CLUSTAL format seed alignment for MF_01384

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

URED_ACIBC       ------------------------------------MNRIQQTFQTSSAPFWYA------
URED_ACIBT       ------------------------------------MNRIQQTFQTSSAPFWYA------
URED_ACIAD       ------------------------------------MNQPQDFPPQKSKALWYA------
URED2_PSYCK      -----------------------------------------------MTWQSSL------
URED_CITK8       -----------------------MHSPHADKGNALDTVAHKTL---TRGWQAEL------
URED_KLEP7       ----------------------------------MHGTVLPPL---KKGWQATL------
URED_ENT38       ----------------------------------MQGTPAKKH---THGWQASL------
URED_PSEP1       ------------------------------MMSLAEQIEQQQD---DAGWSAHL------
URED_PSEPK       -------------------------------MSLAEQIEQQQD---DAGWSAHL------
URED_PSEPG       -------------------------------MSLAEQIEQQQG---DAGWSAHL------
URED_PSEE4       -------------------------------MSLAQQIEPPQA---DPGWSAHL------
URED_SHEHH       ---------------------------MNIPESVSYKRPES-----HFGWRAEL------
URED_ALIF1       ----------------------------------MPKINTS-----SSGWLADI------
URED_ALCBS       ---------------------------MSVEKPVAAGRQNSKATGRHKGWQAKL------
URED_BLOFL       -----------------------------MFNGFDQGDFLSKS---SDDWISRL------
URED_BLOPB       -----------------------------MSDELSQ-NFI-------DGWLGEL------
URED_ALKEH       -------------------------MAVAQQAWSPGADPAPSAAPVSPGWRGAL------
URED_BORBR       ---------------------------MSETL---------------DQWRAGL------
URED_BORPA       ---------------------------MSETL---------------DQWRAGL------
URED_BORPE       ---------------------------MSETL---------------DQWRAGL------
URED_DELAS       ---------------------------MSAALPI--TAVPACA----SGWQAML------
URED_BURCA       ---------------------------MSAPDSH--APLSRPA--VAKSWRGRL------
URED_BURCH       ---------------------------MSAPDSH--APLSRPA--VAKSWRGRL------
URED_BURCM       ---------------------------MSAPDSH--ASLSRPS--VAKSWRGRL------
URED_BURL3       ---------------------------MSAPDSR--APLSRPA--VAKSWHGRL------
URED_BURVG       ---------------------------MSAADSH--ACLSRPA--AAKSWRGRL------
URED_BURMA       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURM9       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURM7       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURMS       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURPS       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURP0       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURP1       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURP6       ---------------------------MSAHEPH--TSLVRP---AAKAWHARL------
URED_BURTA       ---------------------------MSAHDPH--ASLARP---AAKAWHARL------
URED_PARXL       ---------------------------MSLHENH--ATLATAQAGAHSQWRARL------
URED_CUPNH       ---------------------------MRHPDLP--SSLTVP-----AAWQATL------
URED_CUPPJ       ---------------------------MRHPDFP--SAVAVP-----PAWQASL------
URED_CUPMC       ---------------------------MRHPDFP--SQLAMT-----SAWHASL------
URED_RALSO       ---------------------------MRHPDFPVPPRIDAF-----ASWEASL------
URED_POLAQ       ---------------------------MFLAPDNAVKQLFRSL---SPSWMAKL------
URED_AZOSB       ---------------------------MNAVSDLRALHAAQP------GWQAAL------
URED_DECAR       ---------------------------MTSRLPISQ-PEHSP------SWHAEL------
URED_PSEA7       ------------------------------MTAALPDLSFHP------AWHAQL------
URED_PSEAB       ------------------------------MTAALPDLSFHP------AWHAQL------
URED_PSEAE       ------------------------------MTAALPDLSFHP------AWHAQL------
URED_PSEF5       ------------------------------MNLPAATALFTP------SWHAEL------
URED_PSEPF       ------------------------------MNLPVATALFTP------SWHAEL------
URED_PSE14       ------------------------------MNLPANTALFTP------SWHAEL------
URED2_PSEU2      ------------------------------MNLPANTALFTP------SWHAEL------
URED2_PSESM      ------------------------------MNLPAHTALFTP------SWHAEL------
URED_PSEU5       --------------------------------MTVLTHPFTP------HWQAEL------
URED_PSEMY       --------------------------------MNLPAALFTP------SWPAEL------
URED_NITOC       ---------------MKKIAVFKQMPCEAADAPPAKTDLLPL------SWPAKL------
URED_JANMA       -------------------MKRLSDTSSAITHTNKSGIASFR------NDQARL------
URED_NITMU       -------------------------------------MASDS------PLRAHL------
URED_METFK       ----------------------------MDDVNTKTAAWADK------RWQALL------
URED_PSYIN       ---------------------------MLSTVITKPPITAKPK----NQWLAHL------
URED_MARMS       --------------MNNKHNLALAEQYDQKPLIKTSMLPEVGA----SQWHAFL------
URED2_OCHA4      -----------------------------------------MS----TGWHAEL------
URED_PSEHT       -----------MMTLSSMPVTHRA--------DAKSGHSFDAN----RHWAASL------
URED1_PSYCK      -----------MTILFSMPVHPQP--------IIDSGHRFDAS----RHWPASL------
URED_MARHV       -----------MTAYQAIDRHA-------------SGHRFDTE----RRWAAAL------
URED_CHRSD       -----------MTDLSFPGQAASPGEGAGQTPSGGSGHRFDTR----RHWAASL------
URED_HAHCH       MLAEQFTDKNKHAEQELSP----------------GSSAVTGA----RNWRASL------
URED_SACD2       ---------MNAILPKIST----------------LPAKPAPT----REWLAGI------
URED_LEPCP       -----------------------------------------------MSWHGHL------
URED_METPP       -----------------------------------------------MAWLGSL------
URED_ACIAC       -----------------------------------------------MTWHARL------
URED_VEREI       -----------------------------------------------MPWHARL------
URED_POLNA       -----------------------------------------------MTWNATL------
