CLUSTAL format seed alignment for MF_01379

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBA1_GLOVI      -MTATLE----RRSSQGLWDRFADWVTSTNNRFYVGWFGVLMIPTLLSATICFVVAFVAA
PSBA3_GLOVI      -MTATLE----RRQAQGLWDRFADWVTSTHNRFYVGWFGVLMIPTLLSATICFVIAFVAA
PSBA2_GLOVI      -MATILR----RRSLGNPWEQFANWITSTDNRFYIGWFGVLMVPTLLSATICFVVAFIAA
PSBA_THEVL       -MTTTLQ----RRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAA
PSBA1_THEEB      -MTTTLQ----RRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAA
PSBA3_THEEB      -MTTVLQ----RREQLNLWEQFCSWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFIAA
PSBA2_THEEB      -MTTVLQ----RRQTANLWERFCDWITSTENRLYIGWFGVIMIPTLLAATICFVIAFIAA
PSBA_GOSHI       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_LACSA       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_SOLLC       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_SOLTU       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_SPIOL       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_TOBAC       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_CUSRE       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_SOYBN       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_PHAVU       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_ARATH       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_OENEH       -MTAILE----RRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_LOTJA       -MTAILE----RRESENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_AMBTC       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_HORVU       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_WHEAT       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_SACHY       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_SACOF       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_MAIZE       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_ORYNI       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_ORYSA       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_ORYSI       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_ORYSJ       -MTAILE----RRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_CUSGR       -MTVVLD----RRKSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFLIAFIAA
PSBA_CYCTA       -MTAILE----KRESASLWGRFCDWITSTENRLYIGWFGVLMIPTPLVATSVFIIAFIAA
PSBA_GNEPA       -MTAILE----RRESASVWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_PINKO       -MTAIIE----RRESANFWSRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_PINTH       -MTAIIE----RRESANLWSRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_ANTAG       -MTATLE----RRESASLWGRFCDWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_MARPO       -MTATLE----RRESASIWGRFCDWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_NEPOL       -MTAILE----RRESTSVWARFCDWVTSTENRLYIGWFGVLMIPLLLTATSVFIIGFIAA
PSBA_ADICA       -MTATLE----RRESASLWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAA
PSBA_CHLVU       -MTAILE----RRESASLWARFCEWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAA
PSBA_MESVI       -MTATLE----RRESANLWGRFCEFITSTENRLYIGWFGVIMIPCLLTAISVYIIAFVAA
PSBA_CHLRE       -MTAILE----RRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAA
PSBA_BIGNA       -MTAIIE----RRENSSLWARFCEWITSTENRLYIGWFGVLMVPTLLTATTVFIIGFIAA
PSBA_HETNI       -MKNTFNTS-VFANAYSFWGYVIGFILSTSNRLYIGWFGILMFPLLVLATVAFISAFIFA
PSBA_HETPY       -MKNTFNTSNVFANAYSFWGYVIGFILSTSNRLYIGWFGILMFPLLVLATVAYIAAFIFA
PSBA_HETRO       -MKNTFNTSNAFASAYSFWGYVIGFLLSTSNRLYIGWFGILMFPLISLATVAYIAAFIFA
PSBA_PROMC       -MKNS-----QAVTSLTWWSVVVAYIVSTNSRLYIGWFGVLLFPLIAVSTVAYVAAFILA
PSBA_AMPCA       ---------MTSLIRSNSWGSFVQTITSSSNRLYIGWFGLLVFPLLSLATVAYITAFFLA
PSBA_AMPOP       ---------MTSLIRSNSWGSFVQTITSSSNRLYIGWFGLLVFPLLSLATVAYITAFFLA
PSBA_KARMI       -MKSTLLNK-KSQQTTPAWEFFCSWVTTTENRLYLGWFGCLMVPTLVSATFAYIIGFLAA
PSBA_EMIHU       -MTTTLE----RRESASFWEQFCAWITSTENRLYIGWFGCLMFPTLLSAISAYIIAFIAA
PSBA_TRICV       -MTATLE----RREGVSLWERFCAWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAA
PSBA_THAPS       -MIATLE----RREGVSLWERFCAWITSTENRLYIGWFGCLMFPTLLTATSCFIIAFIAA
PSBA_PHATC       -MTATLE----RRQSVSLWERFCGWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAA
PSBA_PORPU       -MTATLQ----RRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAA
PSBA_PYRYE       -MTATLQ----RRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAA
PSBA_GRATL       -MTATLE----RRESASLWERFCTWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAA
PSBA_GUITH       -MTATLE----RRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATTVFIIAFIAA
PSBA_CYACA       -MTVTLE----RRESTSLWERFCSWITSTENRLYIGWFGVLMIPCLLTATTVFIIAFIAA
PSBA_CYAM1       -MTATLQ----RRASANLWERFCAWITSTENRLYIGWFGVLMIPCLLTATCVFIIAFVAA
PSBA_CYAPA       -MTATLE----RNASVSLWEQFCGFITSTENRLYIGWFGVLMFPLLLTATTLFIIAFVAA
PSBA_EUGGR       MISPVLK----KYARPSLWYRFCAWVASKKNRLYVGWFGVLMIPTLLTAATVFIIAFIAA
PSBA1_SYNJA      -MTTVIQ----RRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGA
PSBA3_SYNJA      -MTTVIQ----RRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGA
PSBA2_SYNJB      -MTTVIQ----RRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGA
PSBA1_NOSS1      -MTTTLQ---QRSS-ANVWERFCTWITSTENRIYVGWFGVLMIPTLLAATVCFIIAFVAA
PSBA3_TRIV2      -MTTTLQ---QRSS-ANVWERFCTWITSTENRIYVGWFGVLMIPTLLAATVCFIIAFVAA
PSBA2_TRIV2      -MTATLQ---QRKS-ANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAA
PSBA2_NOSS1      -MTATLQ---QRKS-ANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAA
PSBA1_TRIEI      -MTTTLQ---QRES-ANVWEKFCSWVTSTDNRIYVGWFGVLMIPTLLTATICYIIAFVAA
PSBA2_TRIEI      -MTTTLQ---QREN-ANVWERFCSWVTSTDNRIYVGWFGVLMIPTLLTATICYIIAFVAA
PSBA_PROMS       -MTTIQQ---QRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAA
PSBA_PROM0       -MTTIQQ---QRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAA
PSBA_PROM9       -MTTIQQ---QRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAAAACFIVAFIAA
PSBA_PROM5       -MTTIQQ---QRTSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAAAACFIVAFIAA
PSBA_PROMP       -MTTIQQ---QRTSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAAAACFIVAFIAA
PSBA_PROMA       -MTTIRQ---QRSSLLKGWPQFCEWVTSTDNRIYVGWFGVLMIPCLLAAAICFVVAFIAA
PSBA_PROM1       -MTTIQQ---QRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAA
PSBA_PROMT       -MTTIQQ---QRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAA
PSBA_PROM3       -MTTT-----IRSGRLSSWESFCNWVTSTNNRIYVGWFGVLMVPTLLAAAICFTIAFIAA
PSBA_PROMM       -MTTT-----IRSGRLSGWESFCNWVTSTNNRIYVGWFGVLMVPTLLAAAICFTIAFIAA
PSBA2_SYNSC      -MSTA-----IRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAA
PSBA2_SYNPX      -MSTA-----IRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAA
PSBA1_SYNS9      -MSTA-----IRSGRQSNWGSFCDWVTNTNNRIYVGWFGVLMIPCLLAATICFIIAFVAA
PSBA2_SYNPW      -MATA-----IRSGRIGGWERFCQWVTDTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAA
PSBA3_SYNS3      -MATA-----VRSGRLSSWQSFCQWVTDTNNRIYIGWFGVLMIPCLLAATTCFIVAFIAA
PSBA2_SYNR3      -MSTA-----VRSGRVSSWESFCQWVTNTDNRIYVGWFGVLMIPCLLAATICYIIAFIAA
PSBA1_SYNS3      -MTTTIQ---QRSG-ANGWQQFCDWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAA
PSBA2_SYNS3      -MTTTIQ---QRSG-ANGWQQFCDWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAA
PSBA1_SYNPX      -MTTTLQ---QRSG-ASSWQAFCEWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFVAA
PSBA3_SYNPX      -MTTTLQ---QRSG-ASSWQAFCEWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFVAA
PSBA1_SYNSC      -MTTTLQ---QRSG-ASSWQAFCEWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFVAA
PSBA2_SYNS9      -MTTTIQ---QRSG-ASSWQSFCEWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFVAA
PSBA1_SYNR3      -MQTTIQ---QRSG-ASAWQQFCEWVTSTDNRLYVGWFGVLMIPTLLAATTCFIVAFIAA
PSBA1_SYNPW      -MTTTIQ---QRSG-ANGWQSFCEWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAA
PSBA1_SYNE7      -MTSILR---EQRR-DNVWDRFCEWVTSTDNRIYVGWFGVLMIPTLLTATICFIVAFIAA
PSBA3_SYNP6      -MTSILR---EQRR-DNVWDRFCEWVTSTDNRIYVGWFGVLMIPTLLTATICFIVAFIAA
PSBA2_SYNE7      -MTTALQ---RRES-ASLWQQFCEWVTSTDNRLYVGWFGVLMIPTLLTATICFIVAFIAA
PSBA1_SYNP6      -MTTALQ---RRES-ASLWQQFCEWVTSTDNRLYVGWFGVLMIPTLLTATICFIVAFIAA
PSBA2_SYNP6      -MTTALQ---RRES-ASLWQQFCEWVTSTDNRLYVGWFGVLMILTLLTATICFIVAFIAA
PSBA2_SYNY3      -MTTTLQ---QRES-ASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAA
PSBA1_TRIV2      -MTTLLE----QRSSANLWHRFGNWITSTENRMYVGWFGVLLIPTALTAAIVFILAFIAA
PSBA1_SYNY3      -MTTTQL----GLQEQSLWSRFCCWITSTSNRLYIGWFGVLMIPTLLTATTCFIIAFIAA
PSBA1_SYNJB      -MSTVIRRS-LAARQLWSWNGFCQWITSTENRLYIGWFGVLMIPTLLAAAFCFVIAFIAA
PSBA2_SYNJA      -MSVVVRRS-AAARRLWSWESFCQWITSTENRLYIGWFGVLMIPTLLAATFCFVIAFIAA
                                   *  .   :  . .*:*:**** ::.     :   :  .*. *

PSBA1_GLOVI      PPVDMDGIREPISGSLLYGNNIITGAVIPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLV
PSBA3_GLOVI      PPVDMDGIREPISGSLLYGNNIITGAVIPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLV
PSBA2_GLOVI      PPVDMDGIREPISGSLLYGNNIITGAVIPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLV
PSBA_THEVL       PPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA1_THEEB      PPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA3_THEEB      PPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA2_THEEB      PPVDIDGIREPVSGSLLYGNNIITAAVVPSSNAIGLHLYPIWDAASLDEWLYNGGPYQLI
PSBA_GOSHI       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_LACSA       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_SOLLC       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_SOLTU       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_SPIOL       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_TOBAC       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_CUSRE       PPVDIDGIREPVSGSLLYGNNIVSGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_SOYBN       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_PHAVU       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_ARATH       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_OENEH       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_LOTJA       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_AMBTC       PPVDIDGIREPVSGSLLYGNNILSGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_HORVU       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_WHEAT       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_SACHY       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_SACOF       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_MAIZE       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_ORYNI       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_ORYSA       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_ORYSI       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_ORYSJ       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_CUSGR       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIAEWLYNGGPYELI
PSBA_CYCTA       PPVYIDGIREPVPGSLLYGNNIRYGAIIPTSAAIGLHLYPIWEAASVDGWHYYVGPYELI
PSBA_GNEPA       PPVDIDGIREPVAGSLLYGNNIISGAIIPTSAAIGLHFYPIWEASSVDEWLYNGGPYELI
PSBA_PINKO       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_PINTH       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_ANTAG       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_MARPO       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_NEPOL       PPVDIDGIREPVSGSLLFGNNIISGAIIPSSAAIGIHFYPIWEAASIDEWLYNGGCYELI
PSBA_ADICA       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELI
PSBA_CHLVU       PPVDIDGIREPVSGSLLYGNNIISGAIIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA_MESVI       PPVDIDGIREPVSGSLLYGNNIISGSVIPMSNAIGLHFYPIWEAASLDEWLYNGGPYLMV
PSBA_CHLRE       PPVDIDGIREPVSGSLLYGNNIITGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA_BIGNA       PPVDIDGIREPVSGSLLYGNNIISGAIVPTSNAIGLHFYPIWEAASVDEWLYNGGPYQMI
PSBA_HETNI       PPVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFV
PSBA_HETPY       PPVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFV
PSBA_HETRO       PPVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFV
PSBA_PROMC       PPVDIDGIREPVSGSLLYSNNIITGAVIPSSNAIGVHFYPVWEAISNNEWLYNGGTYQFV
PSBA_AMPCA       PAVDIDGIREPVAGSLIYGNNIISGAVIPSSNAIGVHFYPLWESLGLDEWLYNGGTYQFV
PSBA_AMPOP       PAVDIDGIREPVAGSLIYGNNIISGAVIPSSNAIGVHFYPLWESLGLDEWLYNGGTYQFV
PSBA_KARMI       PPVDIDGIREPVSGSLLYANNIISGAVIPSSNAMGVHFYPIWEAASLDEWLYNGGTYQLV
PSBA_EMIHU       PPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGVHFYPIWEAASIDEWLYNGGTYQLV
PSBA_TRICV       PPVDIDGIREPVAGSLLYGNNIISGAVIPSSNAIGMHFYPIWEAASIDEWLYNGGPYQLI
PSBA_THAPS       PPVDIDGIREPVAGSLLYGNNIISGAVIPSSNAIGMHFYPIWEAASVDEWLYNGGPYQLI
PSBA_PHATC       PPVDIDGIREPVAGSLLYGNNIITGAVIPSSNAIGIHFYPIWEAASVDEWLYNGGPYQLI
PSBA_PORPU       PPVDIDGIREPVAGSLLYGNNIISGAVIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLV
PSBA_PYRYE       PPVDIDGIREPVAGSLLYGNNIISGAVIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLV
PSBA_GRATL       PPVDIDGIREPVAGSLLYGNNIISGAIIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLI
PSBA_GUITH       PPVDIDGIREPVAGSLLYGNNIITGAVIPSSASIGIHFYPIWEAASLDEWLYNGGPYQLI
PSBA_CYACA       PPVDIDGIREPVSGSLLYGNNIITGAVVPTSNAIGLHLYPIWEAASLDEWLYNGGPYQLV
PSBA_CYAM1       PPVDIDGIREPVSGSLFYGNNIITGAVVPTSNAIGLHFYPIWEAASVDEWLYNGGPYQLI
PSBA_CYAPA       PPVDIDGIREPVAGSLFYGNNIISGAVIPSSAAIGMHFYPIWEAASLDEWLYNGGPYQFV
PSBA_EUGGR       PPVDIDGIREPVSGSLFYGNNIITGAVVPTSNAIGLHFYPIWEATSLDEWLYNGGPYQLI
PSBA1_SYNJA      PPVDIDGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA3_SYNJA      PPVDIDGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA2_SYNJB      PPVDIDGIREPVSGSLLYGNNIISGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA1_NOSS1      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA3_TRIV2      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_TRIV2      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_NOSS1      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA1_TRIEI      PPVDIDGIREPVAGSLMFGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_TRIEI      PPVDIDGIREPVAGSLMFGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA_PROMS       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLV
PSBA_PROM0       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLV
PSBA_PROM9       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLV
PSBA_PROM5       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLV
PSBA_PROMP       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLV
PSBA_PROMA       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLV
PSBA_PROM1       PPVDIDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLV
PSBA_PROMT       PPVDIDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLV
PSBA_PROM3       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAASVDEWLYNGGPYQLV
PSBA_PROMM       PPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAASVDEWLYNGGPYQLV
PSBA2_SYNSC      PPVDIDGIREPVAGSLIYGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_SYNPX      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA1_SYNS9      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA2_SYNPW      PAVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA3_SYNS3      PPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWDAASLDEWLYNGGTYQLV
PSBA2_SYNR3      PPVDIDGIREPVAGSFLYGNNIISGAVIPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLV
PSBA1_SYNS3      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA2_SYNS3      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA1_SYNPX      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA3_SYNPX      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA1_SYNSC      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA2_SYNS9      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA1_SYNR3      PPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLV
PSBA1_SYNPW      PPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA1_SYNE7      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA3_SYNP6      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_SYNE7      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA1_SYNP6      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_SYNP6      PPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA2_SYNY3      PPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLV
PSBA1_TRIV2      PPVDVDGIREPVSGSLLYGNNIITATVVPTSAAIGLHLYPIWEAASLDEWLYNGGPYQMI
PSBA1_SYNY3      PPVDIDGIREPIAGSLLYGNNIITAAVVPSSNAIGLHFYPIWEAHSLDEWLYNGGPYQLI
PSBA1_SYNJB      PPVDVDGIREPVIGSLIGGNNLISAAVVPTSAAIGLHFYPIWEAASLDEWLYNGGPYQLI
PSBA2_SYNJA      PPVDVDGIREPVIGSLLGGNNLISAAVVPTSAAIALHFYPIWEAASLEEWLYNGGPYQLI
                 *.* :******: *::: .**:  .:::* * ::.:*:**:*::     * *  * : ::

PSBA1_GLOVI      VFHFLIGVFCYLGREWELSYRLGLRPWICIAYSAPVAAAAAVFLIYPIGQGSFSDGMPLG
PSBA3_GLOVI      VFHFLIGVFCYLGREWELSYRLGLRPWICIAYSAPVAAATAVFLVYPIGQGSFSDGMPLG
PSBA2_GLOVI      VFHFLIGIFAYLGREWEFSYRLGLRPWICVAYSAPVAAATAVFLIYPMGQGSFSDGMSLG
PSBA_THEVL       IFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLG
PSBA1_THEEB      IFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLG
PSBA3_THEEB      IFHFLIGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA2_THEEB      IFHFLIGIFCYMGREWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGLMLG
PSBA_GOSHI       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_LACSA       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_SOLLC       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_SOLTU       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_SPIOL       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_TOBAC       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_CUSRE       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_SOYBN       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_PHAVU       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ARATH       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_OENEH       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_LOTJA       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_AMBTC       VLHFLLSVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_HORVU       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_WHEAT       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_SACHY       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_SACOF       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_MAIZE       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ORYNI       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ORYSA       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ORYSI       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ORYSJ       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_CUSGR       VLHFLLGVACYMGREWELSFRLGMRPWIAIAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_CYCTA       VMHLLLGVARYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGNFSDGMPLG
PSBA_GNEPA       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_PINKO       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_PINTH       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ANTAG       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_MARPO       VLHFLLGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_NEPOL       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_ADICA       VLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLG
PSBA_CHLVU       VCHFFLGICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLG
PSBA_MESVI       VCHFLLGIACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_CHLRE       VCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSDGMPLG
PSBA_BIGNA       VCHFFIGVCSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLG
PSBA_HETNI       VLHFILGAGAYMGREWEFAFRLGMRPWIFVAFSAPLVAASAVFVVYPIGQGSFSDGMPLG
PSBA_HETPY       VLHFILGAGAYMGREWEFAFRLGMRPWIFVAFSAPLVAASAVFIVYPIGQGSFSDGMPLG
PSBA_HETRO       VLHFIFGAGAWMGREWEFAFRLGMRPWIFVAFSAPLVASCAVFVVYPIGQGSFSDGMPLG
PSBA_PROMC       VLHFLAAVLAWLGREYEYSFRLGMRPWIYLAFSAPVVAASAVFVVYPIGQGSFSDGMPLG
PSBA_AMPCA       VFHFFLGVCGWMGREWEFSYRLGMRPWIFVAFSAPIAAAAAVFIIYPIGQGSFSDGMPLG
PSBA_AMPOP       VFHFFLGVCGWMGREWEFSYRLGMRPWIFVAFSAPIAAAAAVFIIYPIGQGSFSDGMPLG
PSBA_KARMI       VFHFFIGVCSYLGREWELSYRLGMRPWIFVAFSAPVAAASAVFIVYPIGQGSFSDGMPLG
PSBA_EMIHU       VLHFFIGVCAYIGREWELSYRLGMRPWICVAFSAPVAAAAAVFVIYPIGQGSFSDGMPLG
PSBA_TRICV       VLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLG
PSBA_THAPS       VLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLG
PSBA_PHATC       VLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLG
PSBA_PORPU       VLHFLTGVACYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLG
PSBA_PYRYE       VLHFLTGVACYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLG
PSBA_GRATL       VLHFLLGVSCYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLG
PSBA_GUITH       VDHFLLGVCGWIGREWEFSYRLGMRPWISVAFTAPVAAASAVFLVYPIGQGSFSDGMPLG
PSBA_CYACA       VLHFLLGVAAYMGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_CYAM1       VLHFLIGVASYMGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_CYAPA       VMHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_EUGGR       VCHFFIGICSYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFIVYPLGQGSFSDGMPLG
PSBA1_SYNJA      VLHFLIGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA3_SYNJA      VLHFLIGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA2_SYNJB      VLHFLIGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA1_NOSS1      IFHFLIGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLG
PSBA3_TRIV2      VFHFLIGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLG
PSBA2_TRIV2      IFHFLTGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA2_NOSS1      IFHFLTGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA1_TRIEI      IFHFLIGIFTYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA2_TRIEI      IFHFLIGIFTYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA_PROMS       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROM0       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROM9       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROM5       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROMP       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROMA       IFHFLIGICGWMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROM1       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROMT       IFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLG
PSBA_PROM3       VFHFLIGICCWLGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPVGQGSFSDGMPLG
PSBA_PROMM       VFHFLIGICCWLGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPVGQGSFSDGMPLG
PSBA2_SYNSC      CFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLG
PSBA2_SYNPX      CFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLG
PSBA1_SYNS9      VFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLVYPFGQGSFSDAMPLG
PSBA2_SYNPW      VFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLVYPFGQGSFSDGMPLG
PSBA3_SYNS3      VFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLG
PSBA2_SYNR3      VFHFLIGISAYMGRQWELSYRLGMRPWICVAYAAPLSAAMVVFLIYPFGQGSFSDGMPLG
PSBA1_SYNS3      VFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA2_SYNS3      VFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA1_SYNPX      VFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA3_SYNPX      VFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA1_SYNSC      VFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA2_SYNS9      VFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA1_SYNR3      IFHFLIGIYAYMGREWELSYRLGMRPWICIAYSAPVAAASAVFLVYPFGQGSFSDAMPLG
PSBA1_SYNPW      VFHFLIGIFCYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDGMPLG
PSBA1_SYNE7      VFHFLLGISCYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPIGQGSFSDGMPLG
PSBA3_SYNP6      VFHFLLGISCYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPIGQGSFSDGMPLG
PSBA2_SYNE7      VFHFLIGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA1_SYNP6      VFHFLIGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA2_SYNP6      VFHFLIGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLG
PSBA2_SYNY3      VFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLG
PSBA1_TRIV2      VLHFLIAIYAYMGRQWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGMMLG
PSBA1_SYNY3      VFHFLIGIFCYLGRQWELSYRLGMRPWICVAYSAPVAAATATLLIYSIGQGSFSDGLPLG
PSBA1_SYNJB      VLHFLIGVWCYLGRQWELSYRLGMRPWIAVAFSAPAAAATAVLLVYPIGQGSFSEGLPLG
PSBA2_SYNJA      VFHFLIGVWCYLGRQWELSYRLGMRPWIAVAFSAPAAAATAVLLVYPIGQGSFSEGLPLG
                   *:: .   ::**::* ::***:**** :*::**  :: ..:::*..***.**:.: **

PSBA1_GLOVI      ISGTFNFMFVFQAEHNILNHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETSMEESQNY
PSBA3_GLOVI      ISGTFNFMFVFQAEHNILNHPFHMLGVAGVFGGALISAMHGSLVTSSLVSETSYEESQNY
PSBA2_GLOVI      ISGTFNFMFIFQAEHNILNHPLHMFGVAGVFGGSLFAAMHGSLVTSSLIKATSYEESQNY
PSBA_THEVL       ISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANY
PSBA1_THEEB      ISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANY
PSBA3_THEEB      ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETTETESANY
PSBA2_THEEB      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTETESTNY
PSBA_GOSHI       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_LACSA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_SOLLC       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_SOLTU       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_SPIOL       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_TOBAC       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_CUSRE       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_SOYBN       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_PHAVU       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_ARATH       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_OENEH       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_LOTJA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_AMBTC       ISGIFNLMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_HORVU       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_WHEAT       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_SACHY       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_SACOF       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_MAIZE       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_ORYNI       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_ORYSA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_ORYSI       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_ORYSJ       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_CUSGR       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANK
PSBA_CYCTA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_GNEPA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANA
PSBA_PINKO       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANA
PSBA_PINTH       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANA
PSBA_ANTAG       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_MARPO       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_NEPOL       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_ADICA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_CHLVU       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_MESVI       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_CHLRE       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANE
PSBA_BIGNA       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRQTTENESTNN
PSBA_HETNI       ISGTFNFMLVFQAEHNILMHPFHILGVAAVFGGSLFSAMHGSLVTSSLLAETAGDLSLNV
PSBA_HETPY       ISGTFNFMLVFQAEHNILMHPFHILGVAAVFGGSLFSAMHGSLVTSSLVAETAGDLSLNV
PSBA_HETRO       ISGTFNFMLVFQAEHNILMHPFHILGVAGVFGGSLFSAMHGSLVTSSLLAETAGDLSLNV
PSBA_PROMC       ISGTFNFMLVFQAEHNILMHPFHILGVSAVFGGSLFSAMHGSLVTSSLLSETASYDSLNA
PSBA_AMPCA       IQGTFNFMLVFQAEHKILMHPFHILGVAGVFGGSLFSAMHGSLVSSSLLAETAGSESLNN
PSBA_AMPOP       IQGTFNFMLVFQAEHKILMHPFHILGVAGVFGGSLFSAMHGSLVSSSLLAETAGSESLNN
PSBA_KARMI       ISGTFNFMLVFQAEHNILMHPLHMFGVAAVFGGSLFSAMHGSLVTSSLLKETAEFESANY
PSBA_EMIHU       ISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANY
PSBA_TRICV       ISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNY
PSBA_THAPS       ISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNY
PSBA_PHATC       ISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNY
PSBA_PORPU       ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETSENESANY
PSBA_PYRYE       ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETSENESANY
PSBA_GRATL       ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANN
PSBA_GUITH       ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANY
PSBA_CYACA       ISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGALFSAMHGSLVTSSLIRETTENESPNY
PSBA_CYAM1       ISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGALFSAMHGSLVTSSLIRETSENESLNN
PSBA_CYAPA       ISGTFNFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANA
PSBA_EUGGR       ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLLRETTENESINV
PSBA1_SYNJA      ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNL
PSBA3_SYNJA      ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNL
PSBA2_SYNJB      ISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNL
PSBA1_NOSS1      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNY
PSBA3_TRIV2      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNY
PSBA2_TRIV2      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNY
PSBA2_NOSS1      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNY
PSBA1_TRIEI      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA2_TRIEI      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA_PROMS       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROM0       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROM9       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROM5       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROMP       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROMA       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROM1       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTSSLIRETTGLDSQNY
PSBA_PROMT       ISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTSSLIRETTGLDSQNY
PSBA_PROM3       ISGTFNFMLVFQAEHNILMHPFHMIGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA_PROMM       ISGTFNFMLVFQAEHNILMHPFHMIGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNY
PSBA2_SYNSC      ISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEAESQNY
PSBA2_SYNPX      ISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA1_SYNS9      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNY
PSBA2_SYNPW      ISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEAESQNY
PSBA3_SYNS3      ISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESHNY
PSBA2_SYNR3      ISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNY
PSBA1_SYNS3      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA2_SYNS3      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA1_SYNPX      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA3_SYNPX      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA1_SYNSC      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNY
PSBA2_SYNS9      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNY
PSBA1_SYNR3      ISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNY
PSBA1_SYNPW      ISGTFNFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNY
PSBA1_SYNE7      ISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA3_SYNP6      ISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA2_SYNE7      ISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA1_SYNP6      ISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA2_SYNP6      ISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNY
PSBA2_SYNY3      ISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNY
PSBA1_TRIV2      ISGTFNFMIVFSPEHNILMHPFHMIGVAGVFGGALFSAMHGSLVTSTLVRETSEVESANT
PSBA1_SYNY3      ISGTFNFMLVLQAEHNVLMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTEVESQNQ
PSBA1_SYNJB      IAGTFYFMLAFQAEHNILMHPASWLGVAGVFGGALLASLHGSLVISSLIRETSEEESQNA
PSBA2_SYNJA      IAGTFYFMLAFQAEHNILMHPASWLGVAGVFGGALLASLHGSLVISSLIRETSEEESQNA
                 * * *  *: :..**::* **    **:.:***:*:.::***** *:*:  *:   * * 

PSBA1_GLOVI      GYKFGQEEETYNIIAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGISV
PSBA3_GLOVI      GYKFGQAEETYNISAAH-GYISRLVFQYFAFWGANSRSLHFIMAAFPVIGIWFTSLGISV
PSBA2_GLOVI      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFT--NSRSLHFFLAAWPVIGIWLTSLGICV
PSBA_THEVL       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWRVVGVWFAALGIST
PSBA1_THEEB      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGVWFTALGIST
PSBA3_THEEB      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLAAWPVIGIWFTALGIST
PSBA2_THEEB      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFAALGIST
PSBA_GOSHI       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_LACSA       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_SOLLC       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_SOLTU       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_SPIOL       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_TOBAC       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_CUSRE       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_SOYBN       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_PHAVU       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_ARATH       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_OENEH       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_LOTJA       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_AMBTC       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_HORVU       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_WHEAT       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_SACHY       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_SACOF       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_MAIZE       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_ORYNI       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_ORYSA       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_ORYSI       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_ORYSJ       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_CUSGR       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGIST
PSBA_CYCTA       GYKFGQEGETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVWPVVGIWFTALGIST
PSBA_GNEPA       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_PINKO       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVAGIWFTALGIST
PSBA_PINTH       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVAGIWFTALGIST
PSBA_ANTAG       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGIST
PSBA_MARPO       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_NEPOL       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVCIWFTALGVST
PSBA_ADICA       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_CHLVU       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGIST
PSBA_MESVI       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVWPVVGIWFTAMGIST
PSBA_CHLRE       GYRFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGLST
PSBA_BIGNA       GYVFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTAMGIST
PSBA_HETNI       GYNFGQEDETYSISAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGVST
PSBA_HETPY       GYNFGQEDETYSISAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGVST
PSBA_HETRO       GYNFGQEDETYSISAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGVST
PSBA_PROMC       GYVFGQEDETYAISAAH-GYFGRLLFQYGSFN--NSRSLHFFLAAWPVIGIWCTAIGVST
PSBA_AMPCA       GYVFGQEDETYSISAAH-AYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWITSLGVAT
PSBA_AMPOP       GYVFGQEDETYSISAAH-AYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTSLGVAT
PSBA_KARMI       GYRFGQSTETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWLTAMGVST
PSBA_EMIHU       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLGAWPVVGIWFTAMGVAT
PSBA_TRICV       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLAAWPVVGIWLTAMGVST
PSBA_THAPS       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLALWPVLGIWLTAMGIST
PSBA_PHATC       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLALWPVVGIWLTAMGVST
PSBA_PORPU       AYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGLWPVVGIWLTALSVST
PSBA_PYRYE       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGLWPVVGIWLTALSVST
PSBA_GRATL       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGLWPVVGIWFTAMSVST
PSBA_GUITH       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLGLWPVVGIWFTALGIMT
PSBA_CYACA       GYKLGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLGLWPVVGIWLTSIGIST
PSBA_CYAM1       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWLTAIGIST
PSBA_CYAPA       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLALWPVVGIWFTALGLST
PSBA_EUGGR       GYKFGQEEETYNIIAAH-AYFGRLIFQYASFN--NSRSLHFFLAVWPVVGIWFTALGVST
PSBA1_SYNJA      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGISI
PSBA3_SYNJA      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGISI
PSBA2_SYNJB      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFTALGISI
PSBA1_NOSS1      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRQLHFFLAAWPVIGIWFTALGVST
PSBA3_TRIV2      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRQLHFFLAAWPVIGIWFTALGVST
PSBA2_TRIV2      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRQLHFFLAAWPVIGIWFTALGVST
PSBA2_NOSS1      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRQLHFFLAAWPVIGIWFTALGVST
PSBA1_TRIEI      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWFTALGVST
PSBA2_TRIEI      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWFTALGVST
PSBA_PROMS       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVFPVVCVWLTSMGICT
PSBA_PROM0       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVFPVVCVWLTSMGICT
PSBA_PROM9       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVFPVVCVWLTSMGICT
PSBA_PROM5       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVFPVVCVWLTSMGICT
PSBA_PROMP       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAVFPVVCVWLTSMGICT
PSBA_PROMA       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAIFPVVCVWLTSMGICT
PSBA_PROM1       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLASWPVICVWLTSMGICT
PSBA_PROMT       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLASWPVICVWLTSMGICT
PSBA_PROM3       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVICIWITSLGIST
PSBA_PROMM       GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVICIWITSLGIST
PSBA2_SYNSC      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWFTSMGIST
PSBA2_SYNPX      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWFTSMGVST
PSBA1_SYNS9      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVIGIWFTSMGIST
PSBA2_SYNPW      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTSMGIST
PSBA3_SYNS3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFLLGAWPVVGIWFTSMGVST
PSBA2_SYNR3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTSMGIAT
PSBA1_SYNS3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA2_SYNS3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA1_SYNPX      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA3_SYNPX      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA1_SYNSC      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA2_SYNS9      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA1_SYNR3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA1_SYNPW      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTALGVST
PSBA1_SYNE7      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWFTSMGIST
PSBA3_SYNP6      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVVGIWFTSMGIST
PSBA2_SYNE7      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTSLGIST
PSBA1_SYNP6      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTSLGIST
PSBA2_SYNP6      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVVGIWFTSLGIST
PSBA2_SYNY3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLGAWPVIGIWFTAMGVST
PSBA1_TRIV2      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRSLHFFLAAWPVIGIWFAALGIST
PSBA1_SYNY3      GYKFGQEEETYNIVAAH-GYFGRLIFQYASFN--NSRALHFFLGAWPVVGIWFAALAVCC
PSBA1_SYNJB      GYRFGQEEVTYNFLAGHYAFLGRLGFPGLGLR--NSRSVHFWMAALPTVGIWAAAIGIGI
PSBA2_SYNJA      GYRFGQQEVTYNFLAGHYAFLGRLGIPSLGWR--NSRSVHFWMAALPTLGIWAAAIGIGL
                 .* :**   ** : *.* .::.** :   .    *** :** :.   .  :* :::.:  

PSBA1_GLOVI      MAFNLNGFNFNSSIVDSQGRAIYTWADIVNRANLGMEVMHERNAHNFPLDLAGTESAPVA
PSBA3_GLOVI      MAFNLNGFNFNSSIVDSQGRAIYTWADIVNRANLGMEVMHERNAHNFPLDLAGTESAPVA
PSBA2_GLOVI      MGFNLNGFNFNASITDNQGRTIYTWADIVNRANLGIEVMHERNAHNFPLDLAGTESAPVA
PSBA_THEVL       MAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLASAESAPVA
PSBA1_THEEB      MAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLASAESAPVA
PSBA3_THEEB      MAFNLNGFNFNHSVVDAQGNVINTWADIINRANLGMEVMHERNAHNFPLDLASAESAPVA
PSBA2_THEEB      MAFNLNGFNFNHSVVDAQGNVINTWADIINRANIGIEVMHERNAHNFPLDLASGELAPVA
PSBA_GOSHI       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTN
PSBA_LACSA       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTN
PSBA_SOLLC       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTN
PSBA_SOLTU       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTN
PSBA_SPIOL       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTN
PSBA_TOBAC       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTN
PSBA_CUSRE       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPATN
PSBA_SOYBN       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIDAPSIN
PSBA_PHAVU       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAMEAPSVN
PSBA_ARATH       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTN
PSBA_OENEH       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTN
PSBA_LOTJA       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSIN
PSBA_AMBTC       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTN
PSBA_HORVU       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEVPAIN
PSBA_WHEAT       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEVPSIN
PSBA_SACHY       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLN
PSBA_SACOF       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLN
PSBA_MAIZE       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPYLN
PSBA_ORYNI       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLN
PSBA_ORYSA       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLN
PSBA_ORYSI       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLN
PSBA_ORYSJ       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLN
PSBA_CUSGR       MAFNLNGFNFNQSVVDSKGHVINTWADIINRANLGMEVMHERNAHNFPLDLATFEVSATN
PSBA_CYCTA       MAFNLNGFNFNQSVVDGQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAVAEVTFID
PSBA_GNEPA       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVELDSID
PSBA_PINKO       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVESISIG
PSBA_PINTH       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVESISIG
PSBA_ANTAG       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVEAPSVN
PSBA_MARPO       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPAVN
PSBA_NEPOL       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVDAPAVQ
PSBA_ADICA       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVDAPSIN
PSBA_CHLVU       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAVVEAPAVN
PSBA_MESVI       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVEAPAVN
PSBA_CHLRE       MAFNLNGFNFNQSVVDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLASTNSSSNN
PSBA_BIGNA       MAFNLNGFNFNQSIIDSQGRVINSWADIINRANLGMEVMHERNAHNFPLDLA--------
PSBA_HETNI       MAFNLNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA--------
PSBA_HETPY       MAFNLNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA--------
PSBA_HETRO       MAFNLNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA--------
PSBA_PROMC       MAFNLNGLNFNQSLLDSSGHVVNSWADVVNRADLGMEVMHERNTHNFPLDLA--------
PSBA_AMPCA       MAFNLNGFNFNQSILDESGHYINSWADILNRADLGIEVMHERNAHNFPLDLA--------
PSBA_AMPOP       MAFNLNGFNFNQSILDESGHYINSWADILNRADLGIEVMHERNAHNFPLDLA--------
PSBA_KARMI       MAFNLNGLNFQQSILDASGCPINTWADILNRANLGMEVMHERNAHNFPLDLACANCLLSL
PSBA_EMIHU       MAFNLNGFNFNQSVVDSQGRVINTWADILNRSNLGMEVMHERNAHNFPLDLAAGESLPVA
PSBA_TRICV       MAFNLNGFNFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLASGDVLPVA
PSBA_THAPS       MAFNLNGFNFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLASGDVLPVA
PSBA_PHATC       MAFNLNGFNFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLASGEVLPVA
PSBA_PORPU       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASGESLPVA
PSBA_PYRYE       MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASGESLPVA
PSBA_GRATL       MAFNLNGFNFNQSVVDSQGRVINTWADILNRANLGMEVMHERNAHNFPLDLASSNSLPVS
PSBA_GUITH       MAFNLNGFNFNQSVVDSQGRVINTWADILNRANLGIEVMHERNAHNFPLDLASGESLPVA
PSBA_CYACA       MAFNLNGLNFNQSIVDSQGRVINTWADIINRANLGIEVMHERNAHNFPLDLADNSLLPVA
PSBA_CYAM1       MAFNLNGFNFNQSVVDSEGRVINTWADILNRANLGIEVMHERNAHNFPLDLASNSVVPVA
PSBA_CYAPA       MAFNLNGLNFNQSVVDSQGRVISTWADIINRANLGMEVMHERNAHNFPLDLASGEVMPVA
PSBA_EUGGR       MAFNLNGFNFNQSVIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA--------
PSBA1_SYNJA      MAFNLNGFNFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLAAVEVAPAI
PSBA3_SYNJA      MAFNLNGFNFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLAAVEVAPAV
PSBA2_SYNJB      MAFNLNGFNFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLAAVEVAPAV
PSBA1_NOSS1      MAFNLNGFNFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAGEVAPVA
PSBA3_TRIV2      MAFNLNGFNFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAGEVAPVA
PSBA2_TRIV2      MAFNLNGFNFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAGEVAPVA
PSBA2_NOSS1      MAFNLNGFNFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAGEVAPVA
PSBA1_TRIEI      MAFNLNGFNFNQSIIDSSGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVE-----
PSBA2_TRIEI      MAFNLNGFNFNQSIIDSSGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVE-----
PSBA_PROMS       MAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTTVA
PSBA_PROM0       MAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTTVA
PSBA_PROM9       MAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTTVA
PSBA_PROM5       MAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTTVA
PSBA_PROMP       MAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTTVA
PSBA_PROMA       MAFNLNGFNFNQSVVDANGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTSVA
PSBA_PROM1       MAFNLNGFNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTSVA
PSBA_PROMT       MAFNLNGFNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLAAAESTSVA
PSBA_PROM3       MAFNLNGFNFNQSVLDAQGRVVPTWADVLNRSNLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA_PROMM       MAFNLNGFNFNQSVLDAQGRVVPTWADVLNRSNLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA2_SYNSC      MAFNLNGFNFNQSILDSQGRVLNTWADVLNRANLGMEVQHERNAHNFPLDLAAAESTPVA
PSBA2_SYNPX      MAFNLNGFNFNQSILDGQGRVVNTWADMVNRAGLGMEVMHERNAHNFPLDLATVESTPVA
PSBA1_SYNS9      MAFNLNGFNFNQSILDGQGRVVSTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA2_SYNPW      MAFNLNGFNFNQSVLDAQGRVLNTWADVLNRANLGMEVMHERNAHNFPLDLAATESTPVA
PSBA3_SYNS3      MAFNLNGFNFNQSILDSQGRVLNTWADMVNRAGLGMEVMHERNAHNFPLDLATVESTPVA
PSBA2_SYNR3      MAFNLNGFNFNQSILDAQGKVVPTWADVLNRANLGMEVMHERNAHNFPLDLATTESAPVA
PSBA1_SYNS3      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA2_SYNS3      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA1_SYNPX      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA3_SYNPX      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA1_SYNSC      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA2_SYNS9      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA1_SYNR3      MAFNLNGFNFNQSILDSQGRVLNTWADILNRAGLGMEVMHERNAHNFPLDLAAAESAPVA
PSBA1_SYNPW      MAFNLNGFNFNQSILDGQGRVLNTWADVLNRANLGMEVMHERNAHNFPLDLAAAESTPVA
PSBA1_SYNE7      MAFNLNGFNFNQSVLDSQGKVINTWADVLNRANLGMEVMHERNAHNFPLDLAAGEATPVA
PSBA3_SYNP6      MAFNLNGFNFNQSVLDSQGKVINTWADVLNRANLGMEVMHERNAHNFPLDLAAGEATPVA
PSBA2_SYNE7      MAFNLNGFNFNQSVLDSQGRVINTWADVLNRANLGMEVMHERNAHNFPLDLAAGEATPVA
PSBA1_SYNP6      MAFNLNGFNFNQSVLDSQGRVINTWADVLNRANLGMEVMHERNAHNFPLDLAAGEATPVA
PSBA2_SYNP6      MAFNLNGFNFNQSVLDSQGRVINTWADVLNRANLGMEVMHERNAHNFPLDLAAGEATPVA
PSBA2_SYNY3      MAFNLNGFNFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLASGEQAPVA
PSBA1_TRIV2      MSFNLNGFNFNNSILDHQGRTIDTWADLLNRANLGIEVMHERNAHNFPLDLASGEVQPIA
PSBA1_SYNY3      FAFNLNGFNFNQSILDAQGRPVSTWADVINRANIGFEVMHERNVHNFPLDLASGDAQMVA
PSBA1_SYNJB      MAFNLNGLNFNQSILDSQGRFIPTYADLLNRANLGIQVMHAPNAHHFPLLLAAQP-----
PSBA2_SYNJA      MAFNLNGFNFNQSILDSQGRFIPTYADLLNRANLGIQAMHAPNAHHFPLLLAAKAD----
                 :.*****:**: *: * .*  : ::.*::**:.:*::. *  *.*:*** **        

PSBA1_GLOVI      VGNADLNG
PSBA3_GLOVI      VSTAKVGG
PSBA2_GLOVI      FAAALGDG
PSBA_THEVL       MIAPSING
PSBA1_THEEB      MIAPSING
PSBA3_THEEB      MIAPSING
PSBA2_THEEB      MIAPSIEA
PSBA_GOSHI       G-------
PSBA_LACSA       G-------
PSBA_SOLLC       G-------
PSBA_SOLTU       G-------
PSBA_SPIOL       G-------
PSBA_TOBAC       G-------
PSBA_CUSRE       G-------
PSBA_SOYBN       G-------
PSBA_PHAVU       G-------
PSBA_ARATH       G-------
PSBA_OENEH       G-------
PSBA_LOTJA       G-------
PSBA_AMBTC       G-------
PSBA_HORVU       G-------
PSBA_WHEAT       G-------
PSBA_SACHY       G-------
PSBA_SACOF       G-------
PSBA_MAIZE       G-------
PSBA_ORYNI       G-------
PSBA_ORYSA       G-------
PSBA_ORYSI       G-------
PSBA_ORYSJ       G-------
PSBA_CUSGR       A-------
PSBA_CYCTA       G-------
PSBA_GNEPA       G-------
PSBA_PINKO       G-------
PSBA_PINTH       G-------
PSBA_ANTAG       G-------
PSBA_MARPO       G-------
PSBA_NEPOL       G-------
PSBA_ADICA       G-------
PSBA_CHLVU       G-------
PSBA_MESVI       G-------
PSBA_CHLRE       --------
PSBA_BIGNA       --------
PSBA_HETNI       --------
PSBA_HETPY       --------
PSBA_HETRO       --------
PSBA_PROMC       --------
PSBA_AMPCA       --------
PSBA_AMPOP       --------
PSBA_KARMI       WPMVG---
PSBA_EMIHU       LVAPAVAA
PSBA_TRICV       LNAPAVNG
PSBA_THAPS       FTAPAVNA
PSBA_PHATC       LTAPAVNG
PSBA_PORPU       LTAPAVNG
PSBA_PYRYE       LTAPAVNG
PSBA_GRATL       LVAPSVNG
PSBA_GUITH       LTAPAVIG
PSBA_CYACA       SSSPSINS
PSBA_CYAM1       LTAPSVEA
PSBA_CYAPA       LTAPSINA
PSBA_EUGGR       --------
PSBA1_SYNJA      RG------
PSBA3_SYNJA      RG------
PSBA2_SYNJB      RG------
PSBA1_NOSS1      LTAPAING
PSBA3_TRIV2      LTAPAING
PSBA2_TRIV2      LTAPAING
PSBA2_NOSS1      ISAPAING
PSBA1_TRIEI      --APSIKG
PSBA2_TRIEI      --APSIKG
PSBA_PROMS       LSAPAIG-
PSBA_PROM0       LSAPAIG-
PSBA_PROM9       LSAPAIG-
PSBA_PROM5       LTAPAIG-
PSBA_PROMP       LTAPAIG-
PSBA_PROMA       LVAPSIG-
PSBA_PROM1       LVAPAIG-
PSBA_PROMT       LVAPAIG-
PSBA_PROM3       LIAPAIG-
PSBA_PROMM       LIAPAIG-
PSBA2_SYNSC      LQAPAIG-
PSBA2_SYNPX      LQAPAIG-
PSBA1_SYNS9      LQAPAIG-
PSBA2_SYNPW      LQAPTIG-
PSBA3_SYNS3      LQAPAIG-
PSBA2_SYNR3      LQAPAVG-
PSBA1_SYNS3      LQAPAIG-
PSBA2_SYNS3      LQAPAIG-
PSBA1_SYNPX      LQAPAIG-
PSBA3_SYNPX      LQVPAIG-
PSBA1_SYNSC      LQAPAIG-
PSBA2_SYNS9      LQAPAIG-
PSBA1_SYNR3      LQAPAIG-
PSBA1_SYNPW      LQAPAIG-
PSBA1_SYNE7      LTAPSIHG
PSBA3_SYNP6      LTAPSIHG
PSBA2_SYNE7      LTAPAING
PSBA1_SYNP6      LTAPAING
PSBA2_SYNP6      LTAPAING
PSBA2_SYNY3      LTAPAVNG
PSBA1_TRIV2      LAAPAIAS
PSBA1_SYNY3      LNAPAIEG
PSBA1_SYNJB      --------
PSBA2_SYNJA      --------