CLUSTAL format seed alignment for MF_01376

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PHNW_BURM7       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURMS       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURM9       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURMA       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURPS       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURP0       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURP1       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURP6       -------MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURTA       -------MPERDPILLTPGPLTTSRMTRDAMLHDWGSWDAAFN-RLTKSVCADLVRIAGG
PHNW_BURCA       -------MP--APILLTPGPLTTSATTRHAMQHDWGSWDAAFN-QLTASVCADLVAIAHG
PHNW1_BURL3      -------MP--DPILLTPGPLTTSATTRHAMQHDWGSWDAAFN-QLTASVCADLVAIAHG
PHNW2_PARXL      ------MIPGNDPILLTPGPLTTSLRTREAMLRDWGSWDAAFN-RMTHGVCADLLKIVHG
PHNW2_BURL3      ------MTLAAQPILLTPGPLTTSDTTRDAMLRDWGSWDSDFN-AITARLRERLLQIVHG
PHNW2_CUPPJ      ------MTATPYPILLTPGPLTTSDRTRAAMLRDWGSWDTDFN-AITARIRQQVLAIVHG
PHNW1_POLSJ      --------MTTDAILLTPGPLTTSSRTKQSMLRDWGSWDTDFN-AITARLRQGLLRIVHG
PHNW_PSEAE       -----MSTAERAPILLTPGPLTTSYRTRRAMMVDWGSWDSDFN-ELTASVCQRLLKIVGG
PHNW_PSEAB       -----MSTAERAPILLTPGPLTTSYRTRRAMMVDWGSWDSDFN-ELTASVCQRLLKIVGG
PHNW_PSEP1       --------MSNAPILLTPGPLTTSIRTRQAMLVDWGSWDRDFN-QLTASVCEQLLAIIDG
PHNW_PSEPK       --------MSNAPILLTPGPLTTSIRTRQAMLVDWGSWDRDFN-QLTASVCEQLLAIIDG
PHNW_PSEPG       --------MSNAPILLTPGPLTTSIRTRQAMLVDWGSWDRDFN-QLTASVCEQLLAIIDG
PHNW_PSEE4       --------MSNAPILLTPGPLTTSTRTRQAMLVDWGSWDRDFN-QLTASVCEQLLAIIDG
PHNW_PSEF5       -------MSIAEPILLTPGPLTTSARTRQAMLVDWGSWDDRFN-QLTASLCQQLLAIIQG
PHNW_PSEPF       -------MSTAAPILLTPGPLTTSARTRQAMMVDWGSWDDRFN-QLTASLCEQLLAILNG
PHNW2_POLSJ      --------MDRDKILLTPGPLTTTLRTKLAMLKDWGSWDTDFN-AVTASVRRSLLDIIHG
PHNW_CUPNH       ------MIRGNDPILLTPGPLTTSLATKQAMLRDWGSWDAAFN-AITRSLCDDLVRIVHG
PHNW1_CUPPJ      ------MIRGNDPILLTPGPLTTSLATKQAMLRDWGSWDAAFN-AITGSLCEDLVRIVHG
PHNW1_PARXL      ---MQPRRGEP--YLLTPGPLTTAFSTKEAMLRDWGSWDGDFR-AMTALLRSSLLEIAGD
PHNW_RHIME       -------MGEP--YLLTPGPLTTAFSVKDAMLRDWGSWDGDFR-GMTAELRRELLAIAGD
PHNW_HAHCH       -------MNQPNYYLLTPGPITTSRTVKEAMLNDWGSWDQDFN-QVTQTVRDKLLAVANS
PHNW_BACAN       -------MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYN-TMVQKVRAKLVSLATK
PHNW_BACHK       -------MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYN-TMVQKVRAKLVSLATK
PHNW_BACCZ       -------MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYN-TMVQKVRAKLVSLATK
PHNW_BACAH       -------MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYN-MMVQKVRAKLVSLATK
PHNW_BACC1       -------MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYN-TMVQDVRAKLVSLATK
PHNW_BACCR       -------MNENHYLLLTPGPLTTTKSVKEVMLYDWCTWDDEYN-TMVQEVRAKLVSLATK
PHNW_BACCN       -------MKNHHYLLLTPGPLTTTKTVKEVMLYDWCTWDTEYN-ELVQEIRKRLVSLATK
PHNXW_CLOD6      ------<VPENDYILLTPGPLSTTKSVRASMLKDWCTWDVEYN-NLVQDVRRRLVSLATQ
PHNW_BACFR       ---------MKPYLLLTPGPLTTSETVKETMMTDWCTWDEDYNLHIVEALRKELVGIATR
PHNW_BACFN       ---------MKPYLLLTPGPLTTSETVKETMMTDWCTWDEDYNLHIVESLRKELVGIATR
PHNW_BACV8       ---------MRPYLLLTPGPLTTSESVKTAMMTDWCTWDEDYNVHIVEEIRKGLVQLATR
PHNW_SALPA       -------MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATA
PHNW_SALTY       -------MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATA
PHNW_SALPB       -------MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTELATA
PHNW_SALTI       -------MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATA
PHNW_SALCH       -------MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATA
PHNW_KLEP7       -------MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNLGVVQTIRQQLVQLATP
PHNW_AERHH       MTHIPAAPAAVDYLLLTPGPLSTTATVRAAMLQDSCTWDADYNQGVVEPIRRELVRLAAG