URED_POLSJ       -----------------------------------------------MTWNATL------
URED_RHOFT       -----------------------------------------------MTWHATL------
URED_NOSS1       ---------------------------------------MSETDTIVKGWHGKL------
URED_TRIV2       ---------------------------------------MAFNSQPIEGWHGKL------
URED_NOSP7       ---------------------------------------MICNSQIAEGWHGKL------
URED_ACAM1       -------------------------------------MQQLEKQSDLASWHGRL------
URED_MICAN       ------------------------------------------------MWQGNL------
URED_THEEB       ----------------------------------------------MAGWLGEL------
URED_SYNP2       ------------------------------------MQDQQQVIHKAQPWHGKV------
URED_SYNY3       -------------------------------------MLSASTVNPSAPWQANL------
URED_PROM1       ---------------------------------------------MKSQWHGTC------
URED_PROMT       ---------------------------------------------MKSQWHGTC------
URED_PROM3       -------------------------------------------MTGDRPWHGQC------
URED_PROMM       -------------------------------------------MTGDRPWHGQC------
URED_SYNS3       -------------------------------------------MQRLDPWHGTC------
URED_SYNS9       -------------------------------------------MQRLNPWHGTC------
URED_SYNSC       -------------------------------------------MQRLDPWHGRC------
URED_SYNPX       -------------------------------------------MQSLEPWHGRC------
URED_SYNR3       ---------------------------------------MTDTPNQLPPWRGSV------
URED_PROM2       --------------------------------------------MIKTNWEGNC------
URED_PROM0       --------------------------------------------MIKTSWEGNC------
URED_PROMS       --------------------------------------------MIKTSWEGNC------
URED_PROM9       --------------------------------------------MIKTSWEGNC------
URED_PROMP       --------------------------------------------MAKSSWEGNC------
URED3_METEP      --------------------MADEAGTRSAGGRPIPAAEPLRPALSRQRSQGAV------
URED2_METPB      --------------------MSEEAWARSAGGRAILAESP-RPVPSRQRSNGVV------
URED1_METRJ      ---------------------------MHGPLAPAPSPERLGAAPARQRSDGRI------
URED_METS4       -----------------------------------MSSHPTPSWPRRQRSEGRV------
URED_XANP2       ---------------------MTTSAASWRSDPADPSVASARERALRQRSEGRV------
URED_AZOC5       ------------------------MAGAPR----------------RQRAVGRV------
URED_BRADU       ---------------------------------MRSELSVTSSIFEANRARGAV------
URED_RHOP5       ----------------------MATPRRPRVNPIDTTLS-ESALFAANRAVGEV------
URED3_BRASB      --------------------------------MRADPASAAADIFEANRARGAV------
URED1_BRASO      --------------------------------MRADPASAAADIFEANRARGAV------
URED_RHOPB       ---------------------------------MTPLDTSAAAIFAANRAQGAV------
URED_RHOPS       ---------------------------MQTESSRREAAAATEQLFAANRAQGSV------
URED_RHOP2       -------------------------------MIQAETSAADSAVFAGNRAQGAV------
URED_RHOPA       -------------------------------MMATDTSLTTSQTFAANRAVGEV------
URED_BEII9       ----------------------------------------MTMSFAANRARGEI------
URED_RHIEC       ------------------------------MTIVATA-------TRPQRAEGRG------
URED_RHIL3       ------------------------------MTIAAAG-------TRPQRAEGRG------
URED_AGRFC       -------------------------MQSEQQAIGASGCEDAQQPVRQQRARGRG------
URED_RHIME       ------------------------------MEPAAII--------APQRARGEG------
URED_SINMW       ------------------------------MEAAAAI--------APQRAWGKG------
URED_CHESB       -------------------------MRQTAQEDASPA--------PMQRAHGTG------
URED1_BRUAB      -------------------------MLIINDNNLSGL--------SLQRVNGTG------
URED1_BRUA2      -------------------------MLIINDNNLSGL--------SLQRVNGTG------
URED1_BRUC2      -------------------------MLIINDNNLSGL--------SLQRVNGTG------
URED1_BRUSU      -------------------------MLIINDNNLSGL--------SLQRVNGTG------
URED1_BRUO2      -------------------------MLIINDNNLSGL--------SLQRVNGTG------
URED1_BRUME      -------------------------MLIINDNNLSGL--------SLQRVNGTG------
URED_BRUSI       -------------------------MLIINDNNLSG---------PLQRVNGTG------
URED1_OCHA4      --------------------------MIINNNKLAEL--------SSQRVNGLG------
URED_RHILO       -------------------------MDTIEYTEFSPP--------LAQRAAGLA------
URED_ROSDO       ------------------------------MLMRTATPLD------QPRAIGSA------
URED_RUEST       ---------------------MPQAADIATAPQRPSAPGDVVAAGQPPRARGRA------
URED_RUEPO       -----------------------------------------------------M------
URED_DINSH       -------------------MLNTLEPQPCETDALSPR---------LQRSTGSA------
URED_JANSC       -----------------------------MLDAATPT---------HQRVRGRA------
URED_RHOS4       ------------------------------MNALTPLS------ARLERSDGHA------
URED_RHOS1       ------------------------------MNALTPLS------ARLERSDGHA------
URED_RHOS5       ------------------------------MNALTPPR------DCLERSQGHA------
URED_PARDP       --------------------MRGRRLSGPMFDAIAPI--------RMQRSRGAA------
URED_MAGMM       -------------------------MRSAATLPYESN--------PSQGVQGCV------
URED_FRAAA       ---------------------------------MPTTTDAASPARPRTGRTAVR------
URED_FRACC       ---------------------MAAMRRGVILGGVAAGPEGPLVTAARTGRTAVR------
URED_FRASN       -------------------------------MNSSAASPPAVSPHAAPSRTTVR------
URED1_SACEN      ----------------------------------------------------MR------
URED_STRAW       -----------------------------------------------MTAAGVR------
URED_STRCO       ---------------------------------------------MTTVAGGVR------
URED3_STRGG      --------------------------------------------------MSVR------
