CLUSTAL format seed alignment for MF_01383

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A2C7Y4_PROM3      MRQNRTVFFPMTIAVGRAPQ---RGWFDVLDDWLKRDRFVFVGWSGLLLFPTAYLALGGW
A8G5U7_PROM2      ----------MTIAVGSAPQ---RGWFDILDDWLKRDRFVFIGWSGLLLLPCAYLAIGGW
PSBD_SYNS3        ----------MTIAAGRMPQ---RGWFDVLDDWLKRDRFVFVGWSGILLLPTAYLSIGGW
Q7NI61_GLOVI      ----------MTIAVGRSEQS--QGWFDALDDWLKKDRFVFIGWSGLLFFPTAYLAVGAW
PSBD_SYNP2        ----------MTIAVGRAPQE--RGWFDVLDDWLKRDRFVFVGWSGILLFPCAFMALGGW
PSBD_TRIEI        ----------MTVAVGRPQSQ--RGAFDVLDDWLKRDRFVFVGWSGILLFPCAFLSIGGW
PSBD1_ACAM1       ----------MTIAVGRAQ-E--RGWFDVLDDWLKRDRFVFIGWSGILLFPCAFLSIGGW
PSBD_GUITH        ----------MTIAIGQEEG---RGWFDLVDDWLKRDRFVFIGWSGLLLFPTSYLSIGGW
PSBD_CYACA        ----------MTIAIGREQE---RGWFDLLDDWLKRDRFVFIGWSGILLFPCAYLALGAW
PSBD_THEVL        --------------------E--RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGW
PSBD_THEEB        ----------MTIAIGRAPAE--RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGW
PSBD_CYAPA        ----------MTVAIGRSDSE--RGWFDVLDDWLKRDRFVFLGWSGLLLLPCAYLAVGAW
PSBD_EUGGR        ----------MTFTDLNTENK--NGWFDVADDWLKKDRFIFIGWSGLLLFPCSYLALGGW
PSBD_CHLAT        ----------MTISIEKSVKKTQPSLFDLCDDWLKRDRFVFVGWSGLLLFPCAYLALGGW
PSBD_CHLRE        ----------MTIAIGTYQEK--RTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGW
PSBD_ARATH        ----------MTIALGKFTKD-EKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGW
C7B2K2_SELML      ----------MTIVVGRLSGG-STSFFDNTDDRPRRDRFAFVGRSGLSLLPRAYFSPGGW
                                            **  **  ::*** *:* **: ::* :::: *.*

A2C7Y4_PROM3      FTGTTFVTSWYTHGIASSYLEGCNFLSAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLG
A8G5U7_PROM2      FVGTTFVTSWYTHGVASSYLEGCNFLTAAVSTPGDAMGHSLLFLWGPEAQGSFVRWLQLG
PSBD_SYNS3        LTGTTFVTSWYTHGIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLG
Q7NI61_GLOVI      LTGTTFVTSWFTHGLASSYLEGGNFLTVAVSSPADAMGHSLLLLWGPEAQGDFTRWCQIG
PSBD_SYNP2        LTGTTFVTSWYTHGLASSYLEGCNFLTVAVSSPADSLGHSLLFLWGPEANWNFARWCQLG
PSBD_TRIEI        LTGTTFVTSWYTHGLASSYLEGCNFLTVAISSPAYSMGHSLLFLWGPEAQWDFARWCQIG
PSBD1_ACAM1       FTGTTFVTSWYTHGLASSYLEGANFLTVAVSTPADSLGHSLLLLWGPEAQGDFTRWCQLG
PSBD_GUITH        FTGTTFVTSWYTHGLASSYLEGCNFFTAAVSTPANSMGHSLLLLWGPEAQGDFTRWCQIG
PSBD_CYACA        FTGTTFVSSWYTHGLASSYLEGCNFLTAAVSSPANSMGHSLLFLWGPEAQGDFTRWCQIG
PSBD_THEVL        LTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLG
PSBD_THEEB        LTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLG
PSBD_CYAPA        FTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSMGHSILFVWGPEAQGDFTRWCQIG
PSBD_EUGGR        LTGITFVTSWYTHGLASSFLEGCNALTAAVSTPPNSMGHSLLLLLGSEAQWDFTRWLQIG
PSBD_CHLAT        FTGTTFVTSWYSHGLASSYLEGCNFLTAAVSTPPNSMGHSLLLLWGPEAQGDFTRWCQLG
PSBD_CHLRE        LTGTTFVTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRWCQLG
PSBD_ARATH        FTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLG
C7B2K2_SELML      FTGTTSVTSRYTHGLASSYPEGRNSLTVAASTPANSPAHSPPLLWGPEAQGDFTRWCQLG
                  :.* * *:* ::**:*:*: ** * ::.* *:*  : .**  :: *.**: .*.** *:*

