA2       ----------MEQRLEIEQFICRSDNYGVLIHDP---ESALTATIDAPDAYAIEAAL-ER
GLO2_BRUME       ----------MEQRLEIEQFICRSDNYGVLIHDP---ESALTATIDAPDAYAIEAAL-ER
GLO2_BRUSU       ----------MEQRLEIEQFICRSDNYGVLIHDP---ESALTATIDAPDAYAIEAAL-ER
GLO2_OCHA4       -------MNSIAPRLEIEQFICRSDNYGVLIHDP---QSALTASIDAPDAAAIEAAL-KR
GLO2_CHESB       ------------MTLEIEQFMCRSDNFGILARDS---ETGITALVDAPEEQAILEAI-KR
GLO2_RHILO       ------------MAVEIEQFMCRSDNFGVLVHDP---KSGQTAIIDAPEEAPILAAI-KR
GLO2_MARMM       -----------MSELLIRQFPCLSDNYGFLIHDP---DSGETATIDTPDADVILNEA-DQ
GLO2_HYPNA       ----------MSVLIEIHQFPCLNDNYGYLVHEP---GSGRTIAIDTPDAAVYLAEA-EK
GLO2_METCA       -------------MLEILQIPVLEDNYVYLLHEP---GSGATAAVDPAVAGPVLEAL-DA
GLO2_RHORT       -----------MSTLDIHQIAVLSDNYIYLVRCR---ATGACAVIDPSLAEPVLAAA-ES
GLO2_BRASB       ------------MAADIRVFTCLSDNFGYLIHDP---ATGATASVDAPEAGPIIRQL-EA
GLO2_BRASO       ------------MAADIRVFTCLSDNFGYLIHDP---ATGATASVDAPEAGPIVRQL-EA
GLO2_BRADU       ------------MAAEIRTFSCLNDNFGYLIHDV---ETKATASIDAPEAGPILKAL-ER
GLO2_NITHX       ------------MTADIRLFTCLTDNFGVLIHDP---ATDATAAIDAPEAGPIIEAL-DR
GLO2_NITWN       ------------MTADIRLFTCLTDNFGVLIHDP---ATGATAAIDAPEAEPVIQAL-DR
GLO2_RHOP5       ------------MAAEIRLFTCLNDNFGYLIHDP---ATGATASVDAPEAAPIIAAL-AR
GLO2_RHOPB       ------------MAAEIRVFTCLKDNFGYLVHDS---DSGATASIDAPEAAPILAAL-AR
GLO2_RHOPS       ------------MAADIRIVPCLTDNFGYLIHDP---SSGATASIDAPEAAPLIAAL-EK
GLO2_RHOP2       ------------MAADIRIVPCLTDNFGYLIHDP---SSGATASIDAPEAAPLIAAL-EK
GLO2_RHOPA       ------------MPADIRIVPCLTDNFGYLVHDP---ATGATASIDAPEAAPLIAAL-DK
GLO2_ROSDO       ------------MPIEILTIPCLNDNYAFLVHDT---ATGQTALIDVPEAAPILKVL-AE
GLO2_RUEPO       ------------MPLEIVTVPCLSDNYAYLIHDA---DAGKTALVDAPEAAPIQSEL-DR
GLO2_JANSC       -----------MADPQIITIPCLQDNYAFLLHDP---STGATACIDVPDAAPIQAAL-GA
GLO2_RHOS4       ------------MPLELVTVPCLSDNYAFLVHDA---GTGETSVVDVPEAGPILKAL-EE
GLO2_RHOS1       ------------MPLELVTVPCLSDNYAFLVHDA---GTGETSVVDVPEAGPVLKAL-EE
GLO2_RHOS5       ------------MPLELVTVPCLSDNYAFLVHDA---ASGETAVVDVPEAGPVMAAL-AE
GLO2_RHOBL       ------------MALNLLTVPCLKDNFAFLLHDA---ASGRTALVDAPEAAPVLSAL-AA
GLO2_RHOCA       ------------MTLELTPIPCLTDNYAWLWHDT---ATDTVVVVDVPEAAPVLKVL-TD
GLO2_PELUB       --------------MEIQIIRCLQDNYSYLIVDK---AKNIACVIDPSEAKPVIKYL-ED
GLO2_BDEBA       ----------MAKKEHVELVPIFDDNYVFILTDD---ATQKAVAVDPGDAGPVIDFL-RA
GLO2_PROM1       -------MLGEKSDFTIHPINVLQDNIVWVWV-----HNCNAVVVDPSISGPVEKWL-LE
GLO2_PROMT       -------MLGKKSDFTIHPINVLQDNIVWVWV-----HNCNAVVVDPSISGPVEKWL-LE
GLO2_PROMA       -------MKKKEEGFIIHPIPVLMDNIIWIWV-----KEKQAIVVDPAISEPVINLL-KG
GLO2_PROMS       --------MEFNKARNIIGLRVLSDNVIWLMA-----KDKSVVVIDPSVHEPVIRYI-NE
GLO2_PROM0       --------MEFNKAQNIIGLRVLNDNVIWLWV-----KDKSVVVIDPSVHEPVIRYI-DE
GLO2_PROM9       --------MEFNKAQNIIGLRVLNDNVIWLWE-----KDKSVVVIDPAIHEPVIRYI-DE
GLO2_PROM3       MEATSTAATSDKQRSSIHALPVLQDNIIWIWI-----KGDQAVVVDPAIAEPVKTWL-QT
GLO2_PROMM       MEATSTAATSDKQRSSIHALPVLQDNIIWIWI-----KGNQAVVVDPAIAEPVKTWL-RT
GLO2_SYNSC       ------------MHSSLHALPVLQDNVIWIWV-----RGAEAVVIDPAVAPPVRAWL-EK
GLO2_SYNPX       ------------MQSSLHALPVLQDNVLWIWV-----RGDEAAVVDPAVAEPVIDWL-QQ
GLO2_SYNS9       ------------MHSTLHALPVLQDNVIWIWA-----RGKNAVVVDPAVAEPVNQWL-NA
GLO2_SYNS3       -------MAMASTIDGIHPVAVLNDNIVWVWV-----RGNQAIVIDPAVAAPILDWL-DR
GLO2_SYNPW       -------MSLTLERGAIAPLPVLQDNIIWIWS-----CGSEAVVVDPAVAEPVIEAL-QQ
GLO2_SYNP6       --------------MRIDCLPALQDNYIFLLVDV---EQRQAAVVDPAEAEPVLAAL-QA
GLO2_SYNY3       --------------MDIHRLPALADNYIFLLHDR---QRNQAAVVDPAEAKPVLDCL-ET
GLO2_POLSJ       ------------MIVERIWTGNAYRNFNYLIACP---ETGEALAIDPLDHEKTLATA-RV
GLO2_NITOC       ------------MLIEQLWTANAYRNFNYLIACP---ETGEALAIDPLDHRQCLATA-KR
GLO2_LEPBJ       ------------MEVFRIYTNSPLRNFTYILRNS---ETSETLSIDPYDSEQIEKFL-DS
GLO2_LEPBL       ------------MEVFRIYTNSPLRNFTYILRNS---ETSETLSIDPYDSEQIEKFL-DS
GLO2_ANADE       --------------MIFDRRRYGKDNYTYLLAAG-----GDAALVDPGDPDAALALA-AA
                                          *                  :*              

GLO2_FRATO       NKLQLEAILITHKHGDHIAGVKKLLAIYPNAKVYAYTG---NDLFKPDIYVKDG----SF
GLO2_FRATH       NKLQLEAILITHKHGDHIAGVKKLLAIYPNAKVYAYTG---NDLFKPDIYVKDG----SF
GLO2_FRATW       NKLQLEAILITHKHGDHIAGVKKLLAIYLNAKVYAYTG---NDLFKPDIYVKDG----SF
GLO2_FRAT1       NKLQLEAILITHKHGDHIAGVKKLLAIYLNAKVYAYTG---NDLFKPDIYVKDG----SF
GLO2_FRATT       NKLQLEAILITHKHGDHIAGVKKLLAIYLNAKVYAYTG---NDLFKPDIYVKDG----SF
GLO2_FRATN       NKLQLEAILITHKHGDHIAGVKKLLAIYPNAKVYAYTE---NDLFKPDIYVKDG----SF
GLO2_NEIG1       NRLMLAQTWVTHPHPDHEGGAAALWRGYMESPVYGESD-----IEAATHTVTAG----TR
GLO2_NEIMA       NRLMLAQTWVTHPHPDHEGGAAALWRGYMESPVYGESD-----IEAATHTVTAG----TQ
GLO2_NEIMB       NRLMLAQTWVTHPHPDHEGGAAALWRGYMESPVYGESD-----IEAATHTVTAG----TQ
GLO2_NEIMF       NRLMLAQTWVTHPHPDHEGGAAALWRGYMESPVYGESD-----IEAATHTVTAG----TQ
GLO2_LEGPA       NQLTLRTILLTHHHYDHIGGVDLLIKQWPSCKVYGPID---ERINNVTHPIKQG----QS
GLO2_LEGPH       NQLTLRTILLTHHHYDHIGGVDSLIKQWPSCKVYGPID---ERINNVTHPIKQG----QS
GLO2_LEGPL       NQLTLRTILLTHHHYDHIGGVDSLIKQWPSCKVYGPID---ERISNLTHPIKQG----QS
GLO2_ACTP2       NQLNLTAILLTHNHHDHTDGMPELLSRYPQLSVYGPQE--VAQ--FANRIVQPE----DH
GLO2_HAEDU       NKLNLTTILITHYHQDHIGGIAGLQATYPDLTIYGSHE--VAQ--YVNHIVQAG----DH
GLO2_HAEIG       QNATVEAVLLTHEHDDHTQGVSAFKKRYPTVPIYGPQE--CEK--KGATQIVNE----GK
GLO2_HAEIN       QNATIEAVLLTHEHDDHTQGVSAFKKRYPTVPIYGPQE--CEK--KGATQIVNE----GK
GLO2_HAEI8       QNATIEAVLLTHEHEDHTQGVSAFKKRYPTVPIYGPQE--CEK--KGATQVVNE----GK
GLO2_MANSM       HHLQLEAVLLTHYHDDHTGGVEELKRYYPDIPVYGPAE--TAD--KGATHIVNE----GN
GLO2_HAES1       QNLVIGALLITHNHRDHIGALAEFKQFYPHVHIYGPAE--CAD--QGVTQVIDA----GR
GLO2_PASMU       HQLNVEALLLTHHHDDHTAGVSLFKQHFPNVKVFGPAE--TQA--KGATEIVNM----GI
GLO2_BAUCH       YQLKLTSILLTHHHPDHVKGVKLLSQYFP-VTIYGPQE--TFK-QCANIIVKKG----DF
GLO2_SODGM       HRLTPVAVLLTHHHQDHVGGVSELLQHFP-VPVYGPEE--TRS-KGATQIVNEG----DS
GLO2_YERPE       GQYVPQAILLTHHHNDHVGGVADLRHHFPDIPVYGPQE--TAK-KGATVIVNDG----DS
GLO2_YERPA       GQYVPQAILLTHHHNDHVGGVADLRHHFPDIPVYGPQE--TAK-KGATVIVNDG----DS
GLO2_YERPN       GQYVPQAILLTHHHNDHVGGVADLRHHFPDIPVYGPQE--TAK-KGATVIVNDG----DS
GLO2_YERPP       GQYVPQAILLTHHHNDHVGGVADLRHHFPDIPVYGPQE--TAK-KGATVIVNDG----DS