URED2_SACEN      -----------------------MGRRAPDRLDRGVTTTSPRTQAPPQAGRGVH------
URED_ANADF       ------------------------MECPDPQPILELLEAPCPTIGQPRPEVGLR------
URED_SORC5       -----------------MRPLAPDARCAPSRPGRGPWYARRPVTTPSDPPAALREPPPPA
URED_SYNJB       -----------------------------------------------MNFGKAI------
URED2_SYNJA      -----------------------------------------------MTFGKAL------
URED1_BRASB      ---------------------------------------MRSPQLSCSASEGRA------
URED3_BRASO      ---------------------------------------MRSPLQSCSASEGRA------
URED1_METEP      -----------------------------MALSLDGLPEKPAPAEAPSPPVGRR------
URED1_METPB      -----------------------------MALSLDDLPEKPAPAEPVSAPVGRR------
URED2_METRJ      --------------------------------------------MPDDIQTGRR------
URED1_PSEU2      -----------------------------------------MNAHQSSLPAQTK------
URED1_PSESM      -----------------------------------------MNAHSSLLPICKK------
URED2_BRASB      ----------------------------------------------MSASAPEP------
URED2_BRASO      ----------------------------------------------MSDLSPDK------
URED2_METEP      -------------------MTLHEPLGLIDAARELRGFQAEPA-QMRAGAPGKV------
URED3_METPB      -------------------MTLHGPLGLLDTARELRGFRTEPA-QMRAGAPGKV------
URED_YERPS       --------MTAQSQNIVETPSRVRAHALGVNAPELAKYQDEPA-QMRSGAVGKS------
URED_YERP3       --------MTAQSQNIVETPSRVRAHALGVNAPELAKYQDEPA-QMRSGAVGKS------
URED_YERE8       --------MTSQSQNIVETPSRVRAHALGINAPELAQYQDEPA-QMRSGAVGKS------
URED_PHOLL       --------MTSTRLPQNIGEACQQANNLGVNAPELARFQDEPP-QMASGDVGKS------
URED2_BRUAB      ---------------------------MLGKARELANYQDEPE-QLPTGSFGKN------
URED2_BRUA2      ---------------------------MLGKARELANYQDEPE-QLPTGSFGKN------
URED2_BRUME      ---------------------------MLGKARELANYQDEPE-QLPTGSFGKN------
URED2_BRUSU      ---------------------------MLGKARELANYQDEPE-QLPTGSFGKN------
URED2_BRUC2      ---------------------------MLGKARELANYQDEPE-QLPTGSFGKN------
URED2_BRUO2      ---------------------------MLGKARELANYQDEPE-QLPTGSFGKN------
URED_CENSY       -----------------------------------------MG-QLGVGRTGKT------
URED_HALWD       --------------------MSTDSDHTHPIPPAFQEYDTQKLRQSPAFGHGKH------
URED_NATPD       ---------------------------MSAVPDAFQRYGAESLAQAPAFGPGKD------
URED_HALMA       -------------------------MAADAPHPAFEGYATEAVPQAAVGSPGKD------
UREH_HELPY       ----------------------------------------------MNTYAQES------
UREH_HELPJ       ----------------------------------------------MNTYAQES------
UREH_HELHP       ----------------------------------------------MSSFAQKS------
URED_HAEIG       ---------------------------------------------------MNS------
URED_HAEIN       ---------------------------------------------------MNS------
URED_ACTPJ       ---------------------------------------------------MQS------
URED_ACTP2       ---------------------------------------------------MQS------
URED_ARTS2       ---------------------MSTTAAPE--------------VELVETETPM-------
URED_PAEAT       -------------------------MGPD--------------STLALGEGAVR------
URED_KOCRD       --------------MDQDRSGAADAGNPDPGRGPAGSAEARNGAAAASSPAEWA------
URED_CORGL       -----------------------------------------------MTQTQPV------
URED_COREF       --------------------------------------------------MKPG------
URED_BACC1       -------------------------------------------------MKSPT------
URED_LACP7       -------------------------------------------------MTNYT------
URED_STAA8       ---------------------------------------------MD--EQQWT------
URED_STAAE       ---------------------------------------------MD--EQQWT------
URED_STAAT       ---------------------------------------------MD--EQQWT------
URED_STAA3       ---------------------------------------------MD--EQQWT------
URED_STAAC       ---------------------------------------------MD--EQQWT------
URED_STAA2       ---------------------------------------------MD--EQQWT------
URED_STAA9       ---------------------------------------------MD--EQQWT------
URED_STAAR       ---------------------------------------------MD--EQQWT------
URED_STAAS       ---------------------------------------------MD--EQQWT------
URED_STAAB       ---------------------------------------------MD--EQQWT------
URED_STAES       ---------------------------------------------MA--EQRWT------
URED_STAEQ       ---------------------------------------------MA--EQHWT------
URED_STAS1       ---------------------------------------------MSNNKQAWT------
URED2_STRGG      --------------------------------MAALASVPDTLAPGSPAKVGIL------
URED_HUNT2       ---------------------------------------------MKNKFGKES------
URED_FLAJ1       ------------------------------------------------------------
URED_UREPA       --------------------------------------------MILNKEKIKN------
URED_MYCS2       ---------------------------------------------MKLAERTAA------
URED_MYCGI       ---------------------------------------------MTAPTIQPG------
URED1_STRGG      ----------------------------------------MTGPPAPAARPAEP------
URED_OPITP       -----------------------------------------------MDFAGHL------
URED_DEIRA       -----------------------------------MTTLGTPVSLGRRTRTGRL------
URED_HERA2       ----------------------------------------MQTATRLERMHGHL------
URED_BACHD       ----------------------------------------MRASSHLPQLHGRL------
URED_LYSSC       -----------------------------------------MVNPQKINHFGKL------
URED1_SYNJA      -------------------------------------------------MVSQF------
URED_TRIEI       ------------------------------------------------MSTNNL------