PHNW_VIBCH       --------MKNAYLLLTPGPLSTSESVREAMLKDWCTWDDDYNLEIVEVIRRKLVTLATT
PHNW_VIBC3       --------MKNAYLLLTPGPLSTSESVREAMLKDWCTWDDDYNLEIVEVIRRKLVTLATT
PHNW_VIBPA       --------MKNEYLLLTPGPLSTSETVREAMLKDWCTWDDEYNKDIVEVIRTKLVKLATK
PHNW_VIBVY       --------MKNEYLLLTPGPLSTSETVREAMLKDWCTWDDEYNKDIVEVIRTKLVKLATK
PHNW_VIBVU       --------MKNEYLLLTPGPLSTSETVREAMLKDWCTWDDEYNKDIVEVIRTKLVKLATQ
PHNW_PSYIN       --------MNNEYLLLTPGPLSTSKTVRNAMLKDWCTWDDQYNKEIVEVIRDKLVKLATT
PHNW_SYNFM       --MAPRSFPENPYILLTPGPLSTSPTVKAVMMRDWCTWDRDYN-AIVQDIRERLVALATA
PHNW_LACPL       --------MKQPYLLLTPGPLSTTASVKDAMQIDYCTWDSDYR-HVTETIRQQILAMAQA
PHNW_LYSSC       ---------MSNYKLLTPGPLTTTKTVKQEMLKDRCTWDDDYK-NVTQVIRKQLLNLAQV
                               ******::*:  .:  *  *  :**  :.  :.  :   :  :   

PHNW_BURM7       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURMS       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURM9       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURMA       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURPS       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURP0       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURP1       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGIAH
PHNW_BURP6       GD---AYVCVPLQGSGTFAVEATLGTLVP---RDARVLVPNNGAYCARIAAILRRLGVAH
PHNW_BURTA       GD---AYVCVPLQGSGTFAVEAALGTLVP---RDGRVLVPNNGAYCARIAKILRRLGIAH
PHNW_BURCA       GD---EYVCVPMQGSGTFSVEAALGTLVP---RDGVVLVPDNGAYCARILKILGRLGIDA
PHNW1_BURL3      GD---EYVCVPMQGSGTFSVEAALGTLVP---RDGVVLVPDNGAYCARILKILGRLGIEA
PHNW2_PARXL      EN---DYVCVPLQGSGTFAVEAALGTLVP---RQGCVLVPNNGAYCARLIRILQRMGIAY
PHNW2_BURL3      EG---THECVPLQGSGTFSVEAAIGTLVP---RDGHVLVPNNGAYCQRIAKICRVLGRQL
PHNW2_CUPPJ      DD---THECVPLQGSGTFSVEAAIGTLVP---RDGHVLVPVNGAYCQRIAKICKTLGRRL
PHNW1_POLSJ      EG---THECVPLQGSGTFSVEAAIGTLVPPGEKGGHVLVPVNGAYCQRIAKICKVLGRKL
PHNW_PSEAE       EG---SHTCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGKRLAKICEVLQRPF
PHNW_PSEAB       EG---SHTCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGKRLAKICEVLQRPF
PHNW_PSEP1       AS---SHHCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGQRLAKICKVLGRTY
PHNW_PSEPK       AS---SHHCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGQRLAKICKVLGRTY
PHNW_PSEPG       SA---SHHCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGQRLAKICKVLGRPY
PHNW_PSEE4       SA---SHHCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGQRLAKICKVLGRTF
PHNW_PSEF5       AD---SHHCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGKRLAKICEVLGRDF
PHNW_PSEPF       AD---SHHCVPLQGSGTFAVEAAIGTLVP---RDGKVLVLINGAYGKRLAKICEVLGRSF
PHNW2_POLSJ      HD---SHVVVPLQGSGTFSVEAAVATLVP---HDGHVLVLDNGAYCKRAVRLTQLMGRRC
PHNW_CUPNH       EG---THVCVPMQGSGTFSVEAAIANVVP---RDGKVLVPQNGAYCQRILKICKVLGRAS
PHNW1_CUPPJ      EG---THVCVPMQGSGTFSVEAAIANVVP---RDGKVLVPQNGAYCQRILKICKVLGRAH
PHNW1_PARXL      TAG--EYDCVPLQGSGSYCVEAMLGSLIP---RDAHALVLANGAYGKRIVTTLGYLGRAC
PHNW_RHIME       ESG--QYDCVPMQGSGSFSVEAMLGSFIP---RDGKVLVLMNGAYGQRIAQTLKYLGRAH
PHNW_HAHCH       QD---THVCVPLQGSGTFAVEATLGTLLG---PQDKLLVLMNGAYGQRIANICDYLKRPY
PHNW_BACAN       EE--EKYTTVLMQGSGTFSVEAVIGSVIP--KNG-KLLVCTNGAYGKRIVQMAEMLHIDV
PHNW_BACHK       EE--EKYTTVLMQGSGTFSVEAVIGSVIP--KNG-KLLVCTNGAYGKRIVQMAEMLHIDV
PHNW_BACCZ       EE--EKYTTVLMQGSGTFSVEAVIGSVIP--KNG-KLLVCTNGAYGKRIVQMAEMLHIDV
PHNW_BACAH       EE--EKYTTVLMQGSGTFSVEAVIGSVIP--KNG-KLLVCTNGAYGKRIVQMAEMLHIDV
PHNW_BACC1       EE--EKYTTVLMQGSGTFSVEAVIGSVIP--KNG-KLLVCTNGAYGKRIVQMAEMLHIDV
PHNW_BACCR       EE--EKYTTVLMQGSGTFSVEAVIGSVIP--ANG-KLLVCTNGAYGKRIVQMAEMLQIDV
PHNW_BACCN       EE--EYYTTVFMQGSGTFSVESVIGSVIP--QEG-KLLVCTNGAYGKRIVQIATTLHINV
PHNXW_CLOD6      NT--DKYTSVLMQGSGTFSVEAIIGSTIS--KDG-KLLVIANGAYGKRMKDICNYLNIQF
PHNW_BACFR       NT--EEYTSVLLQGSGTYCVEAVIGAAIG--KND-KLLICSNGAYGDRMGNIAEYYHIDY
PHNW_BACFN       NT--EEYTSVLLQGSGTYCVEAVIGAAIG--KND-KLLICSNGAYGDRMGNIAEYYHIDY
PHNW_BACV8       KT--DEYTSILMQGSGTYCVEATLGSVIT--PKH-KLLILSNGAYGDRMGNIAEYHEMNY
PHNW_SALPA       SE---GYTSVLLQGSGSYAVEAVLGSALG--PQD-KVLIVSNGAYGARMVEMAGLMGIAH
PHNW_SALTY       SE---GYTSVLLQGSGSYAVEAVLGSALG--PQD-KVLIVSNGAYGARMVEMAGLMGIAH
PHNW_SALPB       SE---GYTSVLLQGSGSYAVEAVLGSALG--PQD-KVLIVSNGAYGARMVEMAGLMGIAH
PHNW_SALTI       SE---GYTSVLLQGSGSYAVEAVLGSALG--PQD-KVLIVSNGAYGARMVEMAGLMGIAH
PHNW_SALCH       SE---GYTSVLLQGSGSYAVEAVLGSALG--PQD-KVLIVSNGAYGARMVEMAGLMGIAH
PHNW_KLEP7       AD---GYTAVLLQGSGSYAVEAVLGSVIG--EQG-KVLIVSNGAYGARMIEMAQLMGIAC
PHNW_AERHH       PEYQSDYSAVLLQGSGSYVVESVLGSAIG--VDE-CLLIINNGAYGARMGEMARCLGLRH
PHNW_VIBCH       QS---GYTSVLMQGSGTASVEATIGSVML--PTD-KLLVIDNGAYGARIAQIAQYLNIAC
PHNW_VIBC3       QS---GYTSVLMQGSGTASVEATIGSVML--PTD-KLLVIDNGAYGARIAQIAQYLNIAC
PHNW_VIBPA       HS---GYTSVLMQGCGTASVEATIGSAIG--KEG-KLLVVDNGAYGARIAQIADYLNIPC
PHNW_VIBVY       HS---GYTSVLMQGSGTASVEATIGSAIG--KEG-KLLVVDNGAYGARIAQIAAYLNIPC
PHNW_VIBVU       QD---GYTSVLMQGSGTASVEATIGSAIA--KEG-KLLVVDNGAYGARIAQIADYLNIPC
PHNW_PSYIN       QK---NYTCVLMQGSGTASVEATIGSVID--KQG-KLLVIDNGSYGARMAEIAHYLALDC
PHNW_SYNFM       GA---GYTSVLMQGSGTFAVEAALGTALP--HDG-KLLVISNGHYGDRMALIAGYLGMRS
PHNW_LACPL       NP--ENYTTVLLQGSGSFGVEATIGTAVP--RTDATLMIAINGAYGHRISQIAEYYDIPH
PHNW_LYSSC       DE--PHYTAVLMQGSGSFVVESVLTTAVG--EDD-KLLIITNGAYGERIVEMAKVLRLAL
                       :  : :**.*:  **: :   :         ::  ** *  *            

PHNW_BURM7       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIV
PHNW_BURMS       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIV
PHNW_BURM9       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIV
PHNW_BURMA       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIV
PHNW_BURPS       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIV
PHNW_BURP0       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGKALIV
PHNW_BURP1       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGKALIV
PHNW_BURP6       VELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGKALIV
PHNW_BURTA       SELPFAEDEPASAQAIDAALARDARITHVALVHLETSAGLLNPLDDIAAVCRARGKALIV
PHNW_BURCA       IALPFGEDAAVDAAAVEAAFAREPRITHVALVHLETSAGILNPLDAIAAACRRHGKRLIV
PHNW1_BURL3      IALPFGEDAAVDPAAIEAAFAREPRITHVAQVHLETSAGVLNPLDDIAAVCRRHGKRLIV
PHNW2_PARXL      IELVLREDEPVSAAAVEDAFNRHSRISHVAHVHLETSAGLLNPLDDIAAVCQRHGKSLIV
PHNW2_BURL3      TTIDYSEDRRVDPADVERALAADPTITHVALVHCETGAGVLNPLHDIAQVVAKHGRALIV
PHNW2_CUPPJ      STIDYAEDRPMRAADIDRQLAADSTITHVAVVHCETGTGVLNPLDEIAQVVARHGRGLIV
PHNW1_POLSJ      TTFEYAEDAQIRPEDIDRLLAKDPSITHVALVHCETSTGILNPLHEIALVVQRHGKGLIV
PHNW_PSEAE       STLETEENVPTTAADVERLLAADPAISHVALIHCETSTGILNPLEAIAKVVERHGKRLIV
PHNW_PSEAB       STFETEENVPTTAADVERLLAADPAISHVALIHCETSTGILNPLEAIAKVVERHGKRLIV
PHNW_PSEP1       STFETAEDQPTTAADVDRLLAEDSAITHVALIHCETSTGILNPLPEIAQVIKHHGKRLII
PHNW_PSEPK       STFETAEDQPTTAADVDRLLAEDPAITHVALIHCETSTGILNPLPEIAQVIKRHGKRLII
PHNW_PSEPG       STFETAEDQPTTAADVDRLLAADPAVTHVALIHCETSTGILNPLPEIAQVIKRHGKRLII
PHNW_PSEE4       STFETAEDQPTTAEDVDRLLAADPAVTHVALIHCETSTGILNPLPEIAQVIQRHGKRLII
PHNW_PSEF5       STFETAEDQPTTAADVERLLQADSSISHVALIHCETSTGILNPLPEIAQVVASHGKRLII
PHNW_PSEPF       STFETAEDEPTTAADVDRLLCADSDITHVALIHCETSTGILNPLPEIAQVVEQHGKRLII
PHNW2_POLSJ      TVLPFDEAAPVSAAALADQLKADASISHVILIHCETGAGVLNPLQEVADVCAAHGKGLIV
PHNW_CUPNH       VELPIPEDQPATAALIEEAIRRDPSITHVAQVHCETGAGVLNPLQEIAALCQRLGKGLIV
PHNW1_CUPPJ      VELPIPEDRPATAAAIEAALKKDPSITHVAQVHCETGAGVLNPLPEIAAVCARLGKGLIV
PHNW1_PARXL      TVLDKGDYLPPRGAEIERMLDDDPRITHVVAVHCETSSGILNPIEEIAAATAKKGRKLLI
PHNW_RHIME       VSIDKGDYMPPRGSEVAAALDADPAITHVVVVHCETSSGILNPLKEISEAVYSRGRKLLV
PHNW_HAHCH       VCIDTGDYLPPDPNAVAELLRQDASITTVAVVHCETSSGILNPVEAIAEVVNGAGRKLII
PHNW_BACAN       VVSQTEEWEPTNIVEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQYGKVTLV
PHNW_BACHK       VVSQTEEWEPTNIVEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQYGKVTLV
PHNW_BACCZ       VVSQTEEWEPTNIVEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQYGKVTLV
PHNW_BACAH       VVSQTEEWEPTNIVEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQYGKVTLV
PHNW_BACC1       VVSQTEEWEPTNVVEVEKILQQDKEITHIAIVHCETTTGIINPIVDVCKLGKQYGKVTLV
PHNW_BACCR       VISQTEEWEPTNIVEVEKLLQEDKEITHIAVVHCETTTGIINPIVDVCKLGQQYGKVTIV
PHNW_BACCN       VESYTNEWEPTNLAEVEEILQKDSEITHIAVVHCETTTGIINPIADVCRLGKQYGKVTIV
PHNXW_CLOD6      VDCTFKDIEAVDLNVVENLLKENKDITHISMVHCETTTGRLNPIQEVGKLAKEYNKIYIV
PHNW_BACFR       ELLAFDETEQVSVDYVDDYLSNNSDVTHVAFVHCETTTGILNPLKELAHVVKMHGKKLIV
PHNW_BACFN       ELLAFDETEQVSVDYVDDYLSNNSDVTHVAFVHCETTTGILNPLKELAHVVKMPGKKLIV
PHNW_BACV8       DMLAFDETEQVSVEYVDDYLAHNAEITHVAVVHCETTTGILNPLKEIAHMVKMHGKKLIV
PHNW_SALPA       HAYDCGEVARPDVQAIDAILNVDPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIV
PHNW_SALTY       HAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIV
PHNW_SALPB       HAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIV
PHNW_SALTI       HAYDCGEVARPNVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIV
PHNW_SALCH       HAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAQRYDKTYIV
PHNW_KLEP7       HPYDCGEVSRPDAAAIEQILQNDPAITHIAMVHSETTTGMLNPIEEVAELAKRYDKRYIV
PHNW_AERHH       HELDCGETTRPEAAAIEAMLVRHPEITHLAMVHCETTTGMLNPLEEVAALCQRRGIRLIV
PHNW_VIBCH       RVIAPGETAQPNLDEIADVLTHDPAITHVAIVHCETTTGMLNPIAEVAKIAKQHGKRVIL
PHNW_VIBC3       RVIAPGETAQPNLDEIADVLTHDPAITHVAIVHCETTTGMLNPIAEVAKIAKQHGKRVIL
PHNW_VIBPA       HVVSPGETSQPHLNEVETALASDPAITHVAIVHCETTTGMLNPIEAFASAAKAHGKVVIL
PHNW_VIBVY       HVVSPGETSQPHLNEVETALASDPAITHVAIVHCETTTGMLNPIEAFASVAKAHGKVVIL
PHNW_VIBVU       HVVSPGETSQPHLNEVETALASDPAITHVAIVHCETTTGMLNPIEAFASVAKAHGKVVIL
PHNW_PSYIN       VVLAPGETTQPDLQLLESTLLNDPKITHVAMVHCETTTGMLNPLEDFCRIAKAHNKVTIV
PHNW_SYNFM       AKLDFGETGRPDPDRVRDTIESDPAITHVAVVHCETTTGMLNPVEEIGRAVKSLGRVFIV
PHNW_LACPL       IDVVFNEDEAVDPVRIEATLADHPEITHFATVHSETTTGILNPIEALMPIMHEHGIVTII
PHNW_LYSSC       VVYSVPYDKQPSSLEVQALLEKDASITHVAVVHCETTTGILNPIKEIGEVVYSFNKTFIV
                                :   :  .  :: .  :* ** :* :**:  .       .   ::

PHNW_BURM7       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURMS       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURM9       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURMA       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURPS       DAMSSFGALPIALAASDIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURP0       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURP1       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURP6       DAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLH
PHNW_BURTA       DAMSSFGALPIALAGSGIDALISASGKCLEGVPGMGFVIARRAPLEAAEGRSPSVVLDLH
PHNW_BURCA       DAMSSFGALPIALADSGIDALISASGKCLEGVPGMGFAIVRRDALDASEGNSPSLALDLH
PHNW1_BURL3      DAMSSFGALPITLAGSGIDALISASGKCLEGVPGMGFAIVRREALDASEGNSPSLALDLH
PHNW2_PARXL      DAMSSFGALPIDLRRGGIDALISASGKCLEGVPGMGFVIMRRSLLEDSEGRSPSLALDLH
PHNW2_BURL3      DAMSSFGAIDIDARTTPFDAVIAASGKCLEGVPGLGFVIAKRSTLERCEGNSHSLAMDLY
PHNW2_CUPPJ      DAMSSFGAIDIDARTTPFDAVIAASGKCLEGVPGMGFVIARRTALERCEGNSHSLSLDLY
PHNW1_POLSJ      DAMSSFGALEIDARKTPFDAVVAASGKCLEGVPGMGFVLARRAALERCEGNCHSLAMDLY
PHNW_PSEAE       DAMSSFGAIGIDARKVPFDALIAASGKCLEGVPGMGFVFARSAALEASAGNCHSLAMDLQ
PHNW_PSEAB       DAMSSFGAIGIDARKVPFDALIAASGKCLEGVPGMGFVFARSAALEASAGNCHSLAMDLQ
PHNW_PSEP1       DAMSSFGALPIDAREIPFEALIAASGKCLEGVPGMGFVFAEKNALAAAEGNAHSLAMDLH
PHNW_PSEPK       DAMSSFGALPIDAREIPFEALIAASGKCLEGVPGMGFVFAEKSALAAAEGNAHSLAMDLH
PHNW_PSEPG       DAMSSFGALPIDAREIPFEALIAASGKCLEGVPGMGFVFAEKTALAAAEGNAHSLAMDLH
PHNW_PSEE4       DAMSSFGALPIDAREVPFEALIAASGKCLEGVPGMGFVFAEKTALAAAEGNAHSLAMDLQ
PHNW_PSEF5       DAMSSFGALPIDAREIPFDALIAASGKCLEGVPGMGFVFAAKASLAQAGGNAHSLAMDLH
PHNW_PSEPF       DAMSSFGALPVDAQKVPFDALIAASGKCLEGVPGMGFVFARKESLAAAAGNSHSLAMDLF
PHNW2_POLSJ      DAMSSFAALEIDARKVRFDALVAASGKCLEGVPGMGFVFIRKAILEGCAGRSQSLAMDLY
PHNW_CUPNH       DAMSSFGAIEIDARTMPFDALVAATGKCIEGVPGMGFVLVKKDVLEASQGNSHSLALDLY
PHNW1_CUPPJ      DAMSSFGAIEIDARTMPFDALVAATGKCIEGVPGMGFVLVKKTVLEGSQGNSHSLALDLY
PHNW1_PARXL      DSMSAFGAVPLDVREIACEAFVSSANKCIEGVPGFGFVIARKSALREAKGRSHSLALDVY
PHNW_RHIME       DSMSAFGAVPAGVGDFRYEAIVSSANKCIEGVPGFGFVIARKSELEAAKDRSHSLSLDVH
PHNW_HAHCH       DSMSAFGALPADAKKLGYAALISSANKCFEGVPGFGFALIRRDLLEQAKGNAHSLSMDLH
PHNW_BACAN       DAMSSFGGIEIDIAELQIDFLISSANKCIQGVPGFGFVIAQRDELLKCKGQARSLSLDLY
PHNW_BACHK       DAMSSFGGIEIDIAELQIDFLISSANKCIQGVPGFGFVIAQRDELLKCKGQARSLSLDLY
PHNW_BACCZ       DAMSSFGGIEIDIAELQIDFLISSANKCIQGVPGFGFVIAKRDELLKCKGQARSLSLDLY
PHNW_BACAH       DAMSSFGGIEIDIAELEIDFLISSANKCIQGVPGFGFVIAQRDELLKCKGQARSLSLDLY
PHNW_BACC1       DAMSSFGGIEIDIAELQIDFLISSANKCIQGVPGFGFVIAKRDELLKCKGQARSLSLDLY
PHNW_BACCR       DAMSSFGGIEIDIADLQIDFLISSANKCIQGVPGFGFVIAKRDELLKCKGQGRSLSLDLY
PHNW_BACCN       DAMSSFGGVEMDVADLQIDFMISSANKCIQGVPGFGFVIAKRTELEQCKGRARSLSLDLY
PHNXW_CLOD6      DAMSSFGGIEIDVEDFNIDFLVSSSNKCIQGVPGFGFIIANKEELSKCKGIAKSLSLDVY
PHNW_BACFR       DAMSSFGGIPMDVSELGIDFLISSANKCIQGVPGFGFIIARRSELVRCKGVARSLSLDIY
PHNW_BACFN       DAMSSFGGIPMDVSELGIDFLISSANKCIQGVPGFGFIIARRSELVRCKGVARSLSLDIY
PHNW_BACV8       DAMSSFGGVPLDVEELGIDFMISSANKCIQGVPGFGFIIARKSELQYCKGVSKSLSLDIY
PHNW_SALPA       DAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGRSRSLSLDLY
PHNW_SALTY       DAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLY
PHNW_SALPB       DAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGRSRSLSLDLY
PHNW_SALTI       DAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGRSRSLSLDLY
PHNW_SALCH       DAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLY
PHNW_KLEP7       DAMSSFGGIPLDIAALNIDYLISSANKCIQGVPGFAFVIAREAELAACKGRSRSLSLDLY
PHNW_AERHH       DAMSSFGGIPIDMGRLGIEFLISSANKCIQGVPGFGFVIARRAALAACAGCARSVSLDLH
PHNW_VIBCH       DAMSSFGGIPMDIGALGIDFMISSANKCIQGVPGFGFVIAKRSELEQCQGRARSLTLDLF
PHNW_VIBC3       DAMSSFGGIPMDIGALGIDFMISSANKCIQGVPGFGFVIAKRSELEQCQGRARSLTLDLF
PHNW_VIBPA       DAMSSFGGIPMDIADLGIDFMISSANKCIQGVPGFGFVIAKQTELEKCQDQARSLSLDLY
PHNW_VIBVY       DAMSSFGGIPIDIAELGIDFMISSANKCIQGVPGFGFVIAKQTELEKCQGQARSLSLDLY
PHNW_VIBVU       DAMSSFGGIPIDIAELGIDFMISSANKCIQGVPGFGFVIAKQTELEKCQGQARSLSLDLY
PHNW_PSYIN       DAMSSFGGIEMDIGQLNIDFMISSANKCIQGVPGFAFVIAKQSVLQECKGLARSLTLDLY
PHNW_SYNFM       DAMSSFGGIPMDIATLGADFLISSANKCIQGVPGFGFVIARRSELEQCAGRSRSLSLDLF
PHNW_LACPL       DAMSSLGGVPISIDELDCDYLISSANKCVQGVPGFAFIIAKQATLAHTADNARSLCLDLY
PHNW_LYSSC       DAMSSFGGVPMDLSDLHIDFCISSANKCIQGVPGFGFVIAKTNILEKCKGQARSVALDLY
                 *:**::..:            ::::.**.:****:.* :     *    .   *: :*: 

PHNW_BURM7       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURMS       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURM9       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURMA       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURPS       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURP0       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURP1       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURP6       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALG
PHNW_BURTA       DQYAYMQRT-SQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYAENCAALVDGMRALG
PHNW_BURCA       DQYAYLRKT-GQWRFTPPTHVIAALRAALDQYLAEGGQPARGARYADNCRTLVESMRALG
PHNW1_BURL3      DQYAYLLKT-GQWRFTPPTHVIAALRAALDQYLAEGGQPARGARYVDNCRTLVESMHALG
PHNW2_PARXL      DQYVYMRKT-TQWRFTPPTHVVAALREALDQFGAEGGQPARGARYARNCAALVGAMKALG
PHNW2_BURL3      DQWVYMQRT-TQWRFTPPTHVVAALDAAVGQYVDEGGLAARGGRYQRNYRALIDGMLALG
PHNW2_CUPPJ      DQWKYMERT-TQWRFTPPTHVVAALDQALQQYVEEGGLPARGARYASNCQLLVDGMETLG
PHNW1_POLSJ      DQWVYMNKT-TQWRFTPPTHVVAALDAALTQYFEQGGLAARGGAYAKNCRELISGLAGLG
PHNW_PSEAE       DQHAYMRKT-GQWRFTPPTHVVAALHEALSQYEEEGGLPARQRRYASNCETLLGEMARLG
PHNW_PSEAB       DQHAYMRKT-GQWRFTPPTHVVAALHEALSQYEEEGGLPARQRRYASNCETLLGEMARLG
PHNW_PSEP1       DQHAYMAKT-GQWRFTPPTHVVAALHEALQQYNEEGGLPARHQRYADNCKTLLDGMAAIG
PHNW_PSEPK       DQHAYMAKT-GQWRFTPPTHVVAALHEALQQYNEEGGLPARHQRYADNCKTLLDGMAAIG
PHNW_PSEPG       DQHAYMAKT-GQWRFTPPTHVVAALHEALQQYNEEGGLPARHQRYADNCKTLLDGMAAIG
PHNW_PSEE4       DQHAYMAKT-GQWRFTPPTHVVAALHEALLQYNEEGGLPARHQRYQDNCQTLLDGMAKIG
PHNW_PSEF5       DQHSYMAKT-GQWRFTPPTHVVAALHEALLQYAEEGGLPARHARYADNCQTLLDGMGELG
PHNW_PSEPF       DQHSYMKKT-GQWRFTPPTHVVAALHEALLQYNEEGGLPARHARYAANCQALMEEMGKLG
PHNW2_POLSJ      DQYIYMEKT-TQWRFTPPTHVVVALAEAIAQFEEEGGQPARLARYQRNYSTLITGMARLG
PHNW_CUPNH       DQYVYMQKT-TQWRFTPPTHVVAAFRTALDQFLEEGGQPVRGARYRRNCDALVQGMAALG
PHNW1_CUPPJ      DQYTYMQKT-TQWRFTPPTHVVAAFRTALDQFLEEGGQPVRGERYRRNYETLVQGMAVLG
PHNW1_PARXL      DQWDVMNRT-GQWRFTPPTHAVAAFIEALRLFRLEGGQVGRLARYANNRDVLVAGMRELG
PHNW_RHIME       AQWAYMNKT-GQWRFTPPTHVVAAFLEALRLHRKEGGVAGRGARYANNRDVMVAGMRQLG
PHNW_HAHCH       DQWAYMEKT-GQWRYTPPTHTVAAFAQALREYEEEGDAPARLARYTRNRDQLVAGMRQLG
PHNW_BACAN       DQWETMENQNGKWRFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIG
PHNW_BACHK       DQWETMENQNGKWRFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIG
PHNW_BACCZ       DQWETMENQNGKWRFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIG
PHNW_BACAH       DQWETMENQNGKWRFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIG
PHNW_BACC1       DQWETMENQNGKWRFTSPTHVVHAFYQALLELEKEGGVKARYNRYDNNQKLLVNRMREIG
PHNW_BACCR       DQWETMEKQNGKWRFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIG
PHNW_BACCN       DQWETMELQNGKWRFTSPTHTVRAFYQALLELEEEGGVKARNTRYRNNQQVLVKRMREVG
PHNXW_CLOD6      AQWDTMEKNNGKWRFTSPTHVVRAFYQALLELEEEGSVEKRYARYKENQFTIASRLKSLG
PHNW_BACFR       DQWETMEKGHGKWRFTSPTHVVRAFKQALTELIEEGGVEARHRRYCENHRVLVEGMRSLG
PHNW_BACFN       DQWETMEKGHGKWRFTSPTHVVRAFKQALTELIEEGGVEARHRRYCENHRVLVEGMRSLG
PHNW_BACV8       DQWDAMEKGHGKWRFTSPTHVVRAFKQAMDELAAEGGVEARHARYCRNHDVLVEGMRSLG
PHNW_SALPA       AQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALG
PHNW_SALTY       AQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALG
PHNW_SALPB       AQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALG
PHNW_SALTI       AQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALG
PHNW_SALCH       AQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAEEGGVAARHQRYQQNQRSLVAGMRALG
PHNW_KLEP7       AQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAQEGGVSARHQRYRNNQRRLVAGMRALG
PHNW_AERHH       AQWQTMEQQGGKWRFTSPTHTVLAFAQALRELDEEGGIAARHRRYRDNQRTLVDGMAALG
PHNW_VIBCH       DQWQCMEKNHGKWRFTSPTHTVRAFYQALLELESEGGIAARYQRYQTNQTQLVKGMRELG
PHNW_VIBC3       DQWQCMEKNHGKWRFTSPTHTVRAFYQALLELESEGGIAARYQRYQTNQTQLVKGMRELG
PHNW_VIBPA       DQWHCMEVNHGKWRFTSPTHTVRAFYQALLELEQEGGIEARHNRYQTNQKTLVAGMRSLG
PHNW_VIBVY       DQWHCMEVNHGKWRFTSPTHTVRAFYQALLELEQEGGIEARHNRYQTNQKTLVAGMRSLG
PHNW_VIBVU       DQWHCMEVNHGKWRFTSPTHTVRAFYQALLELEQEGGIEARHNRYQTNQKTLVAGMRSLG
PHNW_PSYIN       AQWQCMQENNGKWRFTSPTHTVRAFYQALLELEEEGGIGERQQRYITNQKKLVTGMRELG
PHNW_SYNFM       QQWKEMETKGGKWRFTSPTHVVRAFAQALNELDDEGGVACRNARYRENRRILTAGMRALG
PHNW_LACPL       DQWQAMTKQPGKWRFTSPTHVVHAFAQALIELQAEGGVTPRYQRYRASQQLLSDGLQALG
PHNW_LYSSC       SQWEVMKKD-GKWRFTSPTHVVAAFAKALEELVEEGGVNARYQRYADNNLLLRSRLSVLG
                  *   :     :**:*.***.: *:  *:     :*.   *   *  .   :   :  :*

PHNW_BURM7       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURMS       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURM9       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURMA       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURPS       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURP0       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURP1       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURP6       FEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURTA       FEPFLDARAQASVIVTFHAPADPAYAFAAFYAAVRDAGYVLYPGKLTTADTFRVGCIGAL