GLO2_YERPS       GQYVPQAILLTHHHNDHVGGVADLRHHFPDIPVYGPQE--TAK-KGATVIVNDG----DS
GLO2_YERE8       GQYLPQAILLTHHHNDHVGGVADLRRHFPEIPVYGPQE--TAN-KGATIMVTGG----DH
GLO2_PHOLL       RGWIPDAILLTHHHHDHVGGVPGIIDRFPELLVYGPAE--TQS-KGATIIVCGG----DS
GLO2_PECAS       NALLPEAILLTHHHNDHVGGVSEILNHYPNLPVFGPKE--TAK-CGATYLVEEG----NT
GLO2_ECOUT       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_ECOK1       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_ECOL5       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_ECOL6       NNWQPEAIFLTHHHHDHVGGVKELVKKFPQIVVYGPQE--TQD-KGTTQVVKDS----ET
GLO2_ECOLI       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_ECO57       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_SHISS       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_SHIDS       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_SHIBS       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_SHIFL       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_SHIF8       NNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQE--TQD-KGTTQVVKDG----ET
GLO2_SALCH       HKWMPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAE--TQD-KGATHLVGDG----DT
GLO2_SALPA       HKWMPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAE--TQD-KGATHLVDDG----DT
GLO2_SALTY       HKWMPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAE--TQD-KGATHLVGDG----DT
GLO2_SALTI       HKWMPEAIFLTHHHYDHVGGVKELLQHFPQMTVYGPAE--TQD-KGATHLVGDG----DT
GLO2_BUCAI       KKWRLRAILLTHNHIDHTGGTRKIIEYFPKISVFGPKE--TRQ-HGVNKIVSHG----DR
GLO2_BUCAP       KNWKLIAILLTHNHIDHVGGVEEIIRRYPNVTVFGPEE--TKT-RNVNKIVKQG----DV
GLO2_WIGBR       KKLTPVAIFLTHHHHDHVDGVESLKTYF-NTPVYGPKE--TIK-YGTTKIVKEG----DE
GLO2_BLOFL       LQLIPEAILLTHNHRDHTNGVFTLIQHFPKIKIYGPIE--TQNQNFATITVSEG----DT
GLO2_BUCBP       LNLNPKIILLTHNHLDHIQGVKNLLYKYPEISIYGPLE--TQFCGTKNLIDNR-----NT
GLO21_VIBVY      NNLTLEFIFLTHGHCDHTKGVFSLKEKFPNASLFVPIG--LEL-GLGESIIKEG----DE
GLO2_AERHH       LDLQLDAILLTHHHHDHVGGVTALLGHFPHARLYGPK---LDPMPAHHGQWLDDG---DQ
GLO2_RHOFT       LGLQLETILVTHHHPDHTGGVAALRAA-TGAQVFGPA---REPMPEPLIRLTGD----QQ
GLO2_PSEPF       PGWVLGDILITHHHHDHVGGVETLKKA-TGATVYGPA---SENIPGRDVALKDN----DT
GLO2_PHOPR       QSLTLDAILITHHHHDHIGGISELKRHYPNLNVVGPA---SEPIPGISQSVEDG----DQ
GLO2_ALIF1       HDFILDAILITHHHHDHIGGVPELVRQFPNVNVVGPE---NEPIPTLTHPVGDG----DF
GLO2_VIBVU       HQLTLEAILITHHHNDHIGGVADLVRAFPNVNVVGPK---AEPIPTLTHPVEDG----DR
GLO22_VIBVY      HQLTLEAILITHHHNDHIGGVADLVRAFPNVNVVGPK---AEPIPTLTHPVEDG----DR
GLO2_VIBPA       NELTLEAILVTHHHNDHIGGVPDLVRAFPHVTVVGPK---AEPIPTLTTPMEEG----DK
GLO2_VIBCH       HDLNLKAVLITHHHHDHIGGVAELVHQFPEIHVVGPA---QEPIPTLTHPVEDG----DQ
GLO2_PSEHT       HNLTLAGILITHHHYDHTDGVAKLVSENPNIAVYGPT---NSPFKGITQQLTDG----QS
GLO2_HYDCU       NQLQLDGILLTHHHYDHTDGIMGVMDALGEVAIVSNA---QGPFKPVTHPVKEG----DQ
GLO2_SACD2       HELTIASIIITHSHWDHVTGIAELCANLQLWRDEEPVVYGPSVIQDVTHPVEDGDRIELC
GLO2_RHIEC       RGWKITHIFTTHHHTDHVAANL-ALKEQFGCEIIGPIN-EAIAIPGLDRTMADG----DS
GLO2_RHIL3       RGWKITHIFTTHHHTDHVTANL-ALKEQFGCEIIGPIN-EAVAIPGLDRAMADG----DS
GLO2_AGRFC       HGWKLTHIFTTHHHQDHVEANL-VLKDKFRCEVHGPYD-EAIAIPGLDRSQADG----DE
GLO2_RHIME       RGWQLTHILTTHHHGDHVAANA-SLKERFGLTIIGPKN-EASKIPGIDRTVGHG----DR
GLO2_BRUAB       RGWTLDFIFTTHHHLDHVEGNE-PLKEKFGVSIIGPEA-EKAKIPGIDRTVKGG----DE
GLO2_BRUO2       RGWTLDFIFTTHHHLDHVEGNE-PLKEKFGVSIIGPEA-EKAKIPGIDRTVKGG----DE
GLO2_BRUA2       RGWTLDFIFTTHHHLDHVEGNE-PLKEKFGVSIIGPEA-EKAKIPGIDRTVKGG----DE
GLO2_BRUME       RGWTLDFIFTTHHHLDHVEGNE-PLKEKFGVSIIGPEA-EKAKIPGIDRTVKGG----DE
GLO2_BRUSU       RGWTLDFIFTTHHHLDHVEGNE-PLKEKFGVSIIGPEA-EKAKIPGIDRTVKGG----DE
GLO2_OCHA4       RGWTLDFIFTTHHHLDHVEGNE-ALKAKYGVSIIGPKA-EETKIPGIDRTVKDG----DE
GLO2_CHESB       TGWTPSLLLITHHHADHVEANL-ALKERFGLTIIGPAK-EASKIPGIDRQVNEG----DV
GLO2_RHILO       TGWTPTMILTTHHHMDHVEANL-ALKERFKLRIVGPEA-EKAKIPGIDETVEEG----SV
GLO2_MARMM       AGWSITQIWNTHHHFDHAGGNE-TIQALTGAKVVAPRY-DRHRIPGISMEVEDG----DV
GLO2_HYPNA       MSWTISEIWNTHWHPDHAGGNL-KIKEATGCKIIGPAG-EADKIPGIDRRVKGG----DT
GLO2_METCA       RGWRLGHVLNTHHHGDHVGGNL-ELKAATGCTVVGAAG-DRHRIPGIDVALKDG----EE
GLO2_RHORT       LGWTITHILNTHHHYDHTGGNE-EIKAATGCEIIGFAG-DAHRLPGIDRTVVEG----DR
GLO2_BRASB       AGWTLTDILITHHHHDHVGAVA-ELKQKYGCRVVAPHD-KTTAIADVDLRVGHG----DV
GLO2_BRASO       NGWTLTDILITHHHYDHVGGVA-ELKQRYGCRVIGPHD-RKAAIADVDLRVAHG----DV
GLO2_BRADU       EGWQLTDILITHHHGDHVGGVA-ELKHKYNCRVVAPHD-KTTAIANVDLRVANA----DV
GLO2_NITHX       EGWTLTDILVTHHHADHIGGIA-ELKQKYKCRVVAPHD-KKAPIANVDLRVGQG----DI
GLO2_NITWN       EGWVLTDILITHHHSDHVGGVA-ELKRKYACRVVAPHD-RSAEIANVDLRVGQG----DI
GLO2_RHOP5       EGWTLTDILVTHHHGDHVGGVA-ELKQKYRCRVVAPHD-RNGRIPEVDLRVAQG----DV
GLO2_RHOPB       EGWTLTDILVTHHHADHIGGIA-ELKQATNCRVVAPHD-NGAAIPLVDLRVRQG----DV
GLO2_RHOPS       EGWKLTDILVTHHHGDHVGGVA-ELKKKYQCRVVAPHD-ANAKIADIDLRVEEG----DV
GLO2_RHOP2       EGWKLTDILVTHHHGDHVGGIA-ELKAKYHCRVVAPHD-ANAKIADADLRVEEG----DV
GLO2_RHOPA       EGWKLTDILVTHHHGDHVGGIA-ELKKKYQCRVHAPHD-ANAKIADADVRLQEG----DV
GLO2_ROSDO       RTWQLSEVWITHHHADHVQGLG-DILSAHPAQVRGAAR-DAHRLPALDVELRDG----ES
GLO2_RUEPO       RGWSLDQVWLTHHHWDHVDGLA-ALRDRYKPTVIGAEA-DAHRLPPLDLAVSEG----DR
GLO2_JANSC       QGWTLTDILLTHHHWDHIDGVP-ALVEATGAKVWGAAA-DAHRLPPLDHALAEG----DT
GLO2_RHOS4       RGWHLSQILLTHHHSDHVAGVE-ELRAATGARVAGAAA-DAHRLPPLDLELAEG----DL
GLO2_RHOS1       RGWHLSQILLTHHHSDHVAGVE-ELRAATGARVAGAAA-DAHRLPPLDLELAEG----DL
GLO2_RHOS5       RNWRLTQILLTHHHGDHVAGVA-ALREATGARVAGAAA-DAHRLPPLDLALAEG----DR
GLO2_RHOBL       QGWRLTDILLTHHHDDHIQAVP-EIHAATGARVHGAAA-DAHRLPPLDHALREG----DR
GLO2_RHOCA       RRWQLHHILITHHHADHIAGVE-ALAQATGAKVAGAAA-DAHRLPPLDHPVAPG----DV
GLO2_PELUB       KNIHLKYILNTHHHYDHVGGNK-ELKEKYGASVIGYKG-DKDRIPEIDILVGDQ----DI
GLO2_BDEBA       NKLDLAAILLTHHHSDHIGGVG-ELKAAFDCPVYAPQK-NQKQIPVADQWLKEG----DS
GLO2_PROM1       KNLSLKAILQTHHHDDHIGGTQKLIKTWPEAKVVASKK-EHKRIPFQTFSVDDN----DI
GLO2_PROMT       KNLSLKAILQTHHHDDHIGGTQKLIKTWPEAKVVASKK-EHKRIPFQTFSVDDN----DI
GLO2_PROMA       NGLSLHSVLQTHHHEDHIGGTQELINVWPSASVIAAKS-DLDRIQFQTKSVVDN----EE
GLO2_PROMS       NNFHLEAILQTHHHSDHIGGTKSLIEKWPNVKVIASSK-EKKRIPFQNVSVEDG----ET