URED_CYTH3       ---------------------------------------------MVKDTTHSI------
URED_ARCB4       -------------------------------------------------MSIKF------
                                                                             

URED_ACIBC       ---QLELGFCYENSR----TIMSHRKHYGPVRVQKMLWPE----------------KTGV
URED_ACIBT       ---QLELGFCYENSR----TIMSHRKHYGPVRVQKMLWPE----------------KTGV
URED_ACIAD       ---QLELGFRFDGQR----TIMNHRKHHGPVRVQKMLWPE----------------KTGV
URED2_PSYCK      ---QLHFDCASNAAK----TRLYHRAHTGALMVQRALYPEPDSTDSS---------QAGI
URED_CITK8       ---DLRFTR-----A-AHKTVLTSARHVGPLTVQRPFYPEDD-----------------V
URED_KLEP7       ---DLRFHQ-----A-GGKTVLASAQHVGPLTVQRPFYPEEE-----------------T
URED_ENT38       ---ALQFCH-----T-PEKTVLHSARHVGPLTVQRPFYPEEE-----------------T
URED_PSEP1       ---QLRFVQ-----R-DGVTRLGAWKHFGPLLVQRPFYPEGA-----------------P
URED_PSEPK       ---QLRFVQ-----R-DGVTRLGAWKHFGPLLVQRPFYPEGA-----------------P
URED_PSEPG       ---QLRFVQ-----R-GDVTRLGAWKHFGPLLVQRPFYPEGS-----------------P
URED_PSEE4       ---QLRFIQ-----R-EGVTRLGARRHVGPLLVQRPFYPEGA-----------------P
URED_SHEHH       ---SLKYGI-----K-REKTRLLERHQLGPLTVQKTFYPEGA-----------------A
URED_ALIF1       ---SLFYEK-----R-GTNTKLVHREQVGPLMVQRPFYPETG-----------------I
URED_ALCBS       ---HMQLECA-ITGR-GMKTVMAELHHYGPLRVQRPFYPEQD-----------------T
URED_BLOFL       ---ELNFVL-----Q-EGCSVLKKISHIGPILVQKIFYPENDKS--------------NI
URED_BLOPB       ---RLNFAL-----R-GGRSVLTRCKHVGPFYVKKVFYSEND----------------NT
URED_ALKEH       ---RLDFAR-----R-GERTALVRRRHQGPLVVQRTFHPEGA-----------------P
URED_BORBR       ---TLGFAPGHAGR-----TVLRERAHYGPMLVQRALYPEGPQ----------------V
URED_BORPA       ---TLGFAPGHAGR-----TVLRERAHYGPMLVQRALYPEGPQ----------------V
URED_BORPE       ---TLGFAPGHAGR-----TVLRERAHYGPMLVQRALYPEGPQ----------------V
URED_DELAS       ---DLRFGHRAGQG-----SVLSHARHSGPLRVQKPLHPEGPG----------------I
URED_BURCA       ---ELGFERH-GAR-----TTLAHRLHDGPLRVQRPLYPEGDA----------------I
URED_BURCH       ---ELGFERH-GAR-----TTLAHRLHDGPLRVQRPLYPEGDA----------------I
URED_BURCM       ---ELGFERH-GAR-----TTLVHRLHDGPLRVQRPLYPEGDA----------------I
URED_BURL3       ---ELGFERH-GMR-----TTLAHRLHDGPLRVQRPLYPEGDA----------------I
URED_BURVG       ---ELGFERH-GMR-----TTLVHRLHEGPLRVQRPLYPEGDG----------------V
URED_BURMA       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURM9       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURM7       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURMS       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURPS       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURP0       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURP1       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURP6       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_BURTA       ---ELGFERQPGGR-----TALAHRRHVGPLRVQRALYPEGDA----------------I
URED_PARXL       ---ELGFVRE-GER-----TTLKHRLHDGPLRVQRPLYPEGYG----------------V
URED_CUPNH       ---RLRFAQR-GER-----TALTERRHQGPLLVQKPLYPEGG-----------------I
URED_CUPPJ       ---RLRFAAR-GER-----TVLAARQHRGPLMVQKPLYPEGD-----------------I
URED_CUPMC       ---RLRFAAR-AGR-----TAMVERRHEGPLRVQKPLYPEGE-----------------I
URED_RALSO       ---RLAFARR-GGR-----TVLASCRHRGPLRVQKALYPEGEG----------------V
URED_POLAQ       ---SLSYERT-PIG-----TVLKKSLHEGPLRVQKALYPEGDD----------------I
URED_AZOSB       ---SLGFERR-GAR-----TVLATRRHVGPLVVQRALYPEGDG----------------V
URED_DECAR       ---HLGFARA-GER-----TVLRENRHRGPLRVQKALYPEGEA----------------V
URED_PSEA7       ---ELAYARA-GDA-----TRPVTRRHAGPLRVQKHLYAEGPE----------------V
URED_PSEAB       ---ELAYARA-GDA-----TRPVTRRHAGPLRVQKHLYAEGPE----------------V
URED_PSEAE       ---ELAYARA-GDA-----TRPVTRRHAGPLRVQKHLYAEGPE----------------V
URED_PSEF5       ---ELAYARC-GAT-----TRPVLRRHLGPLRVQKHLYAEGPE----------------V
URED_PSEPF       ---ELAYARF-GDC-----TRPTRRRHLGPLRVQKHLYAEGPE----------------V
URED_PSE14       ---ELGYGRF-DDC-----TRPTQRRHKGPLRVQKHLYAEGPQ----------------V
URED2_PSEU2      ---ELGYGRF-DDS-----TRPTLRRHKGPLRVQKHLYAEGPE----------------V
URED2_PSESM      ---ELGYGRF-YDC-----TRPTQRRHKGPLRVQKHLYAEGPE----------------V
URED_PSEU5       ---ELGYTRI-GDA-----TRPVLRRHSGPLRVQKHLYPEGSE----------------V
URED_PSEMY       ---ELAYARH-GER-----TTPVRRRHLGPLRVQKHLHAEGPE----------------V
URED_NITOC       ---ELGYQRV-KMR-----TVPVLRRHQGPLRVQKHLYPEGPA----------------V
URED_JANMA       ---SLAFTDD-AGT-----TRMTERSHFGPLRVQKTLYPEHPA----------------V
URED_NITMU       ---RLKFAES-SGI-----TRMVERDHHGPLLVQKPLYPEGYE----------------V
URED_METFK       ---ALDFSSR-AGR-----TTLIGKRHQGPLVVQKMLYPEGDE----------------V
URED_PSYIN       ---MLEFSDTPVGT------QLTRTKRKGPLSVQKAFYPEGPD----------------C
URED_MARMS       ---TLGFSKTARGT------VLKTSDHKGPLYVQKPFYPEGRD----------------T
URED2_OCHA4      ---ELRFEHNREVT------RLMRRRHVGPLAVQQPFYPEKDG----------------S
URED_PSEHT       ---TLGFCAQNSGD--TRVTRMNIARHYGPLRVQRPFYPEGKD---------------GC
URED1_PSYCK      ---TLGFAAYPEAD--TRITRMNVARHYGPLRVQRAFYPEGRD---------------GC
URED_MARHV       ---ELGFEARAESEP-TPVTRLVRRRHHGPLRVQRPFYPEGKT---------------GC
URED_CHRSD       ---SLGFRDR-DGR-----TRMTRARHHGPLRVQRPFYPETGHVPDAR--------YAEP
URED_HAHCH       ---TLNLTKESNRT------ILKQAAHQGPLRVQRPFYPEGAQ----------------R
URED_SACD2       ---DLLLAKRYQRT------ALMSSKHFGPLRVQRPFYPEPDG----------------C
URED_LEPCP       ---QLHYRHDPNED-----RTVAHDRHHGPLRVLQRLYPEGPS----------------I
URED_METPP       ---DLHYRPDPDAPAAALPRTIGRGVHSGPLRVLQSLYPEGPG----------------I
URED_ACIAC       ---QLDYRRE-------GPRTVAGFLHDGPLRILQSLYPEGGG----------------I
URED_VEREI       ---QLNYTRE-------HARTVARFEHHGPLRVLQSLYPEGGG----------------I
