CLUSTAL format seed alignment for MF_01375

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PHNX_SALCH      -------------------------MMNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQA
PHNX_SALTY      --------------------------MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQA
PHNX_SALPA      --------------------------MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQA
PHNX_SALTI      --------------------------MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQA
PHNX_AERHH      ----------------MTDLQIAVDPTTDVEALILDWAGTVVDFGSFAPTSIFVEAFARA
PHNX_VIBVU      ------------------------MNKSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQG
PHNX_VIBVY      ------------------------MNKSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQG
PHNX_VIBPA      ------------------------MSNSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQG
PHNX_VIBCH      ------------------------MMNSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQG
PHNX_PSYIN      MNSTINNDINNDINNDINNDINNTQSNSPIEAVIFDWAGTIVDFGSFAPTTIFVESFQKE
PHNX_BORBR      -----------------MNAMTLATLPVRLEALVFDWAGTLVDFGSFAPTKVFVDAFAR-
PHNX_BORPA      -----------------MNAMTLATLPVRLEALVFDWAGTLVDFGSFAPTKVFVDAFAR-
PHNX_BORPE      -----------------MNAMTLATLPVRLEALVFDWAGTLVDFGSFAPTKVFVDAFAR-
PHNX_BORA1      -------------MPFFFSGYAMNALPVRLEAVIFDWAGTLVDFGSFAPTRVFVEAFAQ-
PHNX_PSEAE      ---------------------MNYNQPATLQAAILDWAGTVVDFGSFAPTQIFVEAFAE-
PHNX_PSEAB      ---------------------MNYNQPATLQAAILDWAGTVVDFGSFAPTQIFVEAFAE-
PHNX_PSEF5      ---------------------MNYSNPSQLQAAILDWAGTVVDFGSFAPTQIFVEAFAE-
PHNX_PSEPF      ---------------------MNYNNPTQLQAAILDWAGTVVDFGSFAPTQIFVEAFAE-
PHNX_PSEPK      ---------------------MNYNNPTQLQAAILDWAGTVVDFGSFAPTQIFVEAFAE-
PHNX_PARXL      --------------------------MKHVKAVIFDWAGTVVDYGSLAPMGAFVETFGQ-
PHNX_HAHCH      -----------------MSYAYQRFYRGPIEAVIFDWAGTTYDFGSMAPIRAFQNLFAE-
PHNX_BACAN      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHK-
PHNX_BACHK      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHK-
PHNX_BACCZ      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHK-
PHNX_BACAH      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFYK-
PHNX_BACC1      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHK-
PHNX_BACCE      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHK-
PHNX_BACCR      ---------------------------MKIEAVIFDWAGTTVDYGCFAPLEVFMKIFQK-