GLO2_PROM0       NNLHLKAILQTHHHSDHIGGTKPLIERWQNVKVIASSK-EKKRIPFQNVSVEDG----ET
GLO2_PROM9       NNLYIKAILQTHHHSDHIGGTKYLIERWPNVQVIASSK-DKKRIPFQNISVEDG----ET
GLO2_PROM3       RKLSLAAVLQTHHHADHIGGTLELLRDWPNAAVVAAAD-DRDRIPFQTISVRDR----DK
GLO2_PROMM       RKLSLAAVLQTHHHADHIGGTLELLRDWPNAAVVAAAE-DRDRIPFQTISVRDR----DK
GLO2_SYNSC       RQLSLAAVLQTHHHADHIGGTPELLQRWPEAEVIASAD-DRERIPFQTMPVRGG----DH
GLO2_SYNPX       RQLQLSAVLQTHHHADHIGGTPGLLERWPDAAVVAAGA-DRSRIPFQTISVSDG----DQ
GLO2_SYNS9       HGMCLRAILQTHHHADHIGGTPDLLREWPQAEVVAATA-DRLRIPLQTRGVADG----DV
GLO2_SYNS3       RGLQLVAVLQTHHHSDHIGGTPGLLQRWSSAEVIAAAD-DKERIPFQTLSVRDG----DE
GLO2_SYNPW       KGLTLIAVLQTHHHADHIGGTPDLLRQWPDAAVIASGQ-DRGRIPFQTQPVAAG----TR
GLO2_SYNP6       EGLTLTAILNTHHHGDHVGGNRRLLRQFPEAAVSASAV-DRDRIPGQTVLLEAG----DR
GLO2_SYNY3       LGADLVTIYNTHHHGDHVGANRELLAKYPNLEVYGGVE-DQGRIPGQTVFLRDG----DR
GLO2_POLSJ       KGWQITQVLNTHEHHDHTGGNAAVIAATGAKLIAHHKA--GGRIAGVDRGVKAG----DV
GLO2_NITOC       NGWRITQIFNTHEHGDHTGGNEAIIAQTKGKLLAHHKA--RDKIRGIDEGLAAG----DT
GLO2_LEPBJ       KGWTLDFLLNTHEHEDHTSGNTGLVQRYGCTVYSHPEG--IGKIPHATHPLKKG----DF
GLO2_LEPBL       KGWTLDFLLNTHEHEDHTSGNTGLVQRYGCTVYSHPEG--IGKIPHATHPLKKG----DF
GLO2_ANADE       HGVRPRWILHTHGHADHTGGTA-AVARALGAQVLGHGGDAARYRPDVDLAGRAE------
                           ** * **  .                                        

GLO2_FRATO       INLGF-TSFRVMYIPGHIDDHVCFLFEQE--------RALFCGDTLFNAGVGGVQAESAD
GLO2_FRATH       INLGF-TSFRVMYIPGHIDDHVCFLFEQE--------RALFCGDTLFNAGVGGVQAESAD
GLO2_FRATW       INLGF-TSFRVMYIPGHIDDHVCFLFEQE--------RALFCGDTLFNAGVGGVQAESAD
GLO2_FRAT1       INLGF-TSFRVMYIPGHIDDHVCFLFEQE--------RALFCGDTLFNAGVGGVQAESAD
GLO2_FRATT       INLGF-TSFRVMYIPGHIDDHVCFLFEQE--------RALFCGDTLFNAGVGGVQAESAD
GLO2_FRATN       INLGF-TSFRVMYTPGHIDDHVCFLFEQE--------RALFCGDTLFNAGVGGVQAESAD
GLO2_NEIG1       FTFGN-GQVTVWATPGHTDRHTSYLLETSD------GIHVFCGDTLFSAGCGRVFTGTV-
GLO2_NEIMA       FTFGD-GQVTVWATPGHTDRHTSYLLETSD------GIHVFCGDTLFSAGCGRVFTGTI-
GLO2_NEIMB       FTFGD-GQVTVWATPGHTDRHTSYLLETSD------GIHVFCGDTLFSAGCGRVFTGTI-
GLO2_NEIMF       FTFGD-GQVTVWATPGHTDRHTSYLLETSD------GIHVFCGDTLFSAGCGRVFTGTI-
GLO2_LEGPA       VQVGS-LHFHILFNPGHTSTHISYYEPQQ--------GWLFCGDTLFSAGCGRVFDGTI-
GLO2_LEGPH       VQVGS-LHFHILFNPGHTSTHISYYEPQQ--------GWLFCGDTLFSAGCGRVFDGTI-
GLO2_LEGPL       VQVGS-LHFHILFNPGHTSTHISYYEPQQ--------GWLFCGDTLFSAGCGRVFDGTI-
GLO2_ACTP2       LTLFD-YDVRVIESAGHTAQHVSYLFGNE---------YLFCGDALFSGGCGRVFTGNY-
GLO2_HAEDU       LHLLN-SDVEVINSAGHTAQHISFLFAQQ---------YLFCGDALFSAGCGRVFTGDY-
GLO2_HAEIG       ILTAN-YQIDVIPTGGHTKQHVSFLVDN----------HLFCGDALFSAGCGRVFTGNY-
GLO2_HAEIN       ILTAN-YQIDVIPTGGHTKQHVSFLVDN----------HLFCGDALFSAGCGRVFTGNY-
GLO2_HAEI8       ILTAH-YQIDVIPTGGHTKQHVSFLVDN----------HLFCGDALFSAGCGRVFTGNY-
GLO2_MANSM       IQTAH-YRIEVVPSGGHTANHVSYLIDN----------HLFCGDTLFSAGCGRVFTGDY-
GLO2_HAES1       LIIDE-YHIDVLPTGGHTAQHLSFLIDG----------HLFCGDTLFSAGCGRVFTGDY-
GLO2_PASMU       LQTEH-YHIHVLQTAGHTEQHVSYLVDG----------HLFCGDSLFSAGCGRVFTGNY-
GLO2_BAUCH       LVLLE-KKFAVLSFPGHTLGHIGFYSYP----------WLFCGDTVFSAGCGRIFEGTT-
GLO2_SODGM       LTLLD-HTFSIMALPGHTLGHIGFYSAP----------WLFCGDTVFSAGSGRLFEGTP-
GLO2_YERPE       LTIAG-QNYTIIAVPGHTLGHIAYYSSP----------YLFCGDTLFSAGCGRLLEGTP-
GLO2_YERPA       LTIAG-QNYTIIAVPGHTLGHIAYYSSP----------YLFCGDTLFSAGCGRLLEGTP-
GLO2_YERPN       LTIAG-QNYTIIAVPGHTLGHIAYYSSP----------YLFCGDTLFSAGCGRLLEGTP-
GLO2_YERPP       LTIAG-QNYTIIAVPGHTLGHIAYYSSP----------YLFCGDTLFSAGCGRLLEGTP-
GLO2_YERPS       LTIAG-QNYTIIAVPGHTLGHIAYYSSP----------YLFCGDTLFSAGCGRLLEGTP-
GLO2_YERE8       LSIGG-QNYQVIAVPGHTLEHIAYYSKP----------YLFCGDTLFSAGCGRLFEGTP-
GLO2_PHOLL       INFGH-FSFQIIDVPGHTLGHIAFYQAP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_PECAS       VSLLN-SEFSVIEVPGHTSGHIAYYNAP----------FLFCGDTLFSAGCGRIFEGTP-
GLO2_ECOUT       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_ECOK1       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_ECOL5       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_ECOL6       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_ECOLI       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_ECO57       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_SHISS       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_SHIDS       AFVLG-HEFSVIATPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_SHIBS       AFVLG-HEFSVITTPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_SHIFL       AFVLG-HEFSVITTPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_SHIF8       AFVLG-HEFSVITTPGHTLGHICYFSKP----------YLFCGDTLFSGGCGRLFEGTA-
GLO2_SALCH       IRVLG-EKFTLFATPGHTLGHVCYFSHP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_SALPA       IRVLG-EKFTLFATPGHTLGHVCYFSHP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_SALTY       IRVLG-EKFTLFATPGHTLGHVCYFSRP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_SALTI       IRVLG-EKFTLFATPGHTLGHVCYFSHP----------YLFCGDTLFSGGCGRLFEGTP-
GLO2_BUCAI       IILLD-KIFYVFFTPGHTSGHVSYYSQP----------YIFCGDTLFSAGCGRVFKNKH-
GLO2_BUCAP       IKLLK-SEIHVFLTPGHTLGHVSYYLKP----------YIFCGDTLFSGGCGRVFKNKF-
GLO2_WIGBR       IFLLN-KCFKVFELPGHTLGHVGFYSPP----------WFFCGDTLFSAGCGRLFEGSA-
GLO2_BLOFL       LQILN-QEIKVLNFPGHTPHHIGFYYKS----------WLFSGDTIFSAGCGTIQTGYT-
GLO2_BUCBP       IEILN-TKFYIIPTPGHTNGHTAYYCPP----------FLFCGDSIFSGGCGRVKNGMM-
GLO21_VIBVY      LNLLN-STFNVLELPGHTDNHIGIMYKD----------NLFCGDVLFSAGCGRVGSNY--
GLO2_AERHH       INWHG-LSLEVIHVPGHTHGHIAYY----------GHGMLFCGDTLFSAGCGRLFEGTP-
GLO2_RHOFT       LQALG-LNFQVIDVPGHTACHIAYFCADVD-----GAPLLFCGDTLFSAGCGRLFEGSP-
GLO2_PSEPF       VRVLG-WDFDVYAVPGHTLGHIAYY----------HHGLLFCGDTLFAAGCGRLFEGTP-
GLO2_PHOPR       VELFG-ERFMVLGVPGHTLGHVAYV----------GDGKLFCGDTLFSVGCGRLFEGTP-
GLO2_ALIF1       VELFD-EQFMVLGVPGHTNGHVAYI----------GDEKLFCGDALFSAGCGRLFEGTA-
GLO2_VIBVU       LELFD-ETFLVLGLGGHTLGHIGYV----------GDGKLFCGDVLFSAGCGRIFEGTA-
GLO22_VIBVY      LELFD-ETFLVLGLGGHTLGHIGYV----------GDGKLFCGDVLFSAGCGRIFEGTA-
GLO2_VIBPA       LELFG-EIFLVLGLPGHTLGHIGYV----------GDSKLFCGDVLFSAGCGRIFEGTP-
GLO2_VIBCH       IELFD-ERFMVLGLPGHTLGHIGYV----------GDGKLFCGDVLFSAGCGRVFEGTM-