A2C7Y4_PROM3      GLWTFVALHGSFALIGFMLRQFEIARLVGIRPYNALAFSGPVVVFLACFLIYPLGQHSWF
A8G5U7_PROM2      GLWNFVALHGVFGLIGFMLRQFEIAGLVGIRPYNALAFSAVIAVFTSIFLIYPLGQHSWF
PSBD_SYNS3        GLWAFVALHGAFALIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWF
Q7NI61_GLOVI      GLWAFISFHGALALMGFMLRQFEIARLIGIRPYNAIAFSAPIAVFVSVFLMYPLGQHSWF
PSBD_SYNP2        GLWSFVALHGAFGLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWF
PSBD_TRIEI        GLWSFTALHGAFALIGFCLRQIEIARLVGIRPYNAIAFTGPIAVFVSVFLMYPLGQSSWF
PSBD1_ACAM1       GLWNFTTLHGVFGLIGFMLRQFEIARLVGVRPYNAVAFSGPIAVYVSVFLMYPLGQSSWF
PSBD_GUITH        GLWAFCALHGAFGLIGFCLRQFEIARLVGIRPYNAIAFSGPIAIFVSVFLMYPLGQASWF
PSBD_CYACA        GLWTFTALHGSFGLIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLLYPLGQASWF
PSBD_THEVL        GLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWF
PSBD_THEEB        GLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWF
PSBD_CYAPA        GLWTFTALHGALGLIGFTLRQFEIARLIGLRPYNAIAFSGPIAVFVSVFLLYPLGQAGWF
PSBD_EUGGR        GLWPFIALHGAFGLIGFMLRQFEIAKAVQIRPYNAIAFSAPISVFVSVFLIYPLGQSGWF
PSBD_CHLAT        GLWTFVALHGAFALIGFMLRQFEIARAVKLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWF
PSBD_CHLRE        GLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWF
PSBD_ARATH        GLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWF
C7B2K2_SELML      GLWTFVALHGAFGLMGPMLRQSELARSVQSRPYNAIAFSAPIAVSVPVSLIHPLGQSGRF
                  *** * ::** :.*:*  *** *:*  :  *****:**:. : :  .  *::**** . *

A2C7Y4_PROM3      FAPSFGVAAIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCGIHGATVQNTLFEDGAM
A8G5U7_PROM2      FAPSFGVAAIFRYILFIQGFHNITLNPFHMMGVAGILGGALLCAIHGATVQNTLYEDTSI
PSBD_SYNS3        FAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQ
Q7NI61_GLOVI      FGPSYGVNGIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGEA
PSBD_SYNP2        FAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSDQ
PSBD_TRIEI        FAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFQDGEA
PSBD1_ACAM1       FAPSWGVTSIFRFLLFAQGFHNLTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGQD
PSBD_GUITH        FAPSLGVAAIFRFLLFIQGFHNFTLNPFHMMGVAGILGAALLCAIHGATVQNTIFEDGDA
PSBD_CYACA        FAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEA
PSBD_THEVL        FAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEG
PSBD_THEEB        FAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEG
PSBD_CYAPA        FAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDG
PSBD_EUGGR        FAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDS
PSBD_CHLAT        FAPSFGVAGIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDG
PSBD_CHLRE        FAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDG
PSBD_ARATH        FAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDG
C7B2K2_SELML      SAPSSGVAAIFRSILLPQGLHNWTLNPFHMMGVAGVPGAAPPRATHGATVENTLFEDGDG
                   .** ** .*** :*: **:** ************: *.*   . *****:**:::*   

A2C7Y4_PROM3      -------SNTFKGFDPTQEEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGMWT
A8G5U7_PROM2      YTDGKVQSSTFRAFDPTQEEETYSMITANRFWSQIFGIAFSNKRFLHFLMLFVPVMGMWT
PSBD_SYNS3        -------SNTFKAFEPTQEEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWT
Q7NI61_GLOVI      -------PNTFKAFDPAQEEETYSMILANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWM
PSBD_SYNP2        -------ANTFRAFEPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWM
PSBD_TRIEI        -------ANTFRAFEPTQSEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWM
PSBD1_ACAM1       -------ANTFAAFTPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWA
PSBD_GUITH        -------ANTFRAFTPTQSEETYSMVTANRFWSQVFGVAFSNKRWLHFFMLFVPLAGLWT
PSBD_CYACA        -------SDTFRAFTPTQSEETYSMVTANRFWSQIFGVAFANKRWLHFFLLFVPVTGLWV
PSBD_THEVL        -------ASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWM
PSBD_THEEB        -------ASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWM
PSBD_CYAPA        -------SNTFPAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWM
PSBD_EUGGR        -------PNTFRAFNPLQSEETYSMVTANRFWSQIFGVAFSNKRWLHFFMVFVPVTGLRM
PSBD_CHLAT        -------ANTFRAFNPTQSEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWM
PSBD_CHLRE        -------ANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWM
PSBD_ARATH        -------ANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWM
C7B2K2_SELML      -------ANTFRASNPTQSEETYSMVTANRFWSQTSGVAPPNKRRSHFPMLFVPVTGSRM
                         ..** .  * * ******: *******  *:* .***  ** :::**: *   

A2C7Y4_PROM3      PSVGIVGLAVNLRAYDFVSQEVRAAEDPEFETFYTKNVLLNEGIRAWMSVADQPH-ENFV
A8G5U7_PROM2      SSIGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGMRAWMSSVDQPH-ENFV
PSBD_SYNS3        SAIGIIGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPH-ENFV
Q7NI61_GLOVI      ASIGIIGVALNLRAYEFVSQEIRAAQDPEFETLYTANILINEGIRAWMGPYDQNYDETLK
PSBD_SYNP2        SSVGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGMRAWMAPQDQIH-EQFV
PSBD_TRIEI        SSIGIVGLAFNLRAYDFVSQELRAADDPEFETFYTKNILLNEGIRAWMSPADQPH-QNFM
PSBD1_ACAM1       SAIGLVGIALNMRAYDFVSQEIRAAEDPEFETFYTKNILLNEGLRAWMAPQDQIH-ENFI
PSBD_GUITH        SAIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNLLLNEGIRSWMAAQDQPH-ENFI
PSBD_CYACA        SSIGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPH-ENFV
PSBD_THEVL        SAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPH-ENFV
PSBD_THEEB        SAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPH-ENFV
PSBD_CYAPA        SAIGVVGLGVNLRAYDFVSQEIRAAEDPEFETFYTKNLLLNEGIRAWMAVQDQPH-ENFV
PSBD_EUGGR        SALGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPH-EQFI
PSBD_CHLAT        SAIGVLGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPH-ENLV
PSBD_CHLRE        SAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPH-ERLV
PSBD_ARATH        SALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPH-ENLI
C7B2K2_SELML      SAIGVVGLAPNLRAYDFVSQEVRAAEDPEFETPYTKNILSNEGIRAWMAAQDQPH-ENLV
                  .::*::*:. *:*:*:*:***:***:****** ** *:* ***:*:**.  ** : : : 

A2C7Y4_PROM3      FPEEVMPRGNAL
A8G5U7_PROM2      FPEEVLPRGNAL
PSBD_SYNS3        FPEEVLPRGNAL
Q7NI61_GLOVI      FPEEVLPRGNAL
PSBD_SYNP2        FPEEVLPRGNAL
PSBD_TRIEI        FPEEVLPRGNAL
PSBD1_ACAM1       FPEEVLPRGNAL
PSBD_GUITH        FPEEVLPRGNAL
PSBD_CYACA        FPEEVLPRGNAL
PSBD_THEVL        FPEEVLPRGNAL
PSBD_THEEB        FPEEVLPRGNAL
PSBD_CYAPA        FSEEVLPRGNAL
PSBD_EUGGR        FPEEVLPRGNAL
PSBD_CHLAT        FPEEVLPRGNAL
PSBD_CHLRE        FPEEVLPRGNAL
PSBD_ARATH        FPEEVLPRGNAL
C7B2K2_SELML      FPEEVLPRGNAL
                  *.***:******