PHNX_SYNFM      ----------------MEIFVRNKPYTGPVKAVVLDWAGTTVDFGCMAPVTAFIEAFAL-
PHNX_BACFR      --------------------------MKKIECIIMDWAGTAVDYGCFAPVAAFIKAFAG-
PHNX_BACFN      --------------------------MKKIECIIMDWAGTAVDYGCFAPVAAFIKAFAG-
PHNX_LACPL      ---------------------------MTIKAVIFDWAGTTIDYGSRAPIVAFQKAFAN-
PHNX_LACSS      --------------------------MTDIQCVIFDWAGTIIDFGSLDPVLAFQSAFNA-
                                             :.. ::*****  *:*.  *   * . *   

PHNX_SALCH      FDVEITLAEARVPMGLGKWQHIEALGKLPAVDARWQAKFSRSMSAADIDAIYAAFMPLQI
PHNX_SALTY      FDVEITLAEARVPMGLGKWQHIEALGKLPAVDARWQAKFGRSMSAADIDAIYAAFMPLQI
PHNX_SALPA      FDVEITLAEARVPMGLGKWQHIEALGKLPAVDARWQAKFGRAMSAADIDAIYAAFMPLQI
PHNX_SALTI      FDVEITLAEARVPMGLGKWQHIEALGKLPTVDARWQAKFGRAMSAADIDAIYAAFMPLQI
PHNX_AERHH      YDFPVTLDEARQPMGLGKWDHIAALGRLPSVDARWQARFGHPMSHAEVDHLYHTFMPLQI
PHNX_VIBVU      FDFEIDLEEAREPMGLGKWDHIQAVGRIPAVDKRWNEKFGRSMISEDIDAIYAAFMPLQK
PHNX_VIBVY      FDFEIDLEEAREPMGLGKWDHIQAVGRIPAVDKRWNEKFGRSMISEDIDAIYAAFMPLQK
PHNX_VIBPA      FDFDIDLEEAREPMGLGKWDHIQAVGRIPAVDKRWNEKFGRSMTNEDIDAIYAAFMPLQK
PHNX_VIBCH      FDFEISLAEAREPMGLGKWQHIEAVGKLPTVAQRWQKQFGRPMQASDIDAIYAAFMPLQI
PHNX_PSYIN      YDFAITLQEARVPMGLGKWDHIQAVGKLPSVATRWQAQFGKAMDNADIDQIYNTFIPLQK
PHNX_BORBR      FGVQISLEQARGPMGMGKWDHIRALCNDAAIARQYQEQFGRLPTDEDVTAIYERFLPMQL
PHNX_BORPA      FGVQISLEQARGPMGMGKWDHIRALCNDAAIARQYQEQFGRLPTDEDVTAIYERFLPMQL
PHNX_BORPE      FGVQISLEQARGPMGMGKWDHIRALCNDAAIARQYQEQFGRLPTDEDVTAIYERFLPMQL
PHNX_BORA1      FGVALTLEQARGPMGMGKWDHIRALCDDPGIASQYQERFGALPDDAAVTAIYERFLPMQL
PHNX_PSEAE      FGVQVSLEEARGPMGMGKWDHIRTLCDIPAIAERYRAVFGRLPSDDDVTAIYERFMPLQI
PHNX_PSEAB      FGVQVSLEEARGPMGMGKWDHIRTLCDIPAIAERYRAVFGRLPSDDDVTAIYERFMPLQI
PHNX_PSEF5      FDVQVSIEEARGPMGMGKWDHIRTLCDLPEVAERYRKVFGRTPTDADVTAIYERFMPLQI
PHNX_PSEPF      FDVQVSIEEARGPMGMGKWDHIRTLCDQPQVAERYRKVFGRTPTDDDVTAIYNRFMPLQI
PHNX_PSEPK      FDVQVSIEEARGPMGMGKWDHIRTLCDVPEIAERYRKVFGRTPTDDDVTAIYNRFMPLQI
PHNX_PARXL      FGVPITIDEARGPMGMAKRPHIAALMALPRVAQAWTDKYGHAPDDADIDAVYDVFVPKNI
PHNX_HAHCH      QEIPITLAEAREPMGTEKREHITRILNMPRVREAWREKYGALASEADIERLYHAFVPMQI
PHNX_BACAN      RGVGITAEEARKPMGLLKIDHVRALTEMPRIANEWNRIFGQLPTETDIQEMYEEFEEILF
PHNX_BACHK      RGVGITAEEARKPMGLLKIDHVRALTEMPRIANEWNRIFGQLPTETDIQEMYEEFEEILF
PHNX_BACCZ      RGVGITAEEARKPMGLLKIDHVRALTEMPRIANEWNRIFGKLPTETDIQEMYEEFEEILF
PHNX_BACAH      RGVGITAEEARKPMGLLKIDHVRALTEMPRIANEWNRIFGQLPTETDIQEMYEEFEEILF