GLO2_PSEHT       ITVLN-TAFNIIATPGHTLDHICYV----------NEQLAFTGDTLFSGGCGRLFEGSA-
GLO2_HYDCU       VQVLN-ETFQVIETPGHTDEHICFY----------HPEALFSGDTLFTGGCGKIWQNPP-
GLO2_SACD2       KGVDV-PSLQVIATPGHMPEHLSYLLPL-------TTPKLFCGDTLFSCGCGRILQGTH-
GLO2_RHIEC       FLFGD-HTVKVIETPGHTAGHICYHFVDD--------KLLFAADTLFALGCGRLFERPA-
GLO2_RHIL3       FLFGD-HTVNVIETPGHTAGHICYHFVDD--------KLLFAADTLFALGCGRLFERPA-
GLO2_AGRFC       FEFAG-RRVQVIATPGHTAGHICYYLPDD--------GLLFAADTLFAMGCGRLFERPA-
GLO2_RHIME       FDFAG-HPVDVIETPGHTSGHVCYHLPED--------KLLFAADTLFALGCGRLFEGTA-
GLO2_BRUAB       FTFGL-FKVKVISTPGHTAGGISYYLPDA--------KVVFTGDTLFALGCGRLFEGTP-
GLO2_BRUO2       FTFGL-FKVKVISTPGHTAGGISYYLPDA--------KVVFTGDTLFALGCGRLFEGTP-
GLO2_BRUA2       FTFGL-FKVKVISTPGHTAGGISYYLPDA--------KVVFTGDTLFALGCGRLFEGTP-
GLO2_BRUME       FTFGL-FKVKVISTPGHTAGGISYYLPDA--------KVVFTGDTLFALGCGRLFEGTP-
GLO2_BRUSU       FTFGL-FKVKVISTPGHTAGGISYYLPDA--------KVVFTGDTLFALGCGRLFEGTP-
GLO2_OCHA4       FTFGL-FRVKVIATPGHTAGEVSYYLPDA--------KAVFTGDTLFALGCGRLFEGTP-
GLO2_CHESB       VRVGN-QEARVIETPGHTAGHITFYFAKA--------GIAFTADTLFALGCGRLFECKP-
GLO2_RHILO       LHLGD-ERIEVIATPGHTAGHVSYHLPAS--------KVAFTADTLFALGCGRLFECKP-
GLO2_MARMM       ISLGD-HKAKVFYTPGHTMGHVCYHMPMD--------GIAFVGDTLFALGCGRLFEGTP-
GLO2_HYPNA       VELGG-ATATVIDVPGHTLGHIAFHFPDQ--------EAAFVGDAVFALGCGRVFEGTM-
GLO2_METCA       FRLGS-ASARMLDVPGHTSGHVAFWFEDD--------AALFCGDTLFALGCGRLFEGSA-
GLO2_RHORT       VAIGQ-AEARVIETPGHTLGHIAYWFAES--------SALFCGDTLFSAGCGRLFEGSA-
GLO2_BRASB       IKVGE-LLARVLETPGHTLDHVSYVFDAD--------KAVFAADTLFSVGCGRVFEGTY-
GLO2_BRASO       VKVGE-LLARVLETPGHTLDHVSYVFDAD--------KAVFAADTLFSIGCGRVFEGTY-
GLO2_BRADU       VKVGN-LLARVVETPGHTLDHISYVFDTE--------KTVFAADTLFSIGCGRVFEGTY-
GLO2_NITHX       VKVGT-LLGRVLETPGHTLDHISYVFDDE--------KVVFAADTLFSIGCGRVIEGTY-
GLO2_NITWN       IKVGT-LLGRVLETPGHTLDHVSYVFDDE--------KVVFAADTLFSIGCGRVFEGTY-
GLO2_RHOP5       VKVGG-LLARVLETPGHTLDHLAYVFDDD--------KAVFAGDTLFSIGCGRVFEGTY-
GLO2_RHOPB       VKIGG-LLARVLETPGHTLDHVAYVFDDD--------KALFAADTLFSIGCGRVFEGTY-
GLO2_RHOPS       VRVGG-LSARVLETPGHTLDHISYVFDDD--------RALFAADTLFSIGCGRVFEGTY-
GLO2_RHOP2       VKVGG-LEARVLETPGHTLDHISYVFADD--------RALFAADTLFSIGCGRVFEGTY-
GLO2_RHOPA       VRVGD-LTARVLETPGHTLDHLSYVFDDD--------RALFAADTLFSIGCGRVFEGTY-
GLO2_ROSDO       FDFAG-HKVDVMDVSGHTVGHIAYYCADA--------KAVFTADSLMALGCGRLFEGTA-
GLO2_RUEPO       FDLGG-APVEVLDVSGHTVGHIAFHLPTG--------KAVFTADSLMALGCGRLFEGTP-
GLO2_JANSC       IRIGA-LEGDVMDVSGHTVGHVAFHFPAA--------TAVFTADSLMALGCGRLFEGTP-
GLO2_RHOS4       VRVGA-SEGRVIEVPGHTVGHIAFHFPDS--------SLAFTGDSLMAMGCGRLFEGTA-
GLO2_RHOS1       VRVGA-SEGRVIEVPGHTVGHIAFHFPDS--------SLAFTGDSLMAMGCGRLFEGTA-
GLO2_RHOS5       VRIGS-EDGTVLEVPGHTVGHIAFHFADS--------GLAFTGDSLMAMGCGRLFEGTP-
GLO2_RHOBL       VAIGA-ESAVVIDVPGHTRGHIAFHFPGS--------ALAFTGDSLMAAGCGRLFEGTP-
GLO2_RHOCA       LHLGM-EAAQVIAADGHTLGHIAWYLPGA--------GLLFSGDSLMSWGCGRLFEGTP-
GLO2_PELUB       WHEEN-FQAKIFHIPGHTLGHICFYFYNE--------ESVFTGDTLFSLGCGKIFEGTY-
GLO2_BDEBA       VTCGP-WDFTVMELPGHTLGHIAYWNQKH--------KWLFSGDVIFGLGCGRLFEGTF-
GLO2_PROM1       FNLMD-AEIKVIEVHGHTDNHIAFYI--S--KQNAKCNILFPGDTLFGGGCGRLLEGSP-
GLO2_PROMT       FNLMD-AEIKVIEVHGHTDNHIAFYI--S--KQNAKCNILFPGDTLFGGGCGRLLEGSP-
GLO2_PROMA       LDILG-QKIKVIEVPGHTSNHICFFLQGS--KESKIDPVLFCGDTLFGAGCGRLFEGTP-
GLO2_PROMS       LNILG-EEVKIIEVLGHTSSHIAFFL-------NGENPVLFIGDTLFSGGCGRIFEGTY-
GLO2_PROM0       LNILG-EEVKIIEVLGHTSSHIAFFL-------NGENPVLFIGDTLFSGGCGRIFEGTY-
GLO2_PROM9       LNILG-EEIKIIEVLGHTNSHIAFFV-------NGESPVLFIGDTLFSGGCGRIFEGTY-
GLO2_PROM3       ISLLN-SSVEVLAVAGHTRAHIAYYLPTN--KEDREDPAVFCGDTLFGAGCGRLFEGTA-
GLO2_PROMM       VSLLN-SSVEVLAVAGHTRAHIAYYLPTN--KEDLEDPAVFCGDTLFGAGCGRLFEGTA-
GLO2_SYNSC       VTVLG-ETVEVMDVAAHTRAHIAFFLPNP--KGAEIRPLLFCGDTLFSGGCGRLFEGSA-
GLO2_SYNPX       VTVLG-RSLQVLDVAAHTSAHIAFVIPEQ--EDPDLGPVVFCGDTLFSGGCGRLFEGTP-
GLO2_SYNS9       INLLG-RRLEVIDVAAHTSAHIAFIIRNDDDQDPSFGPLAFCGDTLFAGGCGRLFEGSA-
GLO2_SYNS3       IELLG-RPVRVMDVRAHTRAHIAYWLPQGE-ISTSLTSVLFCGDTLFSGGCGRLFEGTP-
GLO2_SYNPW       FTLLG-VPVDVIDVRAHTSAHLAFFLPEGC-SPGGHPPALFCGDTLFSGGCGRLFEGTP-
GLO2_SYNP6       LQICG-QTAEVLFVPGHTRGHIAYYFPEVAE--GNPRGALFCGDTLFAGGCGRLFEGTP-
GLO2_SYNY3       LSFAD-REATVYFVPGHTRGHIAYYFAPGS---GETIGDLFCGDTIFAGGCGRLFEGTP-
GLO2_POLSJ       IKVGKTVELECLDTPGHTMCHICLRSHTE-------QPALFSGDTLFNAGAGNVHNGGDV
GLO2_NITOC       VKVGNGVALKVLDTPGHTMSHLCLFAPSN-------PPALFCGDTLFNAGAGNCHNGGDP
GLO2_LEPBJ       LLRSSKEYLEILDTPGHTFCHVCLLLVENQ-----KPKAIFTGDTIFNAGVGNCHHGGDP
GLO2_LEPBL       LLRSSKEYLEILDTPGHTFCHVCLLLVENQ-----KPKAIFTGDTIFNAGVGNCHHGGDP
GLO2_ANADE       -VALGALALRVHPVPGHTPGSVLLEWEGR----------LLTGDTLFWAGCGNCRHGGDP
                                .*                       : .* ::  * *        

GLO2_FRATO       INQLYDSLVKITKLDGDIKPYPAHDYWLGNLDFALSILAD--------DSYFNY------
GLO2_FRATH       INQLYDSLVKITKLDGDIKPYPAHDYWLGNLDFALSILAD--------DSYFNY------
GLO2_FRATW       INQLYDSLVKITKLDGDIKPYPAHDYWLGNLDFALSILAD--------DSYFNY------
GLO2_FRAT1       INQLYDSLVKITKLDGDIKPYPAHDYWLGNLDFALSILAD--------DSYFNY------
GLO2_FRATT       INQLYDSLVKITKLDGDIKPYPAHDYWLGNLDFALSILAD--------DSYFNY------
GLO2_FRATN       INQLYDSLVKITKLDGDIKPYPAHDYWLGNLDFALSILAD--------DSYFNY------
GLO2_NEIG1       -EQLYDNFQRFNQLPEGTLFYPAHEYTAANLRFAAHIEPD--------NADIQT------
GLO2_NEIMA       -EQLYDSFQRFNRLPENTLFYPAHEYTAANLRFAAHIEPD--------NADIQT------
GLO2_NEIMB       -EQLYDSFQRFNRLPENTLFYPAHEYTAANLRFAAHIEPD--------NADIQT------
GLO2_NEIMF       -EQLYDSFQRFNRLPENTLFYPAHEYTAANLDFAAHIEPD--------NADIQT------
GLO2_LEGPA       -EELHESLLLFKKLPRNTKVFCAHEYTLQNLKFAHTVEPC--------NSSVIN------
GLO2_LEGPH       -EELHESLLLFKKLPRNTKVFCAHEYTFQNLKFAHTVEPC--------NSSVIN------
GLO2_LEGPL       -EELHESLLLFKKLPRNTKIFCAHEYTLQNLKFAHTVEPC--------NSSVIN------
GLO2_ACTP2       -QAQFDALQRFKALPEFVEIFPAHEYTLSNLKFAEAVLAP--------SCALFE------
GLO2_HAEDU       -QAQFNTLQRFKTLPESTLVFPAHEYTLTNLKFAASVLPN--------NNDIRE------
GLO2_HAEIG       -ALMFEGLQRLNTLPDETIVCPAHEYTLGNLAFAETVLVD--------KSAVEKSAVEKS
GLO2_HAEIN       -ALMFEGLQRLNTLPDETIVCPAHEYTLGNLAFAETVLVD--------KSAVEKSAVEK-