PHNW_BURCA       FVPFLDASVQAPVIVTFHAPDHPAYDFRRFYDAVRGAGFILYPGKLTRLETFRVGCIGAI
PHNW1_BURL3      FTTFLDASVQAPVIVTFHAPDHPAYDFRRFYDAVRDAGFILYPGKLTQLETFRVGCIGAI
PHNW2_PARXL      FEPFLKPEVQAPVIVTFHAPRDPAWHFAAFYAAVREAGYVLYPGKLTQVETFRVGCIGAI
PHNW2_BURL3      FRPFLDPAIQAPIIVTFHAPDDPNYDFKRFYQEVKKRGYILYPGKLTEVETFRVGCIGHF
PHNW2_CUPPJ      LKPYLERKVQAPIIVTFHAPADPRYDFKTFYQAVKQRGYILYPGKLTEIETFRVGCIGHF
PHNW1_POLSJ      LRSFLPAAIQAPIIVTFHAPASPAYEFKAFYNAVRQRGYILYPGKLTAVETFRVGCMGQL
PHNW_PSEAE       FRSFLPAEIQAPIIVTFHAPRDPRYRFADFYQRVREKGFILYPGKLTQVETFRVGCIGHV
PHNW_PSEAB       FRSFLPAEIQAPIIVTFHAPRDPRYRFADFYQRVREKGFILYPGKLTQVETFRVGCIGHV
PHNW_PSEP1       LRSFLPAEIQAPIIVTFHAPTDARYQFKDFYERVKAKGFILYPGKLTQVETFRVGCIGVV
PHNW_PSEPK       LRSFLPAEIQAPIIVTFHAPTDARYQFKDFYERVKAKGFILYPGKLTQVETFRVGCIGVV
PHNW_PSEPG       LRSFLPAEIQAPIIVTFHAPNDARYQFKDFYERVKAKGFILYPGKLTQVETFRVGCIGVV
PHNW_PSEE4       LHSFLPAEIQAPIIVTFHAPKDPRYQFKDFYERVKAKGFILYPGKLTQVETFRVGCIGVV
PHNW_PSEF5       LRSFLPEAIQAPIIVTFHAPKDPRYQFKDFYERVKAKGFILYPGKLTQVETFRVGCIGHV
PHNW_PSEPF       LRSFLPAAIQAPIIATFHAPKDPRYQFKDFYERVKAKGYILYPGKLTQVETFRVGCIGHV
PHNW2_POLSJ      FRPFLDPAIQAPIIVTFHAPADSRYEFKRFYASARERGFVLYPGKLTQVETFRVGCIGAI
PHNW_CUPNH       FRAFLPAAVQAPIIVTFHAPADARYDFKTFYARVRERGYILYPGKLTQMETFRVGCIGAI
PHNW1_CUPPJ      FRPFLSPDVQAPIIVTFHAPADARYDFRTFYEKVRSRGYILYPGKLTQVETFRVGCIGAI
PHNW1_PARXL      FEPLLNARWRSPVIVTFFAPAHPSFRFETFYELMKQQGFIIYPGKLTVVDSFRIGCIGQV
PHNW_RHIME       FETLLGDEWLSPIIVTFFSPAHPNFKFERFYELMKARGFIIYPGKLTVVDSFRIGCIGQM
PHNW_HAHCH       FQTLLEERWLSPVIVTFLSPADPNFDFKRFYQELKQRGFVIYPGKLTQTESFRIGCIGKI
PHNW_BACAN       FKPLVNEKYQSPIITSFIYPEGN-FEFQQLYNELKRYGFVIYPGKISKVDTFRIGNIGDV
PHNW_BACHK       FKPLVNEKYQSPIITSFIYPEGN-FEFQQLYNELKRYGFVIYPGKISKVDTFRIGNIGDV
PHNW_BACCZ       FKPIVNEKYQSPIITSFIYPEGN-FEFQQLYNELKRYGFVIYPGKISKVDTFRIGNIGDV
PHNW_BACAH       FKPLVNEKYQSPIITSFIYPEGN-FEFQQLYNELKRYGFVIYPGKISKVDTFRIGNIGDV
PHNW_BACC1       FKPLVDEKYQSPIITSFIYPEEW-FDFEQLYNELKRDGFVIYPGKISKVDTFRIGNIGDV
PHNW_BACCR       FKPLVDKKYQSPIITSFIYPKEG-FEFQQLYNELKRYGFVIYPGKISKVDTFRIGNIGDV
PHNW_BACCN       FEPLLDEAYQSPIITSFLYPGEG-FTFQQLYEELKEHGFVIYPGKISKVDTFRIGNIGDV
PHNXW_CLOD6      FDTLVNDNAQSPVITTFLYPKNAKFEFMEFYTYLKDNGFVIYPGKLTDIDTFRIGSIGEV
PHNW_BACFR       FVTLLDDAIQSPIITSFLYPKTG-FDFKAFYTALKSKGFVIYPGKISKADTFRIGNIGDV
PHNW_BACFN       FVTLLDDAIQSPIITSFLYPKTG-FDFKAFYTALKSKGFVIYPGKISKADTFRIGNIGDV
PHNW_BACV8       FKTLLKDEVQSPVITSFLYPDKE-FDFKEFYHQLKEKGFVIYPGKISQADTFRIGNIGDV
PHNW_SALPA       FNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEV
PHNW_SALTY       FNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEV
PHNW_SALPB       FNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEV
PHNW_SALTI       FNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEV
PHNW_SALCH       FNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEV
PHNW_KLEP7       FRPLLDDSLHSPIITAFYSPDAPQYRFHTFYQKLKDQGFVIYPGKVSQSDCFRIGNIGEV
PHNW_AERHH       FAPLLPEQWQSPIITAFYSPAHPDYRFADFYQRLKAQGFVIYPGKVSQADCFRIGNIGDV
PHNW_VIBCH       FAPLLPEKLHSPIITSFYSPEHSDYQFAEFYQRLKQQGFVIYPGKVSHADCFRIGNIGEV
PHNW_VIBC3       FAPLLPEKLHSPIITSFYSPEHSDYQFAEFYQRLKQQGFVIYPGKVSHADCFRIGNIGEV
PHNW_VIBPA       FEPLLSDDLHSPIITSFYSPTHSDYQFKAFYTRLKEQGFVIYPGKVSNADCFRIGNIGEV
PHNW_VIBVY       FEPLLSDDLHSPIITSFYSPTHSDYQFKAFYTRLKEQGFVIYPGKVSNADCFRIGNIGEV
PHNW_VIBVU       FEPLLNDELHSPIITSFYSPTHSDYQFKAFYTRLKEQGFVIYPGKVSNADCFRIGNIGEV
PHNW_PSYIN       FKTLLPDALHSPIITSFHSPSSPEYDFKRFYVLLKAAGFVIYPGKVSNADCFRIGNIGEV
PHNW_SYNFM       FECLLPEALQSPIITSFLTPGRPGFNFNSLYQELKSRGFVIYPGKVSEADTFRIGTIGHV
PHNW_LACPL       FELVIDPAIQGPIITSFKYPNVD-FDFADFYQFIKQRGFVIYPGKVSNIPSFRIGTIGDV
PHNW_LYSSC       FEAYISEELQSPIITTYLFPHKE-FSFEHFYQEMKKAGFVIYPGKLTDVDTFRIGNIGDI
                 :   :     ..:*.::  *    : *  :*   :  *:::****::    **:* :* .

PHNW_BURM7       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURMS       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURM9       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURMA       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURPS       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURP0       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURP1       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURP6       GADEMRGAVAAIGGALESLGIAMR-----------------
PHNW_BURTA       GAHEMRGAVAAIGGALRALGIAMR-----------------
PHNW_BURCA       DAGDIRRAVAAIGAAVESLGIAMQPA---------------
PHNW1_BURL3      DSNDIRRAVAAIAQAVESLGIAVQRA---------------
PHNW2_PARXL      DANELLNAAAAIGHALERLGIRVR-----------------
PHNW2_BURL3      GEAGIPGAVAAIADTLRAMGVRRVSAEAAA-----------
PHNW2_CUPPJ      GDAGIPGAVKAIGEVLAGMGVEIGMTVAA------------
PHNW1_POLSJ      GARGMAGAVEAVRDALQEMGLELANAE--------------
PHNW_PSEAE       DAAEMRQAVAAIGEALRELEVLEI-----------------
PHNW_PSEAB       DAAEMRQAVAAIGEALRELEVLEI-----------------
PHNW_PSEP1       GADGMQAAVNAVAEVLREMEVLDI-----------------
PHNW_PSEPK       GADGMQAAVNAVAEVLREMEVLDI-----------------
PHNW_PSEPG       GADGMQAAVNAVAQVLREMEVLDI-----------------
PHNW_PSEE4       GAAGMQAAVDAVAEVLREMEVLDI-----------------
PHNW_PSEF5       DRRGMQAAVAAIAEVLQEMEVLDI-----------------
PHNW_PSEPF       TPAQMREAVAAVSEVLREMEVLDI-----------------
PHNW2_POLSJ      GPREMEQAVHAIAGALQDMGISSAAPAH-------------
PHNW_CUPNH       DDNEMRNVVTAIGEVLREMGIKMQAPLAEAA----------
PHNW1_CUPPJ      DDNEMRNVVSAIGETLREMGISMQPEGRVRAA---------
PHNW1_PARXL      DEHVMRRVVEACANSLRTMGVGHAAPPAAALEERRTLAEAA
PHNW_RHIME       DSHVMQKVVAAAAESLAKMRVDTATPPALALAERARLAA--
PHNW_HAHCH       DTPEVARLLQAVKDTLIAMEISLS-----------------
PHNW_BACAN       HEEDINRLVDSIAKGVVIG----------------------
PHNW_BACHK       HEEDINRLVDSIAKGVVIG----------------------
PHNW_BACCZ       HEEDINRLVDSIAKGVVIG----------------------
PHNW_BACAH       HEEDINRLVDSIAKGVVIG----------------------
PHNW_BACC1       HEADINRLVDSIAKGVVIG----------------------
PHNW_BACCR       HEEDINRLVDCIAKGAVIG----------------------
PHNW_BACCN       YESDIHQLVDCISEGVVIG----------------------
PHNXW_CLOD6      YPTDMERLADVIEKFINR-----------------------
PHNW_BACFR       HPEDFARLVEVVRETEY------------------------
PHNW_BACFN       HPEDFARLVEVVRETEY------------------------
PHNW_BACV8       FPEDFSRLIEAIKTVAK------------------------
PHNW_SALPA       YAADITALLTAIRTAMYWTK---------------------
PHNW_SALTY       YAADITALLTAIRTAMYWTK---------------------
PHNW_SALPB       YAADITALLTAIRTAMYWTK---------------------
PHNW_SALTI       YAADITALLTAIRTAMYWTK---------------------
PHNW_SALCH       YAADITALLTAIRTAMYWTK---------------------
PHNW_KLEP7       YDADITALLAAIDNAMYWKQ---------------------
PHNW_AERHH       TPARVRCLLVAMASACYWQGDAR------------------
PHNW_VIBCH       YPQDIERLLSAMQHAIYWQQA--------------------
PHNW_VIBC3       YPQDIERLLSAMQHAIYWQQA--------------------
PHNW_VIBPA       YPADIERLIGAIEKAMYWQVA--------------------
PHNW_VIBVY       YPADIERLIGAIEKAMYWQVA--------------------
PHNW_VIBVU       YPADIERLIGAIEKAMYWQVA--------------------
PHNW_PSYIN       YPEDIDKLMIAIKNVIYWQVAA-------------------
PHNW_SYNFM       FPEDMHRLVKAAKDAMHRFG---------------------
PHNW_LACPL       DTTDIQRLLTIIGDYQQLHR---------------------
PHNW_LYSSC       YEEDMQALCEVIENYMVVKNNEN------------------
                     .