PHNX_BACC1      RGVVITAEEARKPMGLLKIDHVRALTEMPRIASEWNRVFGQLPTETDIQEMYEEFEEILF
PHNX_BACCE      RGVAITAEEARKPMGLLKIDHVRALTEMPRIASEWNRVFRQLPTEADIQEMYEEFEEILF
PHNX_BACCR      RGVEITAEEARKPMGLLKIDHVRALTEMPRIADEWKRVFGQLPTEADIHEMYEEFEEILF
PHNX_SYNFM      RGVEISASEVRGPMGLMKMDHVRALCGLPSVSERWRELFGRIPNEDDVRLVYGDTVPLMV
PHNX_BACFR      KGLTIDVEQTRKPMGLPKIQHIRELLTMPEVNEQFINRYRRAWTEEDVVELNHLFEKYLF
PHNX_BACFN      KGLTIDVEQTRKPMGLPKIQHIRELLTMPEVNEQFINRYRRAWTEEDVVELNHLFEKYLF
PHNX_LACPL      VGIQISEAEIRQDMGLDKYTHIHKIMDLPAIQNDWQARFQVLPTEDDCNQIFSNFKAILL
PHNX_LACSS      AGIQIDTDRIRQDMGIEKHEHIAKLAKMPEVQRAWFAKYKRGITDADQLQLFNYFEQFLL
                  . :   . *  **  *  *:  :   . :   :   :           :         

PHNX_SALCH      AKVVDFSSPIAGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAGHGYCPDHWVATDD
PHNX_SALTY      AKVVDFSSPIAGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAGHGYRPDHWVATDD
PHNX_SALPA      AKVVDFSSPIAGVIDTIATLRAEGIKIGSCSGYPRAVMERLVPAAAGHGYCPDHWVATDD
PHNX_SALTI      AKVVDFSSPIAGVIDTIATLRAEGIKIGSCSGYPRAVMERLVPAAAEHGYRPDHWVATDD
PHNX_AERHH      AAVTRFADPIPGVLPVLDALRGQGMKIGSCSGYPRPVMETLVPAAADHGYRPDHWVATDD
PHNX_VIBVU      AKVADHAEPILNAIEVVNGLKDKGIKIGSCSGYPREVMDVLIPVAADYGYQPDYVVATDD
PHNX_VIBVY      AKVADHAEPILNAIEVVNGLKDKGIKIGSCSGYPREVMDVLIPVAADYGYQPDYVVATDD
PHNX_VIBPA      AKVADHAEPILNAVEVVNGLKDKGIKIGSCSGYPREVMDVLIPVAADYGYQPDYVVATDD
PHNX_VIBCH      AKVADHAAPIPHSLEVVEQIRSRGIKIGSCSGYPRQVMDVLIAAAADYGYRPDYVVATDD
PHNX_PSYIN      VKVVDHADPILNAINVVNDLKKQGIKIGSCSGYPRAVMDVLIPAAAENGYLPDCVVATDD
PHNX_BORBR      EKVAEYSQPIPGAIELLHGLRQRGLKLGSCSGYPAAVMQRVLERAEREGLALDYVVASDD
PHNX_BORPA      EKVAEYSQPIPGAIELLHGLRQRGLKLGSCSGYPAAVMQRVLERAEREGLALDYVVASDD
PHNX_BORPE      EKVAEYSQPIPGAIELLHGLRQRGLKLGSCSGYPAAVMQRVLERAEREGLALDYVVASDD
PHNX_BORA1      EKVAEYSDVIPGALQTLREIRERGLKVGSCSGYPASVMRRVLERALAGGLEIATVVASDQ
PHNX_PSEAE      EKIAEHSALIPGALQAIAELRGMGLKIGSCSGYPAVVMEKVVALAETNGYVADHVVATDE
PHNX_PSEAB      EKIAEHSALIPGALQAIAELRGMGLKIGSCSGYPAVVMEKVVALAETNGYVADHVVATDE
PHNX_PSEF5      EKIAEHSALIPGALEVIAKLRGQGIKIGSCSGYPKQVMDKVVTLAATNGYTADHVVATDE
PHNX_PSEPF      EKIAEHSALIPGALETIANLRQQGIKIGSCSGYPKQVMDKVVALAATNGYVADHVVATDE
PHNX_PSEPK      EKIAVHSALIPGALDTLTGLRQDGLKIGSCSGYPKVVMDKVVELAAQNGYVADHVVATDE
PHNX_PARXL      AVAASYSSVIPGVADVASALRGDDIRIGTTTGYTREIMAEIVPGAAAQGFSPDSIVCTGD
PHNX_HAHCH      EAIRECARPVPGLMETVAWLERRNIKIGANTGYNRDMLDVLTDIAAAQGYRPASNVCATD
PHNX_BACAN      AILPRYASPIHGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDD
PHNX_BACHK      AILPRYASPIHGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDD
PHNX_BACCZ      AILPRYASPIHGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDD
PHNX_BACAH      AILPRYASPIHGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDD
PHNX_BACC1      TILPRYASPIHGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDD
PHNX_BACCE      AILPRYASPINGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDD
PHNX_BACCR      SILPSYATPIDGVKEVIASLRERGIKIGSTTGYTREMMEIVAKEAALQGYKPDFLVTPDD
PHNX_SYNFM      LSVADHAELIPGLLPAIGYFRGNGIKIGTSTGYTTPMMEVLLPRAEKRGYRPDSVVCSSD
PHNX_BACFR      ASLKEYTDPIPGVIPTLEKLRAEGLKIGSTTGYTREMMDVVLPEAQAKGYRVDYCATPNL
PHNX_BACFN      ASLKEYTDPIPGVIPTLEKLRAEGLKIGSTTGYTREMMDVVLPEAQAKGYRVDYCATPNL
PHNX_LACPL      SSLTEFGQLKPGMSAVIDYLTAHNISYGTTTGYDAEMLALVLPIAAKQGYRPAVNITSEQ
PHNX_LACSS      NRLSTETTLTPAVLQVQTYLKAHHIHIATTTGYTKAMLAIAAKQAGLLGYHPELMVSKED
                                   :    :  .: :**   ::      *   *           

PHNX_SALCH      LAAGGRPGPWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGAT
PHNX_SALTY      LAAGGRPGPWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGAT
PHNX_SALPA      LAAGGRPGPWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGAT
PHNX_SALTI      LVAGGRPGPWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGAT
PHNX_AERHH      LKAGGRPGPWMALANVIELGVNAVHRCIKVDDAVPGISEGLNAGMWTVGLSVSGNEFGAT
PHNX_VIBVU      LPQGGRPAPFMALKNVIELGVSDVKACVKVDDSAPGIFEGHNAGMWTVGLLLSGNEAGLT
PHNX_VIBVY      LPQGGRPAPFMALKNVIELGVSDVKACVKVDDSAPGIFEGHNAGMWTVGLLLSGNEAGLT
PHNX_VIBPA      LPQGGRPAPFMALKNVIELDVTDVKACVKVDDSAPGIFEGHNAGMWTVGLLLSGNEAGLT
PHNX_VIBCH      LAQGGRPAPFMALKNVIELGVTDVRACVKVDDALPGIEEGHNAGMWTVGLLLSGNEAGLT
PHNX_PSYIN      LPYGGRPAPHMALKNVIELGVNSVTNCIKVDDSTPGIEEGHNAGMWTVALLLSGNEAGLT
PHNX_BORBR      VPRS-RPAPAMALRNVVELGIADVAGCVKVDDTAPGVEEGRRAGMWTVGLLLSGNAAGLS
PHNX_BORPA      VPRS-RPAPAMALRNVVELGIADVAGCVKVDDTAPGVEEGRRAGMWTVGLLLSGNAAGLS
PHNX_BORPE      VPRS-RPAPAMALRNVVELGIADVAGCVKVDDTAPGVEEGRRAGMWTVGLLLSGNAAGLS
PHNX_BORA1      VPRA-RPAPAMALKNAVELGVADVAACVKVDDTGVGIEEGRRAGMWSVGLLLSGNAAGLT
PHNX_PSEAE      VPNG-RPWPAQALANVIALGIDDVAACVKVDDTWPGILEGRRAGMWTVALTCSGNALGLT
PHNX_PSEAB      VPNG-RPWPAQALANVIALGIDDVAACVKVDDTWPGILEGRRAGMWTVALTCSGNALGLT
PHNX_PSEF5      VPNG-RPWPAQALANVIALGIDDVAACVKIDDTVPGILEGRRAGMWTVALTCSGNALGLT
PHNX_PSEPF      VPNG-RPWPAQALANVIALGIDDVAACVKIDDTVPGILEGRRAGMWTVALICSGNALGLD
PHNX_PSEPK      TPNG-RPWPAQALANVIALGIDDVAACVKVDDTVPGILEGRRAGMWTVALVCSGNALGLT
PHNX_PARXL      TAEG-RPSPYMIYRTLPELGVWRAKEAIKVDDTEVGIEEGINGGTWTVGVSVSGNAFGMA
PHNX_HAHCH      VPKG-RPYPHMSLKNALELGVGDVRACIKVDDTLPGIEEGLAAGMWTVGVTTSGNEVGLS
PHNX_BACAN      VPAG-RPYPWMCYKNAMELGVYPMNHMIKIGDTVSDMKEGRNAGMWTVGVILGSSELGLS
PHNX_BACHK      VPAG-RPYPWMCYKNAMELGVYPMNHMIKIGDTVSDMKEGRNAGMWTVGVILGSSELGLS
PHNX_BACCZ      VPAG-RPYPWMCYKNAMELGVYPMNHMIKIGDTVSDMKEGRNAGMWTVGVILGSSELGLS
PHNX_BACAH      VPAG-RPYPWMCYKNAMELGVYPMNHMIKIGDTVSDMKEGRNAGMWTVGVILGSSELGLS
PHNX_BACC1      VPAG-RPYPWMCYKNAMELGVYPMNHMIKIGDTVSDMKEGRNAGMWTVGVILGSSELGLS
PHNX_BACCE      VPAG-RPYPWMCYKNAMELGVYPMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGLT
PHNX_BACCR      VPAG-RPYPWMCYKNAMELGVYPMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGLT
PHNX_SYNFM      VPRG-RPFPFMCYRNAIDLEVYPLEAVVKIGDTVSDIREGLNAGMWTIGVSKSGSDLGLT
PHNX_BACFR      -LPAGRPAPYMIFENLTKLAVPDPDTVVKVGDTIADIQEGVHAKVWSVGVVLGSNEMALT
PHNX_BACFN      -LPAGRPAPYMIFENLTKLAVPDPDTVVKVGDTIADIQEGVHAKVWSVGVVLGSNEMALT
PHNX_LACPL      TGGVGRPAPAMLALAAEQLTVTDPTTVMKIGDSVNDILEGNNADAVSVGIIDGSNIMGLS
PHNX_LACSS      -VAAGRPAPDMINHIMTAFNITDPQTVVKVGDTVIDMQEGKNAGVLTVGLIESSSLLGLS
                     ** *         : :      :*:.*:  .: **  .   ::.:  ...  .  

PHNX_SALCH      WDAYQTMSKEDVAVRREHAASKLYAAGAHYVVDSLADLPEVIAHINARLAQGERL-----
PHNX_SALTY      WDAYQTMSKEDVAVRREHAASKLYAAGAHYVVDSLADLPGVIAHINARLAQGERP-----
PHNX_SALPA      WDAYQTMSKEDVAVRREHAASKLYAAGAHYVVDSLADLPGVIAHINARLAQGERP-----
PHNX_SALTI      WDAYQTMSKEDVAVRREHAASKLYAAGAHYVVDSLADLPEVIAHINARLAQGERP-----
PHNX_AERHH      WEAFAAMSEAEIAARRAPAEAKLRAAGAHYVIDTLADIAPVIADINRRLAAGERP-----
PHNX_VIBVU      FEEYQAADEATLEKAREKARAKLLKSSPHYLIDTIADFPEVVADIERRLAAGERP-----
PHNX_VIBVY      FEEYQAADEATLEKAREKARAKLLKSSPHYLIDTIADFPEVVADIERRLAAGERP-----
PHNX_VIBPA      FEEYQAADEATLEKAREKARAKFIKSAPHYLIDTISDLPEVIVDIEQRLAAGERP-----
PHNX_VIBCH      LEEYQHADDQTLQAARERAQAKLQQAKPHYLIDTVADLPAVLAQIEQRLLAGERP-----
PHNX_PSYIN      AQEYQQASVQTLNKAREKARLIMKKSNPHYLIDTINDLPAVIKEIELRLIKGERP-----
PHNX_BORBR      LEQFLSLDEAGREAARDRARAELQAGAPHYLIDTVADLPPVLADIETRLAAGQRP-----
PHNX_BORPA      LEQFLSLDEAGREAARDRARAELQAGAPHYLIDTVADLPPVLADIETRLAAGQRP-----
PHNX_BORPE      LEQFLSLDEAGREAARDRARAELQAGAPHYLIDTVADLPPVLADIETRLAAGQRP-----
PHNX_BORA1      RDAYQALDEVGREAARARARQAFASAEPHYFIDTIADLPSVLSDIEARLASAERP-----
PHNX_PSEAE      YEQYQALPAAELERERTRIEQMFEGSRPHYLIETIAELPAVVRDINARLARGEMPQGN--
PHNX_PSEAB      YEQYKALPAAELERERTRIEQMFEGSRPHYLIETIAELPAVVRDINARLARGEMPQGN--
PHNX_PSEF5      YEGYRALASDTLASERKRIHKLFEASRPHYLIDTIADLPQVIADINQRLARGEMPQGN--
PHNX_PSEPF      YEGYRALGSDALASERKRIHALFEGSRPHYMIDTITDLPEVIADINKRLANGEMPQSS--
PHNX_PSEPK      WEGFRALSAEKLESERQRIHALFAGSRPHYLIDTINDLPEVIADINRRLAKGEMPQAF--
PHNX_PARXL      EGDVKALAPDEFAWRRNAAIQKLQAAGAHYVIDSVADLMPVVYDIEARLARGERP-----
PHNX_HAHCH      QEDWTALDSASKTVLREQAQERFRRGGAHVIIGSVADLPAAVEYIERWLAQGHGPDTTGL
PHNX_BACAN      EEEVENMDPAELREKIEVVRNRFVENGAHFTIETMQELESVMERIEKQELIIS-------
PHNX_BACHK      EEEVENMDPAELREKIEVVRNRFVENGAHFTIETMQELESVMERIEKQELIIS-------
PHNX_BACCZ      EEEVENMDPAELREKIEVVRNRFVENGAHFTIETMQELESVMERIEKQELIIS-------
PHNX_BACAH      EEEVENMDSAELREKIEVVRNRFVENGAHFTIETMQELESVMERIEKQELIIS-------
PHNX_BACC1      EEEVENMDPVELREKIEVVRNRFVENGAHFTIETMQELETVMEHIEKQQLIIS-------
PHNX_BACCE      EEEVENMDSVELREKIEVVRNRFVENGAHFTIETMQELESVMEHIEKQELIIS-------
PHNX_BACCR      QYEVESMDSVELREKIEIVRNRFAENGAHSTIETMQELENVMEHIEKQELIIS-------
PHNX_SYNFM      EAELDALPADDLRNRLALVESRFLEAGAHFVVEHIGRCPEIIEEINDLLSQGEVP-----
PHNX_BACFR      EEETHALPAAELENRIAEVKQRMLAAGASYVIRSIEELPALIQLINSKLNH---------
PHNX_BACFN      EEETHALPAAELENRIAEVKQRMLAAGASYVIRSIEELPALIQLINSKLNH---------
PHNX_LACPL      ELAFNALSPAEQAERRAHVTAAYQRAGADYILQSMAELPALLDQINQPVATDH-------
PHNX_LACSS      QAKLIDLPQKTRLAKFAEITKTLKAAGADYVIHNLSELPAILAKYQTPQKEHA-------
                                           .   :  :      :   :              

PHNX_SALCH      -------------
PHNX_SALTY      -------------
PHNX_SALPA      -------------
PHNX_SALTI      -------------
PHNX_AERHH      -------------
PHNX_VIBVU      -------------
PHNX_VIBVY      -------------
PHNX_VIBPA      -------------
PHNX_VIBCH      -------------
PHNX_PSYIN      -------------
PHNX_BORBR      -------------
PHNX_BORPA      -------------
PHNX_BORPE      -------------
PHNX_BORA1      -------------
PHNX_PSEAE      -------------
PHNX_PSEAB      -------------
PHNX_PSEF5      -------------
PHNX_PSEPF      -------------
PHNX_PSEPK      -------------
PHNX_PARXL      -------------
PHNX_HAHCH      AGVTLTAAGVSLR
PHNX_BACAN      -------------
PHNX_BACHK      -------------
PHNX_BACCZ      -------------
PHNX_BACAH      -------------
PHNX_BACC1      -------------
PHNX_BACCE      -------------
PHNX_BACCR      -------------
PHNX_SYNFM      -------------
PHNX_BACFR      -------------
PHNX_BACFN      -------------
PHNX_LACPL      -------------
PHNX_LACSS      -------------