GLO2_HAEI8       -AQMFDGLQRLNTLPDETIVCPAHEYTLGNLAFAETVLVE--------KSAVEK------
GLO2_MANSM       -GQMFESITRLKQLPDKTVICPAHEYTLSNLVFAEAFAPNE-----KVKSAVKN------
GLO2_HAES1       -SQMFTSLQLLKSLPDETIVCPAHEYTLGNLAFALTTGKN--------KSAVQK------
GLO2_PASMU       -QHMFDGLQRLKSLPDDTIVCPAHEYTLANLAFAKYILPE--------NVAIQQ------
GLO2_BAUCH       -KQMYESFQEVNQLSSHTLICCAHEYTLTNLAFASSLLPK--------DRIISS------
GLO2_SODGM       -RQMYESFQKVNQLSSATLICAAHEYTLSNLNFAAALLPQ--------DSVITD------
GLO2_YERPE       -EQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAILPA--------DQDIAT------
GLO2_YERPA       -EQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAILPA--------DQDIAT------
GLO2_YERPN       -EQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAILPA--------DQDIAT------
GLO2_YERPP       -EQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAILPA--------DQDIAT------
GLO2_YERPS       -EQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAILPA--------DQDIAT------
GLO2_YERE8       -AQMYASIQQLAQLPDETLICSAHEYTLANLKFARFILPS--------DQDIAT------
GLO2_PHOLL       -EQMYTSIGKIAELPDDTLICCAHEYTISNMKFAHAVLP---------NQTISE------
GLO2_PECAS       -KQMYESIQKIAELPDDTVVCCAHEYTLSNLRFSNDIWPE--------DPDIES------
GLO2_ECOUT       -SQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_ECOK1       -SQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_ECOL5       -SQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_ECOL6       -SQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_ECOLI       -SQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_ECO57       -SQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_SHISS       -SQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSILPH--------DLSIND------
GLO2_SHIDS       -SQMYQSLKKLSALPDDTLVCCAHEYTLSNMEFALSILPH--------DLSIND------
GLO2_SHIBS       -LQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIFPH--------DLSIND------
GLO2_SHIFL       -LQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIFPH--------DLSIND------
GLO2_SHIF8       -LQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIFPH--------DLSIND------
GLO2_SALCH       -SQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPH--------DSFINE------
GLO2_SALPA       -SQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPH--------DSFINE------
GLO2_SALTY       -SQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPH--------DSFINE------
GLO2_SALTI       -SQMYQSLMKINSLPDDTLICSAHEYTLANIKFALSILPH--------DSFINE------
GLO2_BUCAI       -LEMYRSIKIISSLPDSTLLCCSHEYTLSNLQFSMFILPN--------DNFIKL------
GLO2_BUCAP       -FDMYQSINFIKSLPKKTILCCSHEYTLSNLNFAMSILPF--------DKKIKK------
GLO2_WIGBR       -KDMYFSIKKINSLPPNTLICAGHEYTLQNLNFAISVFPK--------NTILSM------
GLO2_BLOFL       -QAMYKSLLKIQCLPKNTLIYSGHEYTLLNLNFAISILPQ--------DTLIIN------
GLO2_BUCBP       -IKMYNSLRTISKLPNDTLIYCSHEYTRSNLEFFKKIFPK--------NLNILN------
GLO21_VIBVY      -KDMYLSLKKIKSMDDKTKIYFSHEYTLDNLKFAHYIDPK--------NKNIIN------
GLO2_AERHH       -AQMHASLQRLAALPDDTLIYCAHEYTLSNLRFAYAVEP--------DNHAIQQ------
GLO2_RHOFT       -AQMLASLDTLAALPDATRVCCAHEYTLSNLKFACAVEP--------VNQALTD------
GLO2_PSEPF       -QQMHQSLSRLAALPEDTLVYCTHEYTLSNLKFAAAVEP--------DNRDIAA------
GLO2_PHOPR       -AQMFQSLKKLAALPDETEIYCAHEYTSSNLAFALVAEQ--------DNPHLQR------
GLO2_ALIF1       -EQMFNSLQKMAALPDETEVYCAHEYTASNLAFALAVEP--------DNDYLLR------
GLO2_VIBVU       -QQMFDSLNKLLALPEETEVFCAHEYTASNVAFALAVEP--------DNELLHQ------
GLO22_VIBVY      -QQMFDSLNKLLALPEETEVFCAHEYTASNVAFALAVEP--------DNELLHQ------
GLO2_VIBPA       -EQMFESLSKIAALPEETQVFCAHEYTASNVAFALAVEP--------DNEQLRQ------
GLO2_VIBCH       -EQMFSSLNKLLSLPEETQVYSAHEYTAANVAFALAVEP--------ENEQLHI------
GLO2_PSEHT       -EQMWHSFNKLRELPADCKVYCTHEYTQANLAFATAIEP--------RNPELLA------
GLO2_HYDCU       -EQMAESLLKLRALNDDCMVYCGHEYTYANLNFAKIAEP--------NTPAILD------
GLO2_SACD2       -EQLRTSLDAISALPSQTEVYCTHEYTLTNIKFARTVEP--------QSQALID------
GLO2_RHIEC       -ADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDP--------DNERLKS------
GLO2_RHIL3       -ADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDP--------DNERLKS------
GLO2_AGRFC       -ADMWHSFQKLMALPDDTRVYFGHEYTLSNARFALTVDP--------DNAVLRE------
GLO2_RHIME       -DTMWQSLSRLMALPDDTAIYFGHEYTLANAHFAITVDP--------ENSALKE------
GLO2_BRUAB       -ATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDP--------DNSALKE------
GLO2_BRUO2       -ATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDP--------DNSALKE------
GLO2_BRUA2       -ATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDP--------DNSALKE------
GLO2_BRUME       -ATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDP--------DNSALKE------
GLO2_BRUSU       -ATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDP--------DNSALKE------
GLO2_OCHA4       -LTMFQSLQKLVALPGDTAVYCGHEYTESNARFALTIDP--------ANSALKE------
GLO2_CHESB       -PVMYESLKKLVELPLETVIYCGHEYTESNARFALSVDP--------TNSALKE------
GLO2_RHILO       -PVMYESLRKLAALPAATTIYCGHEYTLANARFALTVDP--------TNSALKE------
GLO2_MARMM       -AEMWHSLSRLAALPDETRIYCAHEYTEANARFALSIDP--------DNHDLQV------
GLO2_HYPNA       -EMMWESLKRIKKLPKKTQLYCAHEYTASNAKFAVTIEP--------ENKALKE------
GLO2_METCA       -EQMWRSLERLRALPAETKVFCAHEYTQANARFAVTIEP--------GNAALRE------
GLO2_RHORT       -GQMWDSLRKLRALPAQTLVFCGHEYTQPNITFALTIDP--------RNEALRA------
GLO2_BRASB       -PMMWDSLLKLRALPDDFRLYCGHEYTASNVKFALTVDG--------DNEALKA------
GLO2_BRASO       -PMMWDSLLKLRTLPDDFRLYCGHEYTASNVKFALTVDP--------DNEALKA------
GLO2_BRADU       -PMMWDSLLKLRALPDDFKLYCGHEYTASNVKFALTVDP--------DNAALQA------
GLO2_NITHX       -PMMWDSLLKLRALPDDFRLYCGHEYTASNVKFALTVEP--------NNAALKA------
GLO2_NITWN       -PMMWDSLLKLRALPDSFRLYCGHEYTDSNIKFALTIEP--------NNPVLKA------
GLO2_RHOP5       -PMMWDSLLKLRVLPDDMRLYCGHEYTAANVKFALGVEP--------DNPALQA------
GLO2_RHOPB       -PMMWESLLKLRVLPDDMRLYCGHEYTAANVKFALTVEP--------NNPALQA------
GLO2_RHOPS       -PMMWESLLKLRELPDDFKLYCGHEYTASNVKFALTIEP--------DNAALQA------
GLO2_RHOP2       -PMMWESLLKLRALPDDYKLYCGHEYTASNVKFALTIEP--------ENAALQA------
GLO2_RHOPA       -PMMWESLLKLRALPDDFKLYCGHEYTASNVKFALGIEP--------DNAALQA------
GLO2_ROSDO       -DQMWDSLSKLAALPSETQVYSGHEYTAANARFALTIDP--------HNPDLIS------
GLO2_RUEPO       -DQMWASLSKLAALPDDTLVCSGHEYTQSNARFALSVDP--------DNAALKT------
GLO2_JANSC       -AQMHGSLEKLKMLPPGTLVCSGHEYTASNARFALTIEP--------DNPDLIF------
GLO2_RHOS4       -EAMWQSLRKLSALPPETMICSGHEYAASNARFAATLEP--------DSPMLIF------
GLO2_RHOS1       -EAMWQSLRKLSALPPETMICSGHEYAASNARFAATLEP--------DSPMLIF------
GLO2_RHOS5       -RMMWQSLRKLSALPADTLICSGHEYTQANARFACTLEP--------ENPVLIF------
GLO2_RHOBL       -AEMWASLSKLAALPPETLICSGHDYLDGNLRFALALEP--------GNPALIS------
GLO2_RHOCA       -AQMFDTLTRLAALPPETRVCSGHEYTAANGRFALSLEP--------GNGRLHD------
GLO2_PELUB       -SQMYNSLMKIKALPEKTKIYCGHEYTKQNSKFCIAHDQ--------DNENLKV------
GLO2_BDEBA       -EQGYESLQRIKKLPPQTLIYCTHEYTKSNLEFCRILTNQDNTPITGDSEALEL------
GLO2_PROM1       -VQMFESLYKLNSLPENTEIYPAHEYTESNLKWALSLEP--------GNISIIE------
GLO2_PROMT       -VQMFESLYKLNSLPENTEIYPAHEYTESNLKWALSLEP--------GNISIIE------
GLO2_PROMA       -EQMFNSLSRINNLPKNTKIYCAHEYTEANLRWAKSIFP--------EDIYIEE------
GLO2_PROMS       -QQMYSSLERIKSLPKNTLIYCAHEYTKANILWALNLKP--------KDQDIKN------
GLO2_PROM0       -QQMYSSLERIKSLPKDTLIYCAHEYTKSNILWALNLKP--------KDQDLKN------
GLO2_PROM9       -QQMYSSLERIKSLPKNTLIYCAHEYTKANLLWALNLKP--------KDQDIKN------
GLO2_PROM3       -EDMFKALQRLCCLPAKTRVYCAHEYTEANLRWASALHP--------EDIAISE------
GLO2_PROMM       -EDMFKALQRLSCLPAKTRVYCAHEYTEANLRWASALHP--------EDVAISE------
GLO2_SYNSC       -EQMHQALQKLAELPEATQVCCAHEYTEANLQWAVAQQP--------NNTVLVE------
GLO2_SYNPX       -ADMHRALRRLSELPESTKVCCAHEYTEGNLLWAIQQQP--------QDAAIRQ------
GLO2_SYNS9       -QDMYRALQRFAALPDETLVCCAHEYTEANLRWATEQRP--------NDVQITT------
GLO2_SYNS3       -ADMHRALQRLGSLPPETLVCCAHEYTEANLRWAAQQEP--------DDALITN------
GLO2_SYNPW       -DDMHRALQTLATLPESTRIYCAHEYTEGNLRWAHALQP--------EDRAIKA------
GLO2_SYNP6       -AQMLDSLQQLRSLPDDTAIYCAHEYTLNNLRFALTVEP--------DNFDLQQ------
GLO2_SYNY3       -AQMVQSIGKLRQLPDQTRLWCAHEYTLGNLKFALTVDP--------SNKDLQE------
GLO2_POLSJ       NALYATFAEQLARLPDDTLVYPGHDYIENNLRFTLAREPD--------NAAAKA------
GLO2_NITOC       NALYATFTQQLALLPCNTRIYPGHEYIENNLGFTLDREPD--------NEQAMA------
GLO2_LEPBJ       EVLAKTILEQFYPLEEEILLYPGHDYLETNLKFTLSLDPS--------NQDAIR------
GLO2_LEPBL       EVLAKTILEQFYPLEEEILLYPGHDYLETNLKFTLSLDPS--------NQDAIR------
GLO2_ANADE       ARLAESFLGPIARLDGGLEVHPGHDYAAPNLAFALALEPD--------GAAARA------
                           .  :         *:*   *  :                           

GLO2_FRATO       ----YRNQVAELAAEDKP--IVNLAEEAKLNIFIRAMSDKALLKALPDY----SLG----
GLO2_FRATH       ----YRNQVAELAAEDKP--IVNLAEEAKLNIFIRAMSDKALLKALPDY----SLG----
GLO2_FRATW       ----YRNQVAELAAEDKP--IVNLAEEAKLNIFIRAMSDKALLKALPDY----SLG----
GLO2_FRAT1       ----YRNQVAELAAEDKP--IVNLAEEAKLNIFIRAMSDKALLKALPDY----SLG----
GLO2_FRATT       ----YRNQVAELAAEDKP--IVNLAEEAKLNIFIRAMSDKALLKALPDY----SLG----
GLO2_FRATN       ----YRNQVAELAAEDKP--IVNLAEEAKLNIFIRAMSDKALLKALPDY----SLG----
GLO2_NEIG1       ---------ALKAAEHTPTLPVTLAHERRVNPFLRTEIPAVRQRAEALV----GKT--LN
GLO2_NEIMA       ---------ALKAAERTPTLPVTLAHERRVNPFLRTEIPAVRQRAEALV----GKT--LN
GLO2_NEIMB       ---------ALKAAAHTPTLPVTLAHERRVNPFLRVDLPHVRDRAEALS----GKT--LN
GLO2_NEIMF       ---------ALKAAAHTPTLPVTLAHERRVNPFLRVDLPHVRDRAEALS----GKT--LN
GLO2_LEGPA       ------YMQQILKQPSPCTLPSNIDLELSINPFLRTDKEQVKQYALSHG----ANS---S
GLO2_LEGPH       ------YMQQILKQPSSCTLPSNIDLELSINPFLRTDKEQVKQYALSHG----ANS---S
GLO2_LEGPL       ------YMQQILKQPSPCTLPSNIDLELSINPFLRTDKEQVKQYALSHG----ANS---S
GLO2_ACTP2       ----IQERAEILRSRNQPTLPTTLERELQINPFLQAVD----------------------
GLO2_HAEDU       ----AQARAETLRAQQQPTLPSTIKQELRINPFLQADN----------------------
GLO2_HAEIG       AVEKQRIFVETQRAENKPSLPTTLKLEREINPFLQAKT----------------------
GLO2_HAEIN       ----QRIFVETQRAENKPSLPTTLKLEREINPFLQAKT----------------------
GLO2_HAEI8       ----QRIFVETQRAENKPSLPTTLKLEREINPFLQAKT----------------------
GLO2_MANSM       ----QRISVESLRAQNKPSLPTTLALEKNINPFLQAEN----------------------
GLO2_HAES1       ----QLEKVKKLRAENKPSLPTTLALEKQINPFLQVES----------------------
GLO2_PASMU       ----HEQWVQKQRVTHQPSLPTTMGREKQINPFLIAQD----------------------
GLO2_BAUCH       ----YQRHVTILRNKKKPSLPTKLSLERLINPFFRCHDINLHQAINFSP----LLG----
GLO2_SODGM       ----YQRKIKELRLKNQPSMPTKLHLERQINLFLRCHDVNLQNKLNVHP----APS----
GLO2_YERPE       ----YQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTS----PPD----
GLO2_YERPA       ----YQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTS----PPD----
GLO2_YERPN       ----YQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTS----PPD----
GLO2_YERPP       ----YQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIETTS----PPD----
GLO2_YERPS       ----YQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGITS----PPD----
GLO2_YERE8       ----YQQQIMQLRAKNQPSLPVKLQIERKINVFLRCDDIDLQRKIGVIS----PPN----
GLO2_PHOLL       ----YQQKVIRMRENNQPTIPTTLQTEKKINIFLKCDDIDLQRNIGITP----NSQ----
GLO2_PECAS       ----YLHKISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKISNEP----ENI----
GLO2_ECOUT       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLK----
GLO2_ECOK1       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLQ----
GLO2_ECOL5       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLQ----
GLO2_ECOL6       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLQ----
GLO2_ECOLI       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLQ----
GLO2_ECO57       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLQ----
GLO2_SHISS       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET----LLQ----
GLO2_SHIDS       ----YYRKVKELRAKNQITQPVILKNERQINVFLRTEHIDLINVINEET----LLQ----
GLO2_SHIBS       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINGINEET----LLQ----
GLO2_SHIFL       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINGINEET----LLQ----
GLO2_SHIF8       ----YYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINGINEET----LLQ----
GLO2_SALCH       ----YYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKET----ILQ----
GLO2_SALPA       ----YYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKET----ILQ----
GLO2_SALTY       ----YYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKET----ILQ----
GLO2_SALTI       ----YYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKET----ILQ----
GLO2_BUCAI       ----YLKKIEIKLKLGQSSLPSYIFFEKKINLFLRTNDNYVKKSIGLKS----T-C----
GLO2_BUCAP       ----YYKKIKKHISQNKTSLPVSLETEKKINIFLRTNEKTIKKAMGLKK----D-T----
GLO2_WIGBR       ----YKKKVEKLNFYKKPTLPSALYLERQINIFLNPYNFEFKGELKRLL----L-Q----
GLO2_BLOFL       ----YLKKITKVLKKNKLLQPTTLQLELKINPFLRCNDINIQKSLNLFP----KPG----
GLO2_BUCBP       ----YYNNIKK--SKTQCTLPSTLKIEKKINPFLQLNNTNLRHQVKIHN----DLS----
GLO21_VIBVY      ----YIEVFKE--KPDTVSAPTTLLLEKEINPFLRLSE-----NIDIKN----KIN----
GLO2_AERHH       ----RIGLISKLRQQGLPSLPSRLGDEREFNVFLRCEQDSVKFSAEKHA----LKC--LE
GLO2_RHOFT       ----YTVKAEALRSQQQPTLPSSILLERQINPFLRTRQATVTQAVQAFD----ASA--RD
GLO2_PSEPF       ----RLEKVTRQRENGVMTLPSTLALEKLTNPFLRTGEILVTQKVDERN----GPQ--NR
GLO2_PHOPR       ----YREDVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKA----FD----D
GLO2_ALIF1       ----YREKVLHLRAHGKSTIPSTLQREKLINPFLRTSEANVKKSVASKV----QD----S
GLO2_VIBVU       ----YRDTVNRLRAQNLPTIPTTLRQEKWINPFLRYLQPSVIHSVSSRT----KN----S
GLO22_VIBVY      ----YRDTVNRLRAQNLPTIPTTLRQEKWINPFLRYLQPSVIHSVSSRT----KN----S
GLO2_VIBPA       ----YRDDVNRLRALNIPTLPTTLRKEKWINPFLRTTNPDVVKSVANRI----KN----S
GLO2_VIBCH       ----YRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQV----ST----L
GLO2_PSEHT       ----YSKRVDELRSKNEITLPSTIGQELKINPFMRSDLPNITELLPKEF----CSVTKNN
GLO2_HYDCU       ----RLAEVKTNTQRNIPCVPARLGLEKQTNPFLRFDHPPLMQTLMERQ----AQ--PNE
GLO2_SACD2       ----YEQRVRSLRKNDLPSIPTTIEREKALNPFLRYKELSIQQAVENHL----RLK--GL
GLO2_RHIEC       ----RAAEIEALRAEGKFTVPTTLGLEKETNPFLRAADPAIRRHLIME-----GKT----
GLO2_RHIL3       ----RAAEIEALRADGKFTIPTTLGLEKETNPFLRAADPAIRRNLVME-----GKT----
GLO2_AGRFC       ----RAARVETARQANEFTIPTTIGLEKQTNPYMRVADAGIRRHLGLE-----GAA----
GLO2_RHIME       ----RAAEIEETRSDGGFTAPTTMGLEKRTNPFLRAGDPKIRALLGME-----KAS----
GLO2_BRUAB       ----RAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQ-----DAP----
GLO2_BRUO2       ----RAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQ-----DAP----
GLO2_BRUA2       ----RAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQ-----DAP----
GLO2_BRUME       ----RAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQ-----DAP----
GLO2_BRUSU       ----RAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQ-----DAP----
GLO2_OCHA4       ----RAAEIARLRAADRMTLPSSIALEMATNPFLRWHDAGIRSRLGLQ-----DAP----
GLO2_CHESB       ----RAKKIEALRREGRPTLPTTLGEEMATNPFLRCHDPVLRNNLGMK-----NAA----
GLO2_RHILO       ----RATRIEALRVDNKPTLPTTIGEELSTNPFLRWHDPAIRKHLGME-----KAG----
GLO2_MARMM       ----YAAMVEGERARGEPTVPTTIAAEKAANPFLRPDDPAIRARLGME-----HDD----
GLO2_HYPNA       ----YVAWIEKRRAEDKPTVPALLERELETNPFLRADLPEMQLAMGHA-----GNA----
GLO2_METCA       ----RVERVEALRREGAATVPSILSEELATNPFLRPESPEIRARLGLP-----GVP----
GLO2_RHORT       ----RALEVDALRAAGRPTVPAFLGDEARSNPFLRADSADFQEAFGMT-----GAD----
GLO2_BRASB       ----RAAEVTRLRAANESTIPSLLGDEKQTNVFLRADDPAVAIKLRMK-----GAT----
GLO2_BRASO       ----RAAEVTRLRAANQPTIPVLLGEEKQANVFLRADDPAIAVRLRMK-----GAS----
GLO2_BRADU       ----RAAEVAKLRAENKPTIPSLLGDEKRANVFLRADDPSVAARLHMK-----GAD----
GLO2_NITHX       ----RAEDVARLRAENKPTVPTLMGEEKKANVFLRADDPAVAAGVHMK-----GAS----
GLO2_NITWN       ----RAEEVTRLRAEGRPTVPTLMGEEKKANVFLRADDPAVAAGVHMK-----GAS----
GLO2_RHOP5       ----RAAQVTALRAAGQPTIPTLLGEEKAANVFLRADEPSVAASVRLK-----GAD----
GLO2_RHOPB       ----RAAEVAHLRTAGLPTIPTLLGDEKRANVFLRADEPTVAAGVRLK-----GAG----
GLO2_RHOPS       ----RAKQVEQQRAAGQPTIPVTLGEEKQANLFLRADVPSVAAAVGLP-----GES----
GLO2_RHOP2       ----RAKQVEQQRGAGRPTIPVTLGEEKQANVFLRADVPSVAAAIGFA-----GES----
GLO2_RHOPA       ----RAKQVESLRAEGKPTIPVTLGEEKQANVFLRADVPSVAAAVGMP-----GAP----
GLO2_ROSDO       ----RSEGITAARAAAKPTVPSTLATEAATNPFLRAADPAIRAHLNMQ-----HAS----
GLO2_RUEPO       ----RAAEIDQARAEGRPTVPSLLSLEKSTNPFLRAADPGIQSLLGMQ-----GAD----
GLO2_JANSC       ----RVERITAARAAGQPTVPSTLAEELATNPFLRADAPTVAAPLDME-----GAD----
GLO2_RHOS4       ----RVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMV-----DAE----
GLO2_RHOS1       ----RVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMV-----DAE----
GLO2_RHOS5       ----RVGSIAAARKEGRPTVPSQLSDEIATNPFLRAGEAALKAAVGMA-----DAE----
GLO2_RHOBL       ----RQGRLSEMRREGRLPMPWTLAEELATNPFLRAPLPQMKAAVGLP-----QAS----
GLO2_RHOCA       ----RMDRVTALRLAGEPSLPVTLGEERATNPFLRADDAALRAALGLPG----DAA----
GLO2_PELUB       ----KIKLIDEKLEKNLPTIPSTIKEELECNIFLRSGT----------------------
GLO2_BDEBA       ----YANELSNRRELNLPSVPLKLSIEESVNPFL-------------------LAR----
GLO2_PROM1       ----RLKLIQKKLQKGMSSLPSTLSEERKTNLFLIAEN----------------------
GLO2_PROMT       ----RLKLIQKKLQKGMSSLPSTLSEERKTNLFLIAEN----------------------
GLO2_PROMA       ----RLKEVILRKSKGFLSIPSKLSEERKTNLFIRASN----------------------
GLO2_PROMS       ----KLSEVEKKLSLNELTIPFLLDEEMKINLFLRAKN----------------------
GLO2_PROM0       ----KLSEVEKKLSLNKLTIPFLLDEEMKINLFLRAKN----------------------
GLO2_PROM9       ----KLLQVEKKLSINELTIPFLLDEEMKINLFLRAKN----------------------
GLO2_PROM3       ----RLVDVSSRRQRGALSLPSSISEEQRTNLFVRAQN----------------------
GLO2_PROMM       ----RLADVSSRRQRGALSLPSSISEEQRTNLFVRAQS----------------------
GLO2_SYNSC       ----RYREVRSLRAKGELSLPSSIGLERRTNLFMQASS----------------------
GLO2_SYNPX       ----RYDAVVDLRRRGELSLPSSIGEERRSNLFMRAAS----------------------
GLO2_SYNS9       ----RHQTVKALRSRGDLSLPSSIGAEKRTNLFMQAET----------------------
GLO2_SYNS3       ----RLRVVEATRRSGSLTLPSSIAEEWRSNLFLRATS----------------------
GLO2_SYNPW       ----RLEDVIALRTQHKLTIPSTLAEEHRSNLFLRAQS----------------------
GLO2_SYNP6       ----RYQAVAIARQQGQATIPSRLDIEKATNPFLRWDQAALQAAVSSQ-------D----
GLO2_SYNY3       ----RFQTVQGDRQRGQATIPSWLGTEKRTNPFLRWDNPAIQARVGMT-------E----
GLO2_POLSJ       -----LLPSVTDHDPAKSAVTT-LKDEKEFNTFLRLSSPSVIARLRES----FPDLPDEP
GLO2_NITOC       -----LLAEVKSQDPNHAFVST-LALEKEINTFFRLDNPTLITKLRET----FPDLPRVP
GLO2_LEPBJ       -----TLEECSRLSKNVEFLTTDLRKERKINTFFQCDKPSLELRKNVSKKIPFKQLLDN-
GLO2_LEPBL       -----TLEECSRLSKNVEFLTTDLRKERKINTFFQCDKPSLELRKNVSKKIPFKQLLDN-
GLO2_ANADE       ----RLAEVEAAHAAGLEPAPSTLAGERAVNPFLRLDAPGVAAAVARAEPSAAAAG----
                                        :  *   * :.                          

GLO2_FRATO       --REMFVKLRQLKNNF------------
GLO2_FRATH       --REMFVKLRQLKNNF------------
GLO2_FRATW       --REMFVKLRQLKNNF------------
GLO2_FRAT1       --REMFVKLRQLKNNF------------
GLO2_FRATT       --REMFVKLRQLKNNF------------
GLO2_FRATN       --REMFVKLRQLKNNF------------
GLO2_NEIG1       SGLEVFAALRELKNAYR-----------
GLO2_NEIMA       SGLEVFAALRELKNAYC-----------
GLO2_NEIMB       SSLDTFVALRELKNQYRTK---------
GLO2_NEIMF       SSLDTFVALRELKNQYRTK---------
GLO2_LEGPA       DSLDVFKVLRNQKNSFK-----------
GLO2_LEGPH       DSLDVFKVLRNQKNSFK-----------
GLO2_LEGPL       DSLDVFEVLRNQKNSFK-----------
GLO2_ACTP2       --LDQFIALRHQKDNF------------
GLO2_HAEDU       --LAEFITLRQQKDQY------------
GLO2_HAEIG       --LEEFTALRKAKDIF------------
GLO2_HAEIN       --LEEFTALRKAKDIF------------
GLO2_HAEI8       --LEEFTALRKAKDIF------------
GLO2_MANSM       --LADFIYLRKAKDNF------------
GLO2_HAES1       --LDEFIELRKAKDVF------------
GLO2_PASMU       --METFVAWRKAKDVF------------
GLO2_BAUCH       CEWLVFDYLRQKRDNFRGNSSQK-----
GLO2_SODGM       EEWRVFAALREKKDHF------------
GLO2_YERPE       SLVSVFCELRSRKDSF------------
GLO2_YERPA       SLVSVFCELRSRKDSF------------
GLO2_YERPN       SLVSVFCELRSRKDSF------------
GLO2_YERPP       SLVSVFCELRSRKDSF------------
GLO2_YERPS       SLVSVFCELRSRKDSF------------
GLO2_YERE8       SLVSVFSELRAQKDRF------------
GLO2_PHOLL       PLSAVFHQLRRQKDQF------------
GLO2_PECAS       ENWQVFKMLRSKKDCF------------
GLO2_ECOUT       QPEERFAWLRSKKDRF------------
GLO2_ECOK1       QPEERFAWLRSKKDRF------------
GLO2_ECOL5       QPEERFAWLRSKKDRF------------
GLO2_ECOL6       QPEERFAWLRSKKDRF------------
GLO2_ECOLI       QPEERFAWLRSKKDRF------------
GLO2_ECO57       QPEERFAWLRSKKDRF------------
GLO2_SHISS       QPEERFAWLRSKKDRF------------
GLO2_SHIDS       QPDERFAWLRSKKDRF------------
GLO2_SHIBS       QPEERFAWLRSKKDRF------------
GLO2_SHIFL       QPEERFAWLRSKKDRF------------
GLO2_SHIF8       QPEERFAWLRSKKDRF------------
GLO2_SALCH       QPEARFAWLRSKKDTF------------
GLO2_SALPA       QPEARFAWLRSKKDTF------------
GLO2_SALTY       QPEARFAWLRSKKDTF------------
GLO2_SALTI       QPEARFAWLRSKKDTF------------
GLO2_BUCAI       TDFEVFKRLRLKKDFWS-----------
GLO2_BUCAP       SSFEVFILLRKEKDDF------------
GLO2_WIGBR       EEWVLFKKLRDMKNNFIY----------
GLO2_BLOFL       EEWKILQALRNKKDLYLVKN--------
GLO2_BUCBP       FSLNFFIYLRKIKDKS------------
GLO21_VIBVY      NEFDAFVYLRKLKDKFNSI---------
GLO2_AERHH       NPEDTFTVLRSWKDVF------------
GLO2_RHOFT       E-VSIFAALRQWKNQF------------
GLO2_PSEPF       APSEVFAALRAWKDTF------------
GLO2_PHOPR       SDLETFAALRRWKDNF------------
GLO2_ALIF1       TEVEIFTALRRWKDEF------------
GLO2_VIBVU       DPLSVFTALREWKNEF------------
GLO22_VIBVY      DPLSVFTALREWKNEF------------
GLO2_VIBPA       DPCSVFTALREWKNEF------------
GLO2_VIBCH       DPLTIFTALREWKNEF------------
GLO2_PSEHT       EPWENFAGLRKFKDHF------------
GLO2_HYDCU       SVSTLFATLRAWKDELDQTNILEAGLND
GLO2_SACD2       TAADVFKHLRLWKDSF------------
GLO2_RHIEC       -NEEVFAEIRKRKDNF------------
GLO2_RHIL3       -NEEVFAEIRKRKDHF------------
GLO2_AGRFC       -DADVFAEIRTRKDNF------------
GLO2_RHIME       -DAAVFAEIRKRKDNF------------
GLO2_BRUAB       -DEAVFAEIRKRKDMF------------
GLO2_BRUO2       -DEAVFAEIRKRKDMF------------
GLO2_BRUA2       -DEAVFAEIRKRKDMF------------
GLO2_BRUME       -DEAVFAEIRKRKDMF------------
GLO2_BRUSU       -DEAVFAEIRKRKDMF------------
GLO2_OCHA4       -DEAVFAEIRKRKDMF------------
GLO2_CHESB       -DVEVFAEIRKRKDVF------------
GLO2_RHILO       -DAEVFAEIRKRKDNF------------
GLO2_MARMM       -DEEVFAEIRRRKDSF------------
GLO2_HYPNA       --AATFGEIRGRKDRF------------
GLO2_METCA       -EVEVFAEIRRRKDVFRG----------
GLO2_RHORT       -PVEVFARTRLKKDHF------------
GLO2_BRASB       -AEQVFGELRERKNKS------------
GLO2_BRASO       -AEEVFGELRERKNKS------------
GLO2_BRADU       -AAAVFGELRERKNKS------------
GLO2_NITHX       -GADVFGELRERKNKS------------
GLO2_NITWN       -GVEVFAELRERKNKS------------
GLO2_RHOP5       -PVAVFTELRERKNKS------------
GLO2_RHOPB       -AVEVFTELRERKNKS------------
GLO2_RHOPS       -AADVFGELRERKNNS------------
GLO2_RHOP2       -AADVFGELRERKNNS------------
GLO2_RHOPA       -AAEVFGEIRERKNNG------------
GLO2_ROSDO       -DSEVFAEIRARKDAF------------
GLO2_RUEPO       -PARVFAEIRARKDHF------------
GLO2_JANSC       -PVDVFTRIRAQKDSF------------
GLO2_RHOS4       -DAEVFAEIRRRKDKF------------
GLO2_RHOS1       -DAEVFAEIRRRKDKF------------
GLO2_RHOS5       -DAEVFAEIRRRKDNF------------
GLO2_RHOBL       -DTVVFAEIRARKDLF------------
GLO2_RHOCA       -PLAVFTAARARKDRF------------
GLO2_PELUB       --EENFSKLRDLKDNF------------
GLO2_BDEBA       -DVEQFRYLRELRNRQ------------
GLO2_PROM1       --VEKFTMLRKHKDRWKC----------
GLO2_PROMT       --VEKFTMLRKHKDRWKC----------
GLO2_PROMA       --QREFAQLRLHKDNWKS----------
GLO2_PROMS       --LEEFTFLRANKDLWV-----------
GLO2_PROM0       --LEEFTFLRANKDLWV-----------
GLO2_PROM9       --LKEFTFLRENKDLWV-----------
GLO2_PROM3       --SKELAELRQHKDQWRN----------
GLO2_PROMM       --SKELAELRHHKDQWRN----------
GLO2_SYNSC       --AAELGFLRSHKDQWRPT---------
GLO2_SYNPX       --AEELGRLRRHKDHWRAA---------
GLO2_SYNS9       --AEQLAELRSHKDHWRSS---------
GLO2_SYNS3       --SEELGRLRQHKDSWRG----------
GLO2_SYNPW       --AAELGRLRQLKDDWKGF---------
GLO2_SYNP6       -PVQTLARLRSRKDQF------------
GLO2_SYNY3       -PARVFGKLRGMKDNF------------
GLO2_POLSJ       DARTVFAKLRELRNQW------------
GLO2_NITOC       DPKTVFLKLRELRNKW------------
GLO2_LEPBJ       DPTSFFISLRSLRDQW------------
GLO2_LEPBL       DPTSFFISLRSLRDQW------------
GLO2_ANADE       -PARRFVALRALRDRA------------
                      :   *  ::