URED_POLNA       ---ALDYTRQ-------AEKTVAHFRHSGPLRILQSLYPEGDG----------------I
URED_POLSJ       ---ALDYTRQ-------AGKTVAHFRHSGPLRILQSLYPEGDA----------------I
URED_RHOFT       ---SLDYRLE-------SERSVLRHVHDGPLRVLKSLYPQGDG----------------T
URED_NOSS1       ---NLVYADRSNS------TQLIYNHQQAPLKVQRPFYPEGEK----------------V
URED_TRIV2       ---DLVYADRSNS------TQLIYNHQQAPLKVQRPFYPEGEK----------------V
URED_NOSP7       ---NLVYADRQGA------TQLIYNQQQAPLKVQRPFYPEAEK----------------V
URED_ACAM1       ---SLTYEKKAHQ------TQVQQSYHQAPLNLQRPFYPEGP-----------------V
URED_MICAN       ---ELIYKQKNLA------TEINHVYATAPLKVQRPFYPEGKN----------------L
URED_THEEB       ---ELVYAWRRGQ------TIPVRAYASAPLKLQRSFYPEGKP----------------I
URED_SYNP2       ---GLIYGQRQGK------TEMQRCFTQAPFRIQRPFYPEGNR----------------V
URED_SYNY3       ---WLRYDRPGHR------TRMVECLVQAPLKVQRSFYPDDTG----------------Q
URED_PROM1       ---DLRLFKSSRSNNKDVVKTIHQAKCTAPLKVMRVFNDKKDG----------------R
URED_PROMT       ---DLRLFKSSSSNNKDIVKTIHQAKSTAPLKVMRVFNDKKDG----------------R
URED_PROM3       ---SLQLISKTAADDLQSQLTVHQSQCTAPFKIQRANLDD-DG----------------R
URED_PROMM       ---SLQLISKTATDDLQSQLTVHQSQCTAPFKIQRANLDH-DG----------------R
URED_SYNS3       ---NLQFVAGSSG-------SQFQGGCTAPLKLMRAERGE-NG----------------R
URED_SYNS9       ---RLQFSADADT-------THHQGGCTAPFKLMRAERGN-DG----------------R
URED_SYNSC       ---DLQFHATNGS-------TKHQGGCTAPFKLLRSERGE-DG----------------R
URED_SYNPX       ---RLQFQTNNGS-------TKHQGGCTAPFKLLRADVGD-HG----------------R
URED_SYNR3       ---SLDFELAADGT------TQWQGGARSPLKLLRHFTAG-DG----------------R
URED_PROM2       ---FLNFFNNKSSLE-NVDKTIFKSKSTSPYKLLKSTHDQ-EG----------------R
URED_PROM0       ---FLNFFNNKASLG-NVDKTIFKSKSTSPYKLLKSTHDQ-EG----------------R
URED_PROMS       ---FLNFFNNKVSLG-NVDKTIFKSKSTSPYKLLKSTHDQ-EG----------------R
URED_PROM9       ---FLNFFNNKASIG-NVDKTIFKSKSTSPYKLLKSTHDE-EG----------------R
URED_PROMP       ---FLNFFNNKSSSG-KDDKTIFKSKFTSPYKLLKCSYDQ-EG----------------R
URED3_METEP      ---HLRVAPAGTAAD--APTRIVDLAESGPLRLRCPRQGAERMLE---------------
URED2_METPB      ---RLRVARAGIAAD--GPTRIVDLAEGGPLRLRFPRQGAERMLE---------------
URED1_METRJ      ---RLRVGPAR--PG--GGTRILDLAEAGPSRLRFPR--GTCALE---------------
URED_METS4       ---ALG---AGLVAG--GTTRLTDLAETGPLRLRLPRV-EGAALE---------------
URED_XANP2       ---RITAS----AFG--GVTRLTDLAEGGALRARLPR--GGPGLE---------------
URED_AZOC5       ---RLGVN----AIA--GKSRVSDVAEAGSLRVRMPRV-DGPAVE---------------
URED_BRADU       ---RFDVH----ARD--GVTRRGVLHESGSLRVRFPSP-EDEGLS---------------
URED_RHOP5       ---SFDVQ----RVD--GVTRRNRLHESGSLRVRFPSP-EGEGLS---------------
URED3_BRASB      ---RFDVR----LQD--GMTRRHHLHESGSLRVRFPSP-EDDGLS---------------
URED1_BRASO      ---RFDLR----LQD--GVTRRHHLHESGSLRVRFPSP-EDDGLS---------------
URED_RHOPB       ---KFDVR----LQD--GMTRRGRVQESGSLRVRFPSP-EAEGLS---------------
URED_RHOPS       ---QFDVR----AVD--GVTRRGKLHESGSLRVRFPSP-EQQGLS---------------
URED_RHOP2       ---RFDVR----AVD--GVTRRGQLHESGSLRVRFPSP-EQQGLS---------------
URED_RHOPA       ---AVEVR----ADG--GVTRRGPVHEAGSLRVRFPSP-EQQGLS---------------
URED_BEII9       ---RVRYE----KHG--GITRPLRLFETGGLRLRHPRA--FQGCV---------------
URED_RHIEC       ---HLAAKLLD------GRTRIRELYQEGAAKIRLPNT-FDASME---------------
URED_RHIL3       ---HLAAKLFD------GRTRIRELYQEGAAKIRLPDT-FDASME---------------
URED_AGRFC       ---RIVTKAVE------GRSRLDELFQEGCAKIRLPDT-FSNEAE---------------
URED_RHIME       ---RLVAKAEG------GRTRIAELYQEGCAKIRLPKT-FDASME---------------
URED_SINMW       ---RLVAKTGG------ARTRIAGLYQEGCAKIRLPRT-FDASME---------------
URED_CHESB       ---RIEAKLRE------GRTRLERLYQEGCCKIRLPRS-HGGAME---------------
URED1_BRUAB      ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED1_BRUA2      ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED1_BRUC2      ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED1_BRUSU      ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED1_BRUO2      ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED1_BRUME      ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED_BRUSI       ---ELSVQFKD------GRSRISRLYQEGAAKIRMPQA-VTGPLE---------------
URED1_OCHA4      ---GLSIHFKD------GRSRISRLYQEGAAKIRMPQV-GGDPLE---------------
URED_RHILO       ---QLGCASAD------GRTRLRRLYQDGSAKIRLPAV-LADPLE---------------
URED_ROSDO       ---RVSSKRVN------GGSGIDGLRQSGALKLLFPTS--RDIVQ---------------
URED_RUEST       ---HVSSKRRD----D-GAVALDTLHQSGALKLLFPTG--RPDLE---------------
URED_RUEPO       ---ELTTKLVG------TCSALDRLYQSGSAKCLFPRN-SRAGLE---------------
URED_DINSH       ---RVVMRRKA----D-GTTALADLAQQGCAKAMLPRV-HAPVPE---------------
URED_JANSC       ---MARFTGRR----------LRDLHQSGSAKVLIPRV-FGRAPE---------------
URED_RHOS4       ---LVTLARSR------GAVRLRDLAQRGSAKAFLPRV-EGDVPE---------------
URED_RHOS1       ---LVTLARSR------GAVRLRDLAQRGSAKAFLPRV-EGDVPE---------------
URED_RHOS5       ---QVTLARVL------GAVRLRDLAQRGSAKAFLPRV-DGPVPE---------------
URED_PARDP       ---SVRLG----------PRGIEDLAQSGSAKAMLPRM-TAGRPE---------------
URED_MAGMM       ---RLSFVQRH------GQSRLESLYHSDPMRVIIPQTPPGEPVH---------------
URED_FRAAA       -----AHASVRVERGPQGAPRLAELRSDVPIVLRMTGVSPVRTGARAGAGARADPGPLPT
URED_FRACC       -----ARAVIRVESAPDGTARLIELRSDVPIVLRQTGASPGRTRAPSTVPALS-ADALPT
URED_FRASN       -----ARAALQVELDGGGTARITELRAAVPVLPRRTGGSG------------------RV
URED1_SACEN      -----ATAALRVELAADGRNVVRELRSQPPITLIPRRGVASAAG--------------GP
URED_STRAW       -----ATARIGARGDGRGGTSLPVLEGEGPLALRRTRAS------------------GSE
URED_STRCO       -----ASARVLARGDGRGGTVLPVLEGEGPLAVRRTRGS------------------GAE
URED3_STRGG      -----ATARLRAEPDGRDGTALPVLAGEGPLALRRTRSPQ-----------------AAY
URED2_SACEN      -----ATARIRATSHD-GVTVLPLLRSDGPFHLRQLRNH------------------GSQ
URED_ANADF       -----AGAGRVDIARVDGASAIVACVASSPLQLLAPSPRG------------------RC
URED_SORC5       RRAGKAGSGELVFTRVAGRTVLEKALARSPLKLLAPKNHG------------------QA
URED_SYNJB       ----LKATRR---------GEHTRIWEYSQAPLQWLGSPGEPP-----------------
URED2_SYNJA      ----LKISRQ---------GEHARIWEYSQAPLQWLGSPGEPP-----------------
URED1_BRASB      -----VEAALSVEHA-GGRSMLRRQHVGYPLHVTRGFYLDAARPD--------------L
URED3_BRASO      -----VEAALSVDHA-GGRSVLRRQNVGYPLHVTRGFHLDAARPD--------------L
URED1_METEP      -----VQASLVFARG-GRTTVLSRQVVPYPFHITRAFRMHPESPD--------------L
URED1_METPB      -----VQASLVFARG-GGTTVLSRQVVPYPFHITRAFRMHPESPD--------------L
URED2_METRJ      -----ATARLGFVRG-GGTSVLADQHVPYPFHITKPFRLYPQRPE--------------L
URED1_PSEU2      -----RTAHIAFSKAPSGASYVSRQEVGYPFHLGRTLTLPQDPPG--------------M
URED1_PSESM      -----ATAHIAFSKAPSGISYVSRQEVGYPFHLGRTLKLPQDPPG--------------M
URED2_BRASB      -----PRLDLSFVRR-GGRTVIDRRLFAWPFVLTRSFHTDGARPD--------------L
URED2_BRASO      -----PRLDLSFVRR-GSRTVIDRRLFAWPFVLTRSFHTDAARPD--------------C
URED2_METEP      -----GRLRLGFSLRDG-RSVLHDLYRAAPLLVQQALYWDEAMPE--------------L
URED3_METPB      -----GRLRLGFSLRDG-VSVLHDLYRVAPLLVQQALYWDEAMPD--------------L
URED_YERPS       -----GYLKLRFAKREH-RSILAEMERRVPSLVQKALYWDEEIPE--------------L
URED_YERP3       -----GYLKLRFAKREH-RSILAEMERRVPSLVQKALYWDEEIPE--------------L
URED_YERE8       -----GYLKLRFAKREH-RSILAEMERRVPSMVQKALYWDEEMPE--------------L
URED_PHOLL       -----GYLRLGFARRGD-RSILAQMKRRVPYLVQRALYWDEALPQ--------------M
URED2_BRUAB      -----AFLRLGFERRPE-RTVLATLHRRAPLIVQQALYWDEGMPT--------------L
URED2_BRUA2      -----AFLRLGFERRPE-RTVLATLHRRAPLIVQQALYWDEGMPT--------------L
URED2_BRUME      -----AFLRLGFERRPE-RTVLATLHRRAPLIVQQALYWDEGMPT--------------L
URED2_BRUSU      -----AFLRLGFERRPE-RTVLATLHRRAPLIVQQALYWDEGMPT--------------L
URED2_BRUC2      -----AFLRLGFERRPE-RTVLATLHRRAPLIVQQALYWDEGMPT--------------L
URED2_BRUO2      -----AFLRLGFERRPE-RTVLATLHRRAPLIVQQALYWDEGMPT--------------L
URED_CENSY       -----AVLDIELRRSGS-RTIISRQYSEVPLQVQRALYPDAGLPG--------------M
URED_HALWD       -----GIADLVVGREDNKPTRLLSDFLRVPYHLSGTLDSDP-VDE--------------L
URED_NATPD       -----GVFEATLARTGDRDTRLLRDYTKVPYHLTGTLDTDP-APG--------------L
URED_HALMA       -----GVLELTFERTAD-GTTLVHDYATVPFHISGTLGYDP-LPE--------------A
UREH_HELPY       ---KLRLKTKIGADG---RCVIEDNFFTPPFKLMAPFYPKDDLAE---------------
UREH_HELPJ       ---KLRLKTKIGADG---RCVIEDNFFTPPFKLMAPFYPKDDLAE---------------
UREH_HELHP       ---ILKLKTKRGLNG---KNIIEEMFFTPPLKIISPLE-DEDIAE---------------
URED_HAEIG       ---KLSLSTKLSSNG---KTQLAEYFAMPPFKVITLPSYDDAWANG--------------
URED_HAEIN       ---KLSLSTKLSSSG---KTQLAEYFATPPFKVITLPSYDDAWANG--------------
URED_ACTPJ       ---KLLLSTKLTSQG---KTQLDQYFVSPPFKVMTLPAYDDAWQNG--------------
URED_ACTP2       ---KLLLSTKLTSQG---KTQLDQYFVSPPFKVMTLPAYDDAWQNG--------------
URED_ARTS2       --GELALRVAVRG----CRSVAAHQYHRGALRILRPHYLDDSG----------------Q
URED_PAEAT       --GRLELGVCLRG----GRSVASRQFHEGALRVLRPHYLDESG----------------Q
URED_KOCRD       --GQLRLSVAERN----GRSYAARQFHEGALRVLRPHYLDRSG----------------Q
URED_CORGL       --GTLRLTIDDQGPQ--GQSRAVEQFHQGALRVIRPHYLDDSG----------------Q
URED_COREF       --GELRLRIAHRGTD--GRSFAQSQFHRGALRVLRPHYPSDDG----------------L
URED_BACC1       --GVLNIDVMEKR----DKTVPIKVYHKDALKVTQPIYLDKYG----------------R
URED_LACP7       --GYLQLSTEKKR----GKTIAQDMYFYGAFKLMNPFYLNNDE----------------Q
URED_STAA8       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAAE       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAAT       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAA3       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAAC       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAA2       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAA9       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAAR       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAAS       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAAB       --GQLDLTVFFDG----NRSVSRDIFFEKALKVIRPVYLNQST----------------I
URED_STAES       --GQLDLTVFNNG----QSSKARNIFFEKALKVLRPIYLEQSP----------------V
URED_STAEQ       --GQLDLTVFNNG----ESSKARNIFFEKALKVLRPIYLEQSP----------------V
URED_STAS1       --GQLDLSVFNNG----KKSVARDVFFEKALKVMRPVYLNQSD----------------I
URED2_STRGG      ---DLAFAVRGGR------TELVERYQKTPLQIMRPLWIDPEQPG--------------M
URED_HUNT2       ---RLYIRAKVSDGK----TCLQDSYFTAPFKIAKPFYEGHGG----------------F
URED_FLAJ1       ----MINKLNIVSGFKEGRSYLKDAFFTRPFRIADIKEDKTDP----------------S
URED_UREPA       ---YAAYLYIKVAYDQAHSKMAHTVYFTNFYRSSKPLFLDEEDP--------------IN
URED_MYCS2       ---DLRFARAGAH------TVLTRRRHRWPFVIGRVFADPQDPG---------------L
URED_MYCGI       ---ELGIEVVADSAG---RTRTASLRQRYPQRVTMPLHCDPDRPG--------------A
URED1_STRGG      -----DDPTVVAVERDASGRHLARELSPGAFLAPRPLLPCADR-----------------
URED_OPITP       ---HLRAAPRAFGH-----TALTLQSFRAPFHLSKPYWDYDSR----------------V
URED_DEIRA       ---ELEFGVRHGQ------TALLRDLQKAPLMVVRPFRLPCGT-----------------
URED_HERA2       ---ALDFTLKQQR------TRLTVREHRPPLQVVRDFGLADGT-----------------
URED_BACHD       ---DLTFERRR------GTTRLVASEQTPPLNVSRVLRTEEVD----------------L
URED_LYSSC       ---EMAFEPRR------GYTRLVHVYQQPPLKASRELYEGSDP----------------T
URED1_SYNJA      ----LVSQLELEFIAIGGRTHLRRAYSRGALKVLRPFPYGEGL-----------------
URED_TRIEI       ---DIKLNCNSSGQ-----TIVTHQYTTHPLRLSGVFRLDTTDPR--------------T
URED_CYTH3       ----LEISTIHGK------SSVTGSKIFRPLKIFALEKNK-------------------A
URED_ARCB4       -------------------SFKDEVFSLDKLQLPSRHYHFNDNEN---------------
                                                                             

URED_ACIBC       CHAIIVHPPAGIAGGDHLTFQIETERQAHAVITTPGAGKWYRTNG---------------
URED_ACIBT       CHAIIVHPPAGIAGGDHLTFQIETEGQAHAVITTPGAGKWYRTNG---------------
URED_ACIAD       CHAIIVHPPAGIAGGDHLTFQVSTERKAHAVVTTPGAGKWYKTNG---------------
URED2_PSYCK      CHIYVLYPPAGIADDDRLTLEFDLHSNSHAVITTPGAGKWYGQRKSLRYSRPSDSSKFTN
URED_CITK8       CHLYLLHPPGGIVGGDELTISATLATDSHALITQPGSGKFYRSRGPQ-------------
URED_KLEP7       CHLYLLHPPGGIVGGDELTISAHLAPGCHTLITMPGASKFYRSSGAQ-------------
URED_ENT38       CHLYLLHPPGGIVGGDELNISVQLDPNSHALITMPGAGKFYRSSGPL-------------
URED_PSEP1       CHVYVLHPPGGIVAGDRLELDIHLEPGSHALLTMPGASKFYRSIGPT-------------
URED_PSEPK       CHVYVLHPPGGIVAGDRLELDIHLEPGSHALLTMPGASKFYRSIGPT-------------
URED_PSEPG       CHVYVLHPPGGIVAGDRLELNIHLEPGSHALLTMPGASKFYRSIGPT-------------
URED_PSEE4       CHVYVLHPPGGIVAGDRLELDIHLEAGSHALLTMPGASKFYRSIGPT-------------
URED_SHEHH       CHTYLLHPPGGVVGGDQLSFNIDVGTQAHALLTTPGATKFYRSNGEQ-------------
URED_ALIF1       AHTYLLHPPGGVVGGDQLNINIHVSPQAHSLLTTPGATKFYRSSGAT-------------
URED_ALCBS       AHIYLLHPPGGVVGGDGLDISITASSQAHGLLTTPGATKFYRSAGQT-------------
URED_BLOFL       PHVYLLQPSGGLVGGDQIHISVCLESGSKVLLTTPGSTKFYRTNGKY-------------
URED_BLOPB       PHVYLLHPPGGLVGGDKLVLDVKLESDSRVLLTTPGAAKFYRSNGLY-------------
URED_ALKEH       CHAYLLHPPGGLVGGDELDLSVEVGEGAHALMTTPGAAKFYRSSGDW-------------
URED_BORBR       CHVAILHPPSGIAGGDALEIRVDVAGGARAALTTPGATRWYKSNGRQ-------------
URED_BORPA       CHVAILHPPSGIAGGDALEIRVDVAGGARAALTTPGATRWYKSNGRQ-------------
URED_BORPE       CHVAILHPPSGIAGGDALEIRVDVAGGARAALTTPGATRWYKSNGRQ-------------
URED_DELAS       CHAVLLHPPGGVAGGDQLQIDVTVEPGAHALLTTPGATRWYKSQGRP-------------
URED_BURCA       CHAVIVHPPGGVAGGDRLDIDIALGDGTHAVLTTPGATKWYKSNGLD-------------
URED_BURCH       CHAVIVHPPGGVAGGDRLDIDIALGDGTHAVLTTPGATKWYKSNGLD-------------
URED_BURCM       CHAVIVHPPGGVAGGDQLDIGIALGDGTHAVLTTPGATKWYKSNGLD-------------
URED_BURL3       CHAVIVHPPGGVAGGDRLDIDIALGDGTHAVLTTPGATKWYKSNGLD-------------
URED_BURVG       CHAVIVHPPGGVAGGDRLDLDIALGDGTHAVLTTPGATKWYKSNGLD-------------
URED_BURMA       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURM9       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURM7       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURMS       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURPS       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURP0       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURP1       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURP6       CHAVIVHPPGGVAGGDRLEIDVRLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_BURTA       CHAVIVHPPGGVAGGDRLEIDVKLDAGTHAVLTTPGATKWYKSNGLD-------------
URED_PARXL       CHAVIVHPPGGIAGGDQLAIDVDVGAGAHAVIATPGATKWYKSNGRA-------------
URED_CUPNH       CHAVILHPPAGVAGGDSLDIDVTVEDGAHAVLATPGATKWYKSLGRE-------------
URED_CUPPJ       CHAVILHPPAGVAGGDTLDIALHAEAGTHAVIATPGATKWYKSLGRD-------------
URED_CUPMC       CHGVVLHPPAGVAGGDRLDIDIAVASGAHAVLATPGATKWYKSLGRD-------------
URED_RALSO       CHVVLLHPPAGIAGGDVLDIGIELGAEAHAVLTTPGATKWYKSPGRT-------------
URED_POLAQ       CHTVIIHPPAGIAGGDTLDIQVAVGKGSHVVLSTPSATKWYKSFKNP-------------
URED_AZOSB       CHAIVVHPPAGIVGGDALRIDVDLGAGAHALLTTPGAGKWYRSAGAR-------------
URED_DECAR       CQTIVLHPPSGIAGGDHLAISAEVGEGSHAQLTTPGAGKWYRSGGAE-------------
URED_PSEA7       CQHILVHPPGGIAGGDSLAFDVRLGERAWAQLTSPGAAKWYRAACP--------------
URED_PSEAB       CQHILVHPPGGIAGGDSLAFDVRLGERAWAQLTSPGAAKWYRAACP--------------
URED_PSEAE       CQHILVHPPGGIAGGDSLAFDVRLGERAWAQLTSPGAAKWYRAACP--------------
URED_PSEF5       CQHIIVHPPGGIAGGDRLAISARVDSGAWAQLTSPGAAKWYRATGP--------------
URED_PSEPF       CQHIIVHPPGGIAGGDRLDISARVAQGAWAQITSPGAAKWYRAAGP--------------
URED_PSE14       CQHIIVHPPGGIAGGDRLDISATVGADAWAQLTSPGAAKWYRAASP--------------
URED2_PSEU2      CQHIIVHPPGGIAGGDRLDISATVGADAWAQLTSPGAAKWYRAASP--------------
URED2_PSESM      CQHIIVHPPGGIAGGDRLDISVNVGAHAWAQLTSPGAAKWYRAASP--------------
URED_PSEU5       CQHIIVHPPGGIAGGDRLDISVTLGPGAWAQLTSPGAAKWYRAASP--------------
URED_PSEMY       CQHIIVHPPGGIAGGDRLDISAHAGERTWVQLTSPGAAKWYRAAGV--------------
URED_NITOC       CQHMILHPPGGIAGGDTLDIQIHAGSHAWAQLTSPGAAKWYRSEVSL-------------
URED_JANMA       CHAIIVHPPGGIVGGDQLTITARVGDRAHALLTTPGAGKWYRANGQL-------------
URED_NITMU       CQAVVIHPPGGVVAGDELGIRVHVGPSAHAQITSPGATKWYKSKGRT-------------
URED_METFK       CHGIIIHPPGGVAGGDQLQLQATLEASARALLTTPGAGKWYKANQLS-------------
URED_PSYIN       AHIYLLHPPAGIVSGDELRIGIDVKKNAHLLFTTPGAGRFYRAREDLTIGD---------
URED_MARMS       AHIYLLHPPGGLVSGDRLTITANLAENTHVLITTPGAGRVYRARKDKTL-----------
URED2_OCHA4      AHVYLLHPPGGVAGDDVLDISCFLGRGARAVLTTPGATKFYRSER---------------
URED_PSEHT       CHVYLLHPPGGVVSGDALNIDISLTKGAHSLITTPAANKLYKADSNGVA-----------
URED1_PSYCK      CHVYLLHPPGGIASGDSLTIDVTVSENAHALLTTPAANKLYRADSNNVA-----------
URED_MARHV       CHVYLLHPPGGLVSGDELRIEATVAEGGHALLTTPAAAKLYKADSHGVA-----------
URED_CHRSD       CHVYLLHPPGGLVSGDELRIDIEAESGAHALLTTPAATKLYRADSHGVC-----------
URED_HAHCH       PHIYILHPPGGLVCGDEIEIDAKLEHGAEALLTTPSAGKIYRTDAAGHR-----------
URED_SACD2       CHIYLLHPPGGLVIGDNLHIGASLQQGAQALITTPSAGKLYGAKGASEK-----------
URED_LEPCP       CHHVLVHPPGGIVGGDTLEVDLDLAPGSHALITTPGATRYYRSAGEV-------------
URED_METPP       CHHVLVHPPGGIVGGDELALTAQVDTGAHALLTTPGATRFYRSGGDA-------------
URED_ACIAC       CHNVLVHPPGGLVGGDTLDIAATVAPGAHGLVTTPGATRFYRSTGAP-------------
URED_VEREI       CHNVLVHPPGGLVGGDQLDIRASVGPGAHALITSAGATRFYRSMGAP-------------
URED_POLNA       CHNVIVHPPGGLVGGDTLDLAFTAGAGAHGLVTTPGATRFYRSTGEP-------------
URED_POLSJ       CHNVIVHPPGGLVGGDTLDLQFSASAGAHGLITTPGATRFYRSTGEP-------------
URED_RHOFT       CHNVLVHPPGGLVGGDTLDIQIAVGAGAHALITTPGATRFYRSSGEP-------------
URED_NOSS1       CHSVILHTAGGVVGGDRLSYNLHLQPNAQALITTAAAGKVYRS-----------------
URED_TRIV2       CHSVILHTAGGVVGGDRLSYNLHLQPNAQALITTAAAGKIYRS-----------------
URED_NOSP7       CHSVILHTAGGMVGGDRLSSNIHLQPQAQALITTAAASKIYRS-----------------
URED_ACAM1       CHSVMMHTAGGMVGGDRLSINVTLQPQTHALLTTTSAGKVYRS-----------------
URED_MICAN       CHTVILHTAGGIVGGDVLQQKIHLQAATNALITTASAGKVYQS-----------------
URED_THEEB       CHSVILHTAGGYVGGDRLHQKITLEPQCRVLLTTPAATKVYGR-----------------
URED_SYNP2       CHTVLLHTAGGIVGGDRLSLDLELKPESHVFLTTAAANKIYRT-----------------
URED_SYNY3       CQTMLLHTGGGMVGGDRLGYDIVLEAQSDVCFTSASAGKIYRS-----------------
URED_PROM1       CEIPILHSAGGIVGGDQLTINVNAEEDSIAICSSVAAQKVYGSRGRSKLNP---------
URED_PROMT       CEIPILHSAGGIVGGDQLTINVNAEEDSIAICSSVAAQKVYGSRGRSKLNP---------
URED_PROM3       CQLPLLHTAGGLVGGDQLSVNVKAGASSRGLVTSVAAQKVYGSVGRSKQHP---------
URED_PROMM       CQLPLLHTAGGLVGGDQLSVNVKAGADSRGLVTSVAAQKVYGSVGRSKQHP---------
URED_SYNS3       CELPLLHTAGGLVGGDQLSINLGLRPNSRCLLTSVAAQKIYGSIGRSQLHP---------
URED_SYNS9       CELPLLHSAGGLVGGDQLSVDLELGRNSRALITSVAAQKVYGSIGRSRLHP---------
URED_SYNSC       CELPVLHTAGGLVGGDQLSLDFKLEANSRGLITSVAAQKVYGSIGRSRLQP---------
URED_SYNPX       CELPLLHTAGGLVGGDELSIELDLGPDSRSLITSVAAQKVYGSVGRSRLHP---------
URED_SYNR3       CVMPLLHTAGGLVGGDQLEIALHAAAGSRSFLTSVAAQKIYGSRGRSRVQP---------
URED_PROM2       CILPVLHTAGGLVGGDLLEFEVNLEKNSKVLLTTSSAQKVYGSVGISKVNP---------
URED_PROM0       CILPVLHTAGGLVGGDSLEFEVNLEKNSKVLLTTSSAQKVYGSVGISKINP---------
URED_PROMS       CILPVLHTAGGLVGGDLLVFEVNLEKNSKVLLTTSSAQKVYGSVGISKINP---------
URED_PROM9       CILPVLHTAGGLVGGDLLQFEVNLEKNSKVLLTTSSAQKVYGSVGRSKINP---------
URED_PROMP       CILPILHTAGGLVGGDLLEFEANIGINSKVLLTTSSAQKVYGSVGRSKINP---------
URED3_METEP      --GVLVNTGGGIACGDVFTVSVTVEPGGACVLTTTAAEKIYRSD----------------
URED2_METPB      --GVLVNTGGGVACGDVFEVSVMVEAGAACLLTTTAAEKIYRSD----------------
URED1_METRJ      --AVLVNTAGGVACGDSFAIDLALEPGADLVLTTTAAEKIYRSD----------------
URED_METS4       --GVLLNSAGGLACGDRFAVAAEIGEGADMVLTTTAAEKIYRSD----------------
URED_XANP2       --AVIVNTAGGVACGDVFSIEAKAGPGAHLTVATPAAEKVYRSD----------------
URED_AZOC5       --GVLVNTAGGVACGDHFTIEVKAEAGAHAVVATPAAEKIYRSD----------------
URED_BRADU       --GVFVNTAGGVAGGDRFDVEISAADAARLTLTTAAAEKVYRAP----------------
URED_RHOP5       --AMFVNTAGGIAGGDRFAVDIAAGEGTRLTLTTAAAEKIYRSN----------------
URED3_BRASB      --AMFVNTAGGIAGGDRFAVEVAAGEGSRVTLSSAAAEKVYRAP----------------
URED1_BRASO      --AMFVNTAGGIAGGDRFAIEVAAGEGSRVTLSSAAAEKVYRAP----------------
URED_RHOPB       --AVFINTAGGIAGGDRFDTDIAAGEGTRLTLTTAAAEKLYRAA----------------
URED_RHOPS       --AVLVNTAGGVAGGDRFSIDIAVGESARLTLTTAAAEKIYRSH----------------
URED_RHOP2       --AVLVNTAGGIAGGDRFGVDIAVGESARLTLTTAAAEKIYRSH----------------
URED_RHOPA       --AVLVNTAGGVAGGDRFSISLDVQAHARLTLTTAAAEKVYRTH----------------
URED_BEII9       --GMIVNSAGGIAGGDHLRLAIEAEEQSELVIATPAAEKIYRAR----------------
URED_RHIEC       --AVIINTAGGLTGGDRMDWSVVAGAGTKIDVTTQACEKIYKAS----------------
URED_RHIL3       --AVIINTAGGLTGGDRMDWSVDAGPGTRIDVTTQACEKIYKAS----------------
URED_AGRFC       --AILINSSGGLTGGDDIEWQATAGAGTSLVVTTQACEKVYKAS----------------
URED_RHIME       --AVLINSSGGVTGGDRLSWEFRAGKGTKLTLTTQACEKVYKAA----------------
URED_SINMW       --AVLINSSGGVTGGDRLAWEFEAGEGTNLTLTTQACEKVYKAS----------------
URED_CHESB       --AVLINTSGGLTGGDRIDWKADALAGSKLVVTTQACERIYRST----------------
URED1_BRUAB      --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED1_BRUA2      --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED1_BRUC2      --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED1_BRUSU      --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED1_BRUO2      --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED1_BRUME      --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED_BRUSI       --AILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSG----------------
URED1_OCHA4      --AILINTSGGLTGGDRLQWDVELGENASAVITTQACERIYRSG----------------
URED_RHILO       --AVLINTAGGLTGGDRIGWDVDVGTEASASITTQACEKVYRAA----------------
URED_ROSDO       --ATLINTAGGVTGGDRFDIDGCAGAGSRLTITTQAAERAYGAQI---------------
URED_RUEST       --AVTVNTAGGITGGDDFALTAKAGAQSQLTLTTQAAERVYRAQP---------------
URED_RUEPO       --AVLLNTAGGVTGGDRLSFSAQVRAGTRLSVTTQACERAYRAQP---------------
URED_DINSH       --VVFLNTAGGVTGGDSLSYRLDLEAGAQATGATQTAERTYRSS----------------
URED_JANSC       --VVFLNTAGGITGGDRLDYALHVDDGT-CVGTTQTAERAYRSH----------------
URED_RHOS4       --VVFLNTSGGLTGGDRLSYRLEVGEGCRATATTQTAERAYAAG----------------
URED_RHOS1       --VVFLNTSGGLTGGDRLSYRLELGAGCRATATTQTAERAYAAG----------------
URED_RHOS5       --IVFLNTSGGLTGGDRLSYRLEVGEGCRAVATTQTAERAYAAG----------------
URED_PARDP       --IVFLNTAGGLASGDRLDYRIELAPRTQALATTQTAERAYRAK----------------
URED_MAGMM       --GVVVTTSGGLVGGDQLDIELIARPHTQLLVMTQAAEKVYRST----------------
URED_FRAAA       MTVHLVNGAAGPLAGDDLRLDISVGGGVRLVLRSVAATVALPGR----------------
URED_FRACC       ATVHLVNATAGPLAGDDLGLDISVGSGVRLVVRSVAATVALPGH----------------
URED_FRASN       VVVHLVGGAGGPLAGDDLGLDIIVGAGAHLVVRSVAATVALPGH----------------
URED1_SACEN      AVVHLVGSATSPMGGDRVDLRVHVGAGAALRLSGTAATVALPGQ----------------
URED_STRAW       ARVMLVGAMSGPLGGDHFTVEATVAAGARLHVGSAAATIALPGQ----------------
URED_STRCO       ARVMLVGAMSGPLGGDHFEVGAHAANGARLRVGSAAATLALPGQ----------------
URED3_STRGG      ARVTVVGAMSAPLNGDRLAVEAEVTDGAHLTVDAAