CLUSTAL format seed alignment for MF_01380

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ERPA_ACIAC       --------MSAVAENI---QTE------MPAPIVFTDSAAAKVADLIAEE---GNPDLKL
ERPA_VEREI       --------MSAVAENI---QTG------MPAPILFTDSAAAKVAQLIAEE---GNPELKL
ERPA_RHOFT       --------MSAVAETI---QTE------MPSPILFTDSAAAKVADLIAEE---GNPDLKL
ERPA_ACISJ       --------MSAVAENT---TTE------MPAPILFTDSAAAKVAELIAEE---GNPDLKL
ERPA1_POLNA      --------MSAVAENI---QTE------MPAPFVFTDSAASKVAELIAEE---GNPDLKL
ERPA_POLSJ       --------MSAVAEII---QTE------MPAPFVFTDSAAAKVAELIAEE---GNPDLKL
ERPA_HERAR       --------MNAIAE--------------MPSPILFSDSAAAKVAELIEDE---GNPDLKL
ERPA_JANMA       --------MNAVAE--------------MPSPIVFSDSAAMKVAELIEEE---GNPDLKL
ERPA_METPP       --------MSAVAEHI---ATQ------MPAPIVFTDSAAGKVKELVEEE---GNPELKL
ERPA_BURCA       --------MNAVTETA-ATTTD------MPLPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURCH       --------MNAVTETA-ATTTD------MPLPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURCM       --------MNAVTESA-ATTAE------MPVPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURL3       --------MNAVTESA-ATTAE------MPVPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA1_BURVG      --------MNAVNESA-ATTAE------MPVPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURMA       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURM9       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURM7       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURMS       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURPS       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURP0       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURP1       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURP6       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA_BURTA       --------MNAVTESA-ATT-E------MPAPFVFTDAAADKVKQLIDEE---GNPDLKL
ERPA1_PARXL      --------MNAVTDTP-VTE--------MPAPFVFTDAAADKVKQLIEEE---GNADLKL
ERPA_CUPNH       --------MNAVAEA--PVTED------VPAPFVFTDSAADKVKQLIEEE---GNAELKL
ERPA_CUPPJ       --------MNAVAEA--PVTED------VPAPFVFTDSAADKVKQLIEEE---GNAELKL
ERPA_CUPMC       --------MNAVAEA--PATED------VPAPFVFTDSAADKVKQLIEEE---GNAELKL
ERPA_RALSO       --------MNAVAQAATPDVNE------VPAPLVFTDSAADKVKQLIEEE---GNPELKL
ERPA_THIDA       --------MNATTE--------------MESPLVFTDSAASKVKSLIDEE---GNPDLKL
ERPA_BORBR       --------MNAVTETV-DLQAP------PPVPLVFTDSAAAKVKDLLAEE---GNPELKL
ERPA_BORPA       --------MNAVTETV-DLQAP------PPVPLVFTDSAAAKVKDLLAEE---GNPELKL
ERPA_BORPE       --------MNAVTETV-DLQAP------PPVPLVFTDSAAAKVKDLLAEE---GNPELKL
ERPA_BORA1       --------MNAITETV-DLQAP------PPVPLVFTDSAAAKVKDLLAEE---GNPELKL
ERPA_METFK       --------MNAVTEEI-------------PSPLIFTDNAARKVKELIDEE---GSPDLKL
ERPA_AZOSB       --------MNAAVET--------------PEILVFTDNAANKVRELIDEE---GNPALKL
ERPA_AROAE       --------MNTVVDT--------------PELMVFTDSAAMKVKELIEEE---GNPELKL
ERPA_DECAR       --------MNAVNEM--------------AVPFVFTDNAAGKVKELIEEE---GNPGLKL
ERPA_NITOC       --------MNVTNA--------------MPNPLIFTDIAAGKVKELIEEE---GNDKLML
ERPA_NITEU       --------MGTTIHEETSAAQP---------PLNFTDGAASKVKELIEEE---DNQALKL
ERPA_NITEC       --------MNTITHEEANTVQP---------PLFFTDSAASKVKELIEEE---ANQALKL
ERPA_NITMU       --------MNTPFNDGSGQTDPMTD---IPTPLIFTDNAANKVRELIEEE---GNNDLKL
ERPA_MARN8       --------MAT--------------------PLFFTDNAVAKVRELIEEE---ENPDLKL
ERPA_NEIG1       --------MSDE------------------SPIIFTDSCCAKVADLIAEE---NNPDLKL
ERPA_NEIMA       --------MSDE------------------SPIIFTDSCCAKVADLIAEE---NNPDLKL
ERPA_NEIMB       --------MSDE------------------SPIIFTDSCCAKVADLIAEE---NNPDLKL
ERPA_NEIMF       --------MSDE------------------SPIIFTDSCCAKVADLIAEE---NNPDLKL
ERPA_CHRVO       --------MTEAA-----TE--------MPSPINFTESACAKVQDLIAEE---GNPDLKL
ERPA_ALKEH       --------MSETAQSYDPTE--------DFQALVVTDSAAARVAQLIAQE---ESDDLKL
ERPA2_METCA      --------MTSELGIFYRSDFDRAWCDMSAETIKFTDSAAQRVSELLAEE---GDQNLKL
ERPA1_METCA      --------MTSIVDLTP-----------SEPALIFTGNAAAKVSELIAEE---GNPALKL
ERPA_HAHCH       --------MNVAETYE-------------PTPIIFTDNAAAKVKSLIEDE---GNDELSL
ERPA_SACD2       --------MSAPQTFV-------------PEPVQVTENALAKVKALIEEE---GNPDLKL
ERPA_PSEAE       --------MSI-ETFT-------------PTPLLFTPGAANKVKTLIDEE---GNPRLKL
ERPA_PSEAB       --------MSI-ETFT-------------PTPLLFTPGAANKVKTLIDEE---GNPRLKL
ERPA_PSE14       --------MSV-ESFT-------------PTALEFTPNAAHKVKTLVDEE---GNDRLKL
ERPA_PSEU2       --------MSV-ESFT-------------PTALEFTPNAAHKVKTLVDEE---GNDRLKL
ERPA_PSESM       --------MSV-ESFT-------------PTALEFTPNAAHKVKTLVDEE---GNDRLKL
ERPA_PSEE4       --------MSV-ESFT-------------PTALEFTPGAAHKVKTLVSEE---GNDRLKL
ERPA_PSEF5       --------MSV-ESFT-------------PTALQFTQGAAHKVKTLVDEE---GNDRLKL
ERPA_PSEPF       --------MSV-ESFT-------------PTALQFTQGAAHKVKSLVDEE---GNDRLKL
ERPA_PSEPK       --------MSV-ETFT-------------PTGLEFTHGAAQKVKNLVNEE---GNERLKL
ERPA_PSEU5       --------MSV-ESFT-------------PTAIQFSQGAASKVKSLVDEE---GNPRLKL
ERPA_ECOLI       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_SHIBS       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_ECOL6       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_ECOL5       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_ECOK1       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_ECO57       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_ECOUT       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_SHIF8       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_SHISS       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_SHIDS       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_SHIFL       --------MSDDV----------------ALPLEFTDAAANKVKSLIADE---DNPNLKL
ERPA_SALCH       --------MSDDV----------------ALPLQFTDAAANKVKSLIADE---DNPNLKL
ERPA_SALPA       --------MSDDV----------------ALPLQFTDAAANKVKSLIADE---DNPNLKL
ERPA_SALTI       --------MSDDV----------------ALPLQFTDAAANKVKSLIADE---DNPNLKL
ERPA_SALTY       --------MSDDV----------------ALPLQFTDAAANKVKSLIADE---DNPNLKL
ERPA_CROS8       --------MSDDV----------------ALPLQFTDAAANKVKSLIADE---DNPNLKL
ERPA_YERPE       --------MSNET----------------VLPLQFTEAAAKKVKLLISDE---ENPNLKL
ERPA_YERPA       --------MSNET----------------VLPLQFTEAAAKKVKLLISDE---ENPNLKL
ERPA_YERPS       --------MSNET----------------VLPLQFTEAAAKKVKLLISDE---ENPNLKL
ERPA_YERPN       --------MSNET----------------VLPLQFTEAAAKKVKLLISDE---ENPNLKL
ERPA_YERPP       --------MSNET----------------VLPLQFTEAAAKKVKLLISDE---ENPNLKL
ERPA_YERE8       --------MSDET----------------VLPLQFTEAAAKKVKLLISDE---ENPNLKL
ERPA_PHOLL       -------MMSDDI----------------VLPLQFTDAAANKVKILVSDE---ENPNLRL
ERPA_PECAS       -------MSDDIA----------------ALPLQFTDAAASKVKNLIADE---ENPELKL
ERPA_SODGM       --------MSETA----------------TLPLRFTDSAASKVKNLIADE---ENPNLKL
ERPA_ACTP2       --------MSNI-----------------QIPLIFTDAAAKKVKSLIEGE---DNPNLRL
ERPA_HAEDU       --------MSDID----------------QIPLTFTDAAAKKVKSLIEGE---DNPNLRL
ERPA_AERHH       --------MSAVAE--------------APLPIQMTDAAANKVKTLITEE---ENPELKL
ERPA_AERS4       --------MSAVAE--------------APLPIQMTDAAANKVKNLITEE---ENPELKL
ERPA_COLP3       --------MSNP-----------------ELPIKFTDSAASKVLSLITEE---ENPALKL
ERPA_PSET1       --------MSE------------------ELPIKFTDAAADRVKQLIDEE---ENPELKL
ERPA_IDILO       --------MSSAA--E------------QAMPIEFTEQAASKVGKLIAEE---ENPNLKL
ERPA_PSYIN       --------MTSEVQVE------------VAMPIYFSDSAANKVKGLIAEE---ENPNMKL
ERPA_SHESA       --------MTDQAD--------------AAMPIKFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHESM       --------MTDQAD--------------AAMPIKFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHESR       --------MTDQAD--------------AAMPIKFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHEON       --------MTDQAD--------------ATMPIKFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHEPC       --------MTEQAD--------------AAMPIQFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHESW       --------MTEQAD--------------AAMPIQFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHELP       --------MTEQAE--------------DTMPIRFTDAAAAKVKTLLEEE---QNDALKL
ERPA_SHEAM       --------MTEQTD--------------VAMPISFTDAAAAKVKALLDEE---QNDALKL
ERPA_SHEB5       --------MTDQAD--------------TAMPIQFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHEB8       --------MTDQAD--------------TAMPIQFTDAAAAKVKGLLEEE---QNPALKL
ERPA_SHEFN       --------MTEQVD--------------ATMPIQFTDAAAIKVKGLLEEE---QNPELKL
ERPA_SHEDO       --------MTEQTD--------------AAMPIKFTDAAAIKVKGLLEEE---QNPELKL
ERPA_PSEA6       --------MSVQT----------------AVPIEFSDAAARKVKALVEEE---ENPNLKL
ERPA_HAEIN       -------MIDDM-----------------AVPLTFTDAAANKVKSLISEE---ENTDLKL
ERPA_HAEIE       -------MIDDI-----------------AVPLTFTDAAANKVKSLISEE---ENTDLKL
ERPA_HAEI8       -------MIDDM-----------------AVPLTFTDAAANKVKSLISEE---ENTNLKL
ERPA_HAEIG       -------MIDDM-----------------AVPLTFTDAAANKVKSLISEE---ENTNLKL
ERPA_MANSM       --------MTDM-----------------TIPLTFTDAAAKKVKNLIIEE---ENQDLKL
ERPA_PASMU       -------MMTEI-----------------SVPLIFTDAAANKVKALISEE---ENPNLKL
ERPA_HAES1       --------MADL-----------------AVPLTFTDAAANKVKTLISEE---ENTELKL
ERPA_VIBCB       --------MSEV-----------------NVPLSFSDAAASRVKALIAEE---ENPALKL
ERPA_VIBPA       --------MSEV-----------------NVPLSFSDAAASRVKALIAEE---ENPALKL
ERPA_VIBCH       --------MSEV-----------------NVPLSFSDAAAKRVKALIAEE---ENPSLML
ERPA_VIBVU       --------MSDI-----------------NLPLSFSDAAAARVKMLIAEE---ENPALKL
ERPA_VIBVY       --------MSDI-----------------NLPLSFSDAAATRVKMLIAEE---ENPALKL
ERPA_PHOPR       --------MSDA-----------------NVPLSFSDVAANKVKTLIAEE---ENPELKL
ERPA_ALIF1       --------MSDV-----------------SVPLTFSDVAAAKVKTLIAEE---ENPNLKL
ERPA_BLOFL       --------MSNDKKN--------------AFPIKLTHSAADQVKKLISSQDYAEKLDLKL
ERPA_BLOPB       --------MNNDAK----------------FPIQLTDFAARKVKFFTENEIINSNSHLKL
ERPA_BUCAI       --------MENAFK----------------SHLQFTEKAIKKIKNLIEIE---KNHDLKL
ERPA_BUCAP       --------MEKNPI----------------KYIEFTNSAAKKIKSIIKEK---KNKNVKL
ERPA_BUCBP       -------MKNNISK----------------FPLSFSKSAIKKIKTIISEK---NIPNLKF
ERPA_BUCCC       -----------MLK----------------HQIKITINAIKKIKKLLLKK---KNFKLKL
ERPA_WIGBR       --------MENNKL----------------FNLKLTDLAKNKIKNLLKEE---KNKNKKF
ERPA_BAUCH       --------MNEMIR----------------FPLQLTDSAINRIKTLIAEE---ANPHLKF
ERPA_ALCBS       -------MSADSESMI------------ESAPISFTDAAAAKVKELRDDE---GNPNLKL
ERPA_ACIBT       ---------------M------------NAQALVLTDNAANKVRQLRDSE---GNDDLML
ERPA_ACIAD       ---------------M------------NAQALVITDNAAKKVRQLRDSE---GNQDLML
ERPA_PSYA2       MNQPANQFNPSSSQPV------------DPTVLNLTDSAAQKVRRLREEE---GDSNLML
ERPA_PSYCK       MNQPANQFNPSSSQPV------------DPTVLNLTDSAAQKVRRLREEE---GDSNLML
ERPA_CHRSD       ---------MSGAESF------------VPAPMYLTDAAAQRLGALVEEE---GNPGLKL
ERPA_HALHL       ---MSDIAEPETHAPA------------DDQLLIFTDAAADKVRELLDGE---EGGDVKL
ERPA_COXBU       --MNALAQKTPSPP-----------------TLVFTEAAVRKVKGLIDEE---NNPYLNL
ERPA_HYDCU       --------MSEMPT-----------------PVNFTEAAASKVSGLIQDE---GNPELKL
ERPA_FRATH       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_FRATO       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_FRATF       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_FRATN       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_FRATT       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_FRAT1       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_FRATW       -----MSEVVQSVD-----------------PINFTEAASLKVKELIEEE---GDNSLSL
ERPA_LEGPC       ---MASVDVSQNTS-----------------DIHFSVSAADKVAELIKEE---DNSNLNL
ERPA_LEGPA       ---MASVDVSQNTS-----------------DIHFSVSAADKVAELIKEE---DNSNLNL
ERPA_LEGPL       ---MASVDVSQNTS-----------------DINFSVSAADKVAELIKEE---DNSDLNL
ERPA_LEGPH       ---MANLDVSQNTS-----------------DIHFSVSAADKVAELIKEE---DNSNLNL
ERPA_XANAC       --MSTLVSLPTAAPAP--------DYQSIDRPLNFSVAAAAKVRELIQEE---GNADLAL
ERPA_XANC5       --MSTLVSLPTVAPAP--------DYQSIDRPLNFSVAAAAKVRELIQEE---GNADLAL
ERPA_XANCP       --MSTLVSLPTAAPAP--------DYQSIDRPLNFSNAAAAKVRELIQEE---GNAELAL
ERPA_XANC8       --MSTLVSLPTAAPAP--------DYQSIDRPLNFSNAAAAKVRELIQEE---GNAELAL
ERPA_XANOR       --MSTLVSLPTAAPAP--------DYQSIDRPLHFSVAAAAKVRELIQEE---GNADLAL
ERPA_XANOM       --MSTLVSLPTAAPAP--------DYQSIDRPLHFSVAAAAKVRELIQEE---GNADLAL
ERPA_XYLFA       --MTMLISLPTAPSVP--------NYQSLERPLNFTMAAAAKVRELIQEE---NNADLAL
ERPA_XYLFT       --MTMLISLPTAPSVP--------NYQSLERPLNFTMAAAAKVRELIQEE---NNADLAL
ERPA_RUTMC       ---METKQALEKAD------------------IIFSDNAAKKVSTLIEEE---KNENLHL
ERPA_VESOH       ---MEIKQISEKAD------------------IIFSDNAAKKVSTLIEEE---QNNNLYL
ERPA2_BURVG      -----MELLQPSADAA---------PVPLPAFLDFTPNAAAKVAALIDAE---GNPQLKL
ERPA2_PARXL      -----MQTLAQPAAAT---------SGALPALLEFTRQAAAKVASLIEEE---GNPNLKL
ERPA2_POLNA      ----MEAALNIASPSL---------PGVMPGQLEFTTSAAAKVSELIVEE---GNPNLKL
                                                 . .:  .      :   :         :

ERPA_ACIAC       RVFVQGGGCSGFQYGFTFDEITNEDDTTMT---------------KNGVSLLIDAMSYQY
ERPA_VEREI       RVFVQGGGCSGFQYGFTFDEITNEDDTTMT---------------KNGVSLLIDAMSYQY
ERPA_RHOFT       RVFVQGGGCSGFQYGFTFDEITNEDDTTMT---------------KNGVSLLIDAMSYQY
ERPA_ACISJ       RVFVQGGGCSGFQYGFTFDEITNEDDTTMT---------------KNGVSLLIDAMSYQY
ERPA1_POLNA      RVFVQGGGCSGFQYGFTFDEITNEDDTTMT---------------KNGVSLLIDAMSYQY
ERPA_POLSJ       RVFVQGGGCSGFQYGFTFDEITNEDDTTMT---------------KNGVSLLIDAMSYQY
ERPA_HERAR       RVFVQGGGCSGFQYGFTFDEIVNEDDTTMT---------------KNGVQLLIDSMSYQY
ERPA_JANMA       RVFVQGGGCSGFQYGFTFDEIVNEDDTTMT---------------KNGVQLLIDSMSYQY
ERPA_METPP       RVFVQGGGCSGFQYGFTFDEIVNDDDTKME---------------KNGVMLLIDAMSLQY
ERPA_BURCA       RVFVQGGGCSGFQYGFTFDEEVNEDDTVMN---------------KNGVQLLIDSMSYQY
ERPA_BURCH       RVFVQGGGCSGFQYGFTFDEEVNEDDTVMN---------------KNGVQLLIDSMSYQY
ERPA_BURCM       RVFVQGGGCSGFQYGFTFDEEVNEDDTVMN---------------KNGVQLLIDSMSYQY
ERPA_BURL3       RVFVQGGGCSGFQYGFTFDEEVNEDDTVMN---------------KNGVQLLIDSMSYQY
ERPA1_BURVG      RVFVQGGGCSGFQYGFTFDEEVNEDDTVMD---------------KNGVQLLIDSMSYQY
ERPA_BURMA       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURM9       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURM7       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURMS       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURPS       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURP0       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURP1       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURP6       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA_BURTA       RVFVQGGGCSGFQYGFTFDEEVNEDDTVLN---------------KNGVVLLVDAMSYQY
ERPA1_PARXL      RVFVQGGGCSGFQYGFTFDEAVNEDDTVMN---------------KSGVQLLIDSMSYQY
ERPA_CUPNH       RVFVQGGGCSGFQYGFTFDEEVNEDDTTMV---------------KNGVTLLIDSMSYQY
ERPA_CUPPJ       RVFVQGGGCSGFQYGFTFDEEVNEDDTTMV---------------KNGVTLLIDSMSYQY
ERPA_CUPMC       RVFVQGGGCSGFQYGFTFDEDVNEDDTTMV---------------KNGVTLLIDSMSYQY
ERPA_RALSO       RVFVQGGGCSGFQYGFTFDEDTNEDDTTMT---------------KNGVTLLIDSMSYQY
ERPA_THIDA       RVFVSGGGCSGFQYGFTFDEAQNADDTVMV---------------KNGVTLLVDSMSFQY
ERPA_BORBR       RVFVQGGGCSGFQYGFTFDEVVNDDDTVLD---------------KAGVQLLVDPMSFQY
ERPA_BORPA       RVFVQGGGCSGFQYGFTFDEVVNDDDTVLD---------------KAGVQLLVDPMSFQY
ERPA_BORPE       RVFVQGGGCSGFQYGFTFDEVVNDDDTVLD---------------KAGVQLLVDPMSFQY
ERPA_BORA1       RVFVQGGGCSGFQYGFTFDEVVNEDDTVLD---------------KEGVQLLVDPMSFQY
ERPA_METFK       RVFVSGGGCSGFQYGFTFEETINEDDTTVD---------------KDGVTLLIDPMSLQY
ERPA_AZOSB       RVFVTGGGCSGFQYGFTFDEEVNEDDTAFE---------------KNGVTLLIDPMSYQY
ERPA_AROAE       RVFVSGGGCSGFQYGFTFDEEVNEDDTAFE---------------KNGVTLLVDPMSYQY
ERPA_DECAR       RVFVTGGGCSGFQYGFTFDEEVNEDDTTME---------------KNGVTLLIDPMSYQY
ERPA_NITOC       RVFITGGGCSGFQYGFTFDETSHEGDTRVK---------------NGGVTLLIDPTSYQY
ERPA_NITEU       RVFVSGGGCSGFQYGFTFDEIVNEDDFVME---------------KQGVKLLVDSMSFQY
ERPA_NITEC       RVFVSGGGCSGFQYGFTFDEIINEDDFVIE---------------KQGVRLLVDSMSVQY
ERPA_NITMU       RVFVAGGGCSGFKYGFTFDELISEDDTVME---------------KNGVKLLVDAMSFQY
ERPA_MARN8       RVFVTGGGCSGFQYGFSFDESQEEDDTVIE---------------RDGVKLLVDSMSYQY
ERPA_NEIG1       RVFVNGGGCSGFQYGFTFDEIKNDDDFEIE---------------KNGLVFLVDPMSYQY
ERPA_NEIMA       RVFVNGGGCSGFQYGFTFDEIKNDDDFEIE---------------KNGLVFLVDPMSYQY
ERPA_NEIMB       RVFVNGGGCSGFQYGFTFDEIKNDDDFEIE---------------KNGLVFLVDPMSYQY
ERPA_NEIMF       RVFVNGGGCSGFQYGFTFDEIKNDDDFEIE---------------KNGLVFLVDPMSYQY
ERPA_CHRVO       RVFVTGGGCSGFQYGFTFDEIANEDDTAIE---------------RQGVTFLVDPMSYQY
ERPA_ALKEH       RVFVSGGGCSGFQYGFTFDERIEEGDSVVE---------------KDGVTFLVDPMSSQY
ERPA2_METCA      RVYVTGGGCSGFQYGFTFDEVVNEDDTVVE---------------KNGVSVLVDPMSLQY
ERPA1_METCA      RVYVSGGGCSGMQYGFAFEEAVNEDDTTVE---------------KDGVVLLVDPTSLQY
ERPA_HAHCH       RVFVTGGGCSGFQYGFSFDEAVNEDDTIVE---------------KDGVRLVVDSLSYQY
ERPA_SACD2       RVFVTGGGCSGFQYGFAFDEACAEDDAKIE---------------RDGVTVVVDAMSYPY
ERPA_PSEAE       RVFVTGGGCSGFQYGFTFDEDIADDDTVIE---------------RDGVGLVVDPMSFQY
ERPA_PSEAB       RVFVTGGGCSGFQYGFTFDEDIADDDTVIE---------------RDGVGLVVDPMSFQY
ERPA_PSE14       RVFVTGGGCSGFQYGFTFDEDVADDDTIVE---------------REGVSLVVDPMSFQY
ERPA_PSEU2       RVFVTGGGCSGFQYGFTFDEDVADDDTIVE---------------REGVSLVVDPMSFQY
ERPA_PSESM       RVFVTGGGCSGFQYGFTFDEDVADDDTIVE---------------REGVSLVVDPMSFQY
ERPA_PSEE4       RVFVTGGGCSGFQYGFTFDEDVAEDDTIVE---------------REGVALVVDPMSFQY
ERPA_PSEF5       RVFVTGGGCSGFQYGFTFDEEVAEDDTIVE---------------REGVSLVVDPMSFQY
ERPA_PSEPF       RVFVTGGGCSGFQYGFTFDEDVAEDDTIVE---------------REGVSLVVDPMSFQY
ERPA_PSEPK       RVFVTGGGCSGFQYGFTFDEDVAEDDTIVE---------------REGVSLVVDPMSFQY
ERPA_PSEU5       RVFVTGGGCSGFQYGFTFDEDVADDDTVIE---------------REGVSLVVDPMSYQY
ERPA_ECOLI       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SHIBS       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_ECOL6       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_ECOL5       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_ECOK1       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_ECO57       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_ECOUT       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SHIF8       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SHISS       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SHIDS       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SHIFL       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SALCH       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SALPA       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SALTI       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_SALTY       RVYITGGGCSGFQYGFTFDDQVNEGDMTIE---------------KQGVGLVVDPMSLQY
ERPA_CROS8       RVYITGGGCSGFQYGFTFDDQINDGDMTIE---------------KQGVSLVVDPMSLQY
ERPA_YERPE       RVYITGGGCSGFQYGFTFDDQVNDGDMTIE---------------KQGVELVVDPMSLQY
ERPA_YERPA       RVYITGGGCSGFQYGFTFDDQVNDGDMTIE---------------KQGVELVVDPMSLQY
ERPA_YERPS       RVYITGGGCSGFQYGFTFDDQVNDGDMTIE---------------KQGVELVVDPMSLQY
ERPA_YERPN       RVYITGGGCSGFQYGFTFDDQVNDGDMTIE---------------KQGVELVVDPMSLQY
ERPA_YERPP       RVYITGGGCSGFQYGFTFDDQVNDGDMTIE---------------KQGVELVVDPMSLQY
ERPA_YERE8       RVYITGGGCSGFQYGFTFDDQINDGDMTIE---------------KQGVELVVDPMSLQY
ERPA_PHOLL       RVYITGGGCSGFQYGFTFDDQINEGDMTIE---------------KQGVELVVDPMSLQY
ERPA_PECAS       RVYITGGGCSGFQYGFTFDDQINDGDMTIE---------------KQGVALVVDPMSLQY
ERPA_SODGM       RVYITGGGCSGFQYGFTFDDKVNEDDFTIE---------------KQGVALVVDPMSLQY
ERPA_ACTP2       RVYITGGGCSGFQYGFTFDDQINEGDLTIE---------------NQNVGLVVDPMSLQY
ERPA_HAEDU       RVYITGGGCSGFQYGFTFDDKINEGDLTIE---------------NQNVGLIVDPMSLQY
ERPA_AERHH       RVYITGGGCSGFQYGFTFDEKINEGDTVVE---------------KSGVTMVIDPMSLQY
ERPA_AERS4       RVYITGGGCSGFQYGFTFDEKINEGDTVVE---------------KSGVTMVIDPMSLQY
ERPA_COLP3       RVYVTGGGCSGFQYGFTFDEKVNDGDMTIE---------------KQGVMMVIDPMSLQY
ERPA_PSET1       RVYVTGGGCSGFQYGFTFDEKANPGDLEIV---------------KNGVMLVVDPMSLQY
ERPA_IDILO       RVYVTGGGCSGFQYGFTFDEKKNPGDMEIE---------------KNGVTLLVDPMSLQY
ERPA_PSYIN       RVYVTGGGCSGFSYGFTFAETANEDDTKIE---------------NAGVTLLVDPMSLQY
ERPA_SHESA       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHESM       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHESR       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHEON       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHEPC       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHESW       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHELP       RVYVTGGGCSGFQYGFTFDEKVNEGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHEAM       RVYVTGGGCSGFQYGFTFDEKVNDGDFTVE---------------KQGVQLVVDPMSLQY
ERPA_SHEB5       RVYVTGGGCSGFQYGFTFDEKVNDGDFTIE---------------KQGVLLVVDPMSLQY
ERPA_SHEB8       RVYVTGGGCSGFQYGFTFDEKVNDGDFTIE---------------KQGVLLVVDPMSLQY
ERPA_SHEFN       RVYVTGGGCSGFQYGFTFDEKVNEGDFTIE---------------KQGVQLVVDPMSLQY
ERPA_SHEDO       RVYVTGGGCSGFQYGFTFDEKSSADDFVIE---------------KQGVKLVVDPMSLQY
ERPA_PSEA6       RVYVTGGGCSGFQYGFTFDEKVNDGDTTID---------------KDQVTLVVDPMSLQY
ERPA_HAEIN       RVYITGGGCSGFQYGFTFDEKVNDGDLTIE---------------KSGVQLVIDPMSLQY
ERPA_HAEIE       RVYITGGGCSGFQYGFTFDEKVNDGDLTIE---------------KSGVQLVIDPMSLQY
ERPA_HAEI8       RVYITGGGCSGFQYGFTFDEKVNDGDLTIE---------------KSGVQLVIDPMSLQY
ERPA_HAEIG       RVYITGGGCSGFQYGFTFDEKVNDGDLTIE---------------KSGVQLVIDPMSLQY
ERPA_MANSM       RVYITGGGCSGFQYGFTFDEKVNDGDLTIE---------------NDGVKLVIDPMSLQY
ERPA_PASMU       RVYITGGGCSGFQYGFTFDEKVNDGDLTIE---------------KSGVHLVIDPMSLQY
ERPA_HAES1       RVYITGGGCSGFQYGFTFDEKTNDGDLIVE---------------NSGVKLVVDPMSLQY
ERPA_VIBCB       RVYITGGGCSGFQYGFTFDERVNEGDTTIV---------------NSGVTLVVDPMSLQY
ERPA_VIBPA       RVYITGGGCSGFQYGFTFDENVNDGDTTIE---------------NSGVTLVVDPMSLQY
ERPA_VIBCH       RVYITGGGCSGFQYGFTFDETVNEGDTKIE---------------NSGVILVVDPMSLQY
ERPA_VIBVU       RVYITGGGCSGFQYGFTFDESVNEGDTTIE---------------NSGVTLVVDPMSLQY
ERPA_VIBVY       RVYITGGGCSGFQYGFTFDESVNEGDTTIE---------------NSGVTLVVDPMSLQY
ERPA_PHOPR       RVYITGGGCSGFQYGFTFDEKVNDGDMTIE---------------NSGVTLVVDPMSLQY
ERPA_ALIF1       RVYITGGGCSGFQYGFTFDEDVNEGDMTIE---------------NDGVTLVVDPMSLQY
ERPA_BLOFL       RVYILGGGCGGFQYKFILDDQVSNDDCVIE---------------SNGAIVVVDPMSLQY
ERPA_BLOPB       RVYIIGGGCSGFQYRFILDDKISSDDCIVE---------------NNGVSLVIDPMSLQY
ERPA_BUCAI       RIYINGGGCSGFQYQFIFDTSINEDDIIIT---------------QSEVSLIIDPISLQY
ERPA_BUCAP       RIYIIGGGCSGFQYQFIFDEKINEDDILVK---------------KLNICLVIDPISLQY
ERPA_BUCBP       RVYIAGGGCSGFQYKFKFDKNKNKNDTIVN---------------IFNNIIIIDPISLQY
ERPA_BUCCC       RIFITGGGCSGFQYGFELEKITKKNDISII---------------QSGIEIIIDPISIQY
ERPA_WIGBR       RIYISGGGCNGFQYNFILDEKINKEDHLIL---------------FLDVEIVIDSISLQY
ERPA_BAUCH       RVYITGGGCSGLQYGFTFDDKVNEEDIAIE---------------KQGVVLIVDPISLQY
ERPA_ALCBS       RVYITGGGCAGFSYGFTFDETVNEDDTSVE---------------KEGVILLVDAMSIQY
ERPA_ACIBT       RVYVTGGGCSGFSYGFNFAESVNEDDAEFV---------------NGDVKMLVDSLSYQY
ERPA_ACIAD       RVYVTGGGCSGFSYGFNFADSPNEDDAEFV---------------NGDVKMLVDSLSYQY
ERPA_PSYA2       RVYVTGGGCSGFSYGFNFANELNEDDANFD---------------NNDVTLVVDSLSYQY
ERPA_PSYCK       RVYVTGGGCSGFSYGFNFANELNEDDANFD---------------NNDVTLVVDSLSYQY
ERPA_CHRSD       RVYVTGGGCSGFQYGFDFADTVGDEDTIIE---------------NGTASMVVDALSYQY
ERPA_HALHL       RVFITGGGCSGFQYGFTFDETVEEGDTIIE---------------KRGVKIVVDPVSGIY
ERPA_COXBU       RVFITGGGCSGFQYGFTFDEAINSDDLVIEKQLEEEDDDEGGTGQMALVKLLVDPLSLQY
ERPA_HYDCU       RVYITGGGCSGFQYGFTFDESQAEDDTVVEK--------DG-------VKLMIDPMSFQY
ERPA_FRATH       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_FRATO       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_FRATF       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_FRATN       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_FRATT       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_FRAT1       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_FRATW       RVYITGGGCSGFQYAFAFDNEVKEDDMVIT---------------KNGVRLLVDSMSFQY
ERPA_LEGPC       RVSITGGGCSGFQYGFSFDEQINDDDTIIIQQCSD---------GKSSVKLLIDSMSYQY
ERPA_LEGPA       RVSITGGGCSGFQYGFSFDEQINDDDTIIIQQCSD---------GKSSVKLLIDSMSYQY
ERPA_LEGPL       RVSITGGGCSGFQYGFSFDEQINDDDTVIIQQCSD---------GKSSVKLLIDSMSYQY
ERPA_LEGPH       RVSITGGGCSGFQYGFSFDEQINDDDTIVIQQCSD---------GKSSVKLLVDSMSYQY
ERPA_XANAC       RVYIQGGGCSGFQYGFEFDENRAEDDLAVA---------------TDGVTLLVDPLSLQY
ERPA_XANC5       RVYIQGGGCSGFQYGFEFDENRAEDDLAVA---------------TDGVTLLVDPLSLQY
ERPA_XANCP       RVYIQGGGCSGFQYGFEFDENRAEDDLAVA---------------TDGVTLLVDPLSLQY
ERPA_XANC8       RVYIQGGGCSGFQYGFEFDENRAEDDLAVA---------------TDGVTLLVDPLSLQY
ERPA_XANOR       RVYIQGGGCSGFQYGFEFDENRAEDDLAVV---------------TDGVTLLVDPLSLQY
ERPA_XANOM       RVYIQGGGCSGFQYGFEFDENRAEDDLAVV---------------TDGVTLLVDPLSLQY
ERPA_XYLFA       RVYIQGGGCSGFQYGFEFDENRADDDLALE---------------TDGVVLLVDPLSLQY
ERPA_XYLFT       RVYIQGGGCSGFQYGFEFDENRADDDLALE---------------TDGVVLLVDPLSLQY
ERPA_RUTMC       RVYITGGGCSGFSYGFNFDETYKEGDSSVE---------------NNGVQLVVDPMSYQY
ERPA_VESOH       RVYITGGGCSGFSYGFTFDEKRKEGDSSVT---------------NNGVQLVIDPMSYQY
ERPA2_BURVG      RLYVSGGGCSGFQYGFAFDDQVADDDLQVV---------------TDGVTLLIDAMSRQY
ERPA2_PARXL      RLYVSGGGCSGFQYGFAFDDQVADDDMQTV---------------TDGVTLLVDSMSLQY
ERPA2_POLNA      RLYVTGGGCSGFSYGFAFDDQTAEDDTLIV---------------TEGVALVVDAMSLQY
                 *: : **** *:.* * :       *                        .::*. *  *

ERPA_ACIAC       LVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_VEREI       LVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSA---------
ERPA_RHOFT       LVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSFS----------
ERPA_ACISJ       LVGAEIDYKEDLQGAQFVIKNPNAASTCGCGSSFSVEDH------
ERPA1_POLNA      LVGAEIDYKDDLEGAQFVIKNPNASSSCGCGSSFSV---------
ERPA_POLSJ       LVGAEIDYKDDLEGAQFVIKNPNATSTCGCGSSFSA---------
ERPA_HERAR       LVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFTA---------
ERPA_JANMA       LVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFSA---------
ERPA_METPP       LVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSFST---------
ERPA_BURCA       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURCH       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURCM       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURL3       LVGAEIDYKDDLNGAQFVIKNPNASTTCGCGSSFSV---------
ERPA1_BURVG      LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURMA       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURM9       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURM7       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURMS       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURPS       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURP0       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURP1       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURP6       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_BURTA       LVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV---------
ERPA1_PARXL      LVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV---------
ERPA_CUPNH       LVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV---------
ERPA_CUPPJ       LVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV---------
ERPA_CUPMC       LVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV---------
ERPA_RALSO       LVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV---------
ERPA_THIDA       LVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFSA---------
ERPA_BORBR       LVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV---------
ERPA_BORPA       LVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV---------
ERPA_BORPE       LVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV---------
ERPA_BORA1       LVGAEIDYKEDLEGAQFVIRNPNATTTCGCGSSFSV---------
ERPA_METFK       LVGAEIDYQDSLQGSQFVIRNPNATTTCGCGSSFSA---------
ERPA_AZOSB       LVGAEIDYTEGLEGSQFVIRNPNATSTCGCGSSFSA---------
ERPA_AROAE       LVGAEIDYSEGLEGSQFVIRNPNATSTCGCGSSFSA---------
ERPA_DECAR       LVGAEIDYTEGLEGSQFVIRNPNATSTCGCGSSFSA---------
ERPA_NITOC       LVGAEIDYTEGLEGAQFVIRNPNAETTCGCGSSFSP---------
ERPA_NITEU       LVGAEIDYQESAQGAQFVIKNPSAASTCGCGSSFSV---------
ERPA_NITEC       LLGAEIDYQENAQGAQFVIKNPAAASTCGCGSSFSV---------
ERPA_NITMU       LAGAEIDYQENAEGAQFIIKNPGAASTCGCGSSFSV---------
ERPA_MARN8       LVGATIDYQEGLQGSQFVVQNPNASSTCGCGSSFSI---------
ERPA_NEIG1       LVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV---------
ERPA_NEIMA       LVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV---------
ERPA_NEIMB       LVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV---------
ERPA_NEIMF       LVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV---------
ERPA_CHRVO       LVGAEIDYQESLEGSQFVIRNPNATTTCGCGSSFSV---------
ERPA_ALKEH       LMGAEIDFVEGIEGEQFVIRNPNATTTCGCGSSFSI---------
ERPA2_METCA      LQGAEIDYTENVSGSQFVIRNPNATTTCGCGSSFSV---------
ERPA1_METCA      LQGAEIDYQEGLEGSRFVIKNPNATSSCSCGSSFSVDGGASCSSH
ERPA_HAHCH       LVGAEVDFREGLEGAQFVIKNPNASTTCGCGSSFSI---------
ERPA_SACD2       LVGAQVDYEEGLKGSKFVVANPNASTTCGCGSSFSI---------
ERPA_PSEAE       LAGSEVDYQEGLEGSRFVIKNPNAATTCGCGQSFSI---------
ERPA_PSEAB       LAGSEVDYQEGLEGSRFVIKNPNAATTCGCGQSFSI---------
ERPA_PSE14       LAGAEVDYQEGLEGSRFVIKNPNASTTCGCGSSFSI---------
ERPA_PSEU2       LAGAEVDYQEGLEGSRFVIKNPNASTTCGCGSSFSI---------
ERPA_PSESM       LAGAEVDYQEGLEGSRFVIKNPNASTTCGCGSSFSI---------
ERPA_PSEE4       LAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI---------
ERPA_PSEF5       LAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI---------
ERPA_PSEPF       LAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI---------
ERPA_PSEPK       LAGAEVDYQEGLEGSRFVIKNPNAATTCGCGSSFSI---------
ERPA_PSEU5       LAGAEVDYQEGLEGSRFVIKNPNATTTCGCGQSFSI---------
ERPA_ECOLI       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SHIBS       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_ECOL6       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_ECOL5       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_ECOK1       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_ECO57       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_ECOUT       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SHIF8       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SHISS       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SHIDS       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SHIFL       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SALCH       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SALPA       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SALTI       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_SALTY       LVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_CROS8       LVGGAVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI---------
ERPA_YERPE       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_YERPA       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_YERPS       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_YERPN       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_YERPP       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_YERE8       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI---------
ERPA_PHOLL       LVGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI---------
ERPA_PECAS       LVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV---------
ERPA_SODGM       LVGGSVDYSEGLEGSRFIVTNPNAKTTCGCGSSFSI---------
ERPA_ACTP2       LIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI---------
ERPA_HAEDU       LIGGSVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI---------
ERPA_AERHH       LVGGSVDYTEGLEGSRFTVTNPNATTTCGCGSSFSI---------
ERPA_AERS4       LVGGSVDYTEGLEGSRFTVTNPNASTTCGCGSSFSI---------
ERPA_COLP3       LVDGEVDYLESLEGSRFVVNNPNATTTCGCGSSFSI---------
ERPA_PSET1       LVDGEVDYTEGLEGARFFVTNPHATTTCGCGSSFTI---------
ERPA_IDILO       LMGGVVSYEEGLQGSRFFVDNPNATTTCGCGSSFSV---------
ERPA_PSYIN       LVGGTVDYTNGLEGSRFFVNNPNATATCGCGSSFSM---------
ERPA_SHESA       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHESM       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHESR       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEON       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEPC       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHESW       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHELP       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEAM       LMGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEB5       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEB8       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEFN       LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV---------
ERPA_SHEDO       LVGGEVDYTSGLEGSRFFVKNPNASSTCGCGASFSV---------
ERPA_PSEA6       LLGGEVDYTEGLEGSRFLVNNPNATTTCGCGASFTV---------
ERPA_HAEIN       LIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI---------
ERPA_HAEIE       LIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI---------
ERPA_HAEI8       LIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI---------
ERPA_HAEIG       LIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI---------
ERPA_MANSM       LIGGTVDYTEGLEGSRFVVHNPNATTTCGCGSSFSI---------
ERPA_PASMU       LIGGTVDYTEGLEGSRFVVNNPNASTTCGCGSSFSI---------
ERPA_HAES1       LVGGTVDYTEGLEGSRFIVNNPNASTTCGCGSSFSI---------
ERPA_VIBCB       LIGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV---------
ERPA_VIBPA       LIGGIVDYTEGLEGARFFVNNPNATTTCGCGASFSV---------
ERPA_VIBCH       LIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV---------
ERPA_VIBVU       LIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV---------
ERPA_VIBVY       LIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV---------
ERPA_PHOPR       LVGGIVDYTEGLEGSRFFVNNPNATTTCGCGASFSV---------
ERPA_ALIF1       LIGGKVDYTEGLEGSRFFIDNPNATTTCGCGASFSV---------
ERPA_BLOFL       LFGGIIDYYEGLEGSKFLVVNPNAKGVCSCGSSFNI---------
ERPA_BLOPB       LFGGIIDYYEGLEGSRFVVINPNAKNTCSCGSSFSV---------
ERPA_BUCAI       LYGGQIDYLENLEGSKFIVYNPNAKNTCGCGSSFSI---------
ERPA_BUCAP       LHGGTIDYLENLEGSKFIVSNPNAKNTCGCGLSFSI---------
ERPA_BUCBP       LRGGQIDYIENLEGSKFIILNPKAKHTCGCGSSFSI---------
ERPA_BUCCC       LLGGKIDYIENLEGSKFVISNPNAKRTCGCGLSFSI---------
ERPA_WIGBR       LIGGVVDYKEELLESCFFVINPNAKTTCSCGTSFSI---------
ERPA_BAUCH       LLGGLVDYSEGLKGSRFFIINPNVQTTCSCGSSFSMT--------
ERPA_ALCBS       LDGSVVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV---------
ERPA_ACIBT       LVGSVVDYVEGLEGSRFIVQNPNATTTCGCGSSFSI---------
ERPA_ACIAD       LVGSVVDYIEGLEGSRFIIQNPNATTTCGCGSSFSI---------
ERPA_PSYA2       LQGSTVDYTEGLEGARFIVTNPNATTTCGCGSSFSI---------
ERPA_PSYCK       LQGSTVDYTEGLEGARFIVTNPNATTTCGCGSSFSI---------
ERPA_CHRSD       LVGSTVDFEEGLAGARFIIKNPNATSTCGCGASFAV---------
ERPA_HALHL       LQGAEVDFSSGLEGEQFIIRNPNATTTCGCGSSFAI---------
ERPA_COXBU       LQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSFAA---------
ERPA_HYDCU       LMGAKIDYLEDLQGARFVIENPNASTTCGCGSSFGV---------
ERPA_FRATH       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_FRATO       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_FRATF       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_FRATN       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_FRATT       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_FRAT1       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_FRATW       LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV---------
ERPA_LEGPC       LHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDEDDL---
ERPA_LEGPA       LHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDEDVL---
ERPA_LEGPL       LHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDEDDL---
ERPA_LEGPH       LHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDEDDL---
ERPA_XANAC       LMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV---------
ERPA_XANC5       LMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV---------
ERPA_XANCP       LMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV---------
ERPA_XANC8       LMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV---------
ERPA_XANOR       LMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV---------
ERPA_XANOM       LMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV---------
ERPA_XYLFA       LLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV---------
ERPA_XYLFT       LLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV---------
ERPA_RUTMC       LIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV---------
ERPA_VESOH       LIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV---------
ERPA2_BURVG      LAGARVDYEDGLEGSRFVIQNPNAQSTCGCGSSFSV---------
ERPA2_PARXL      LPGARVDYEDGLEGSRFVIHNPNAQSTCGCGSSFSV---------
ERPA2_POLNA      VLGARVDFEDGLEGSRFVIHNPNAQSTCGCGSSFSV---------
                 : .. :.: .      * : ** .   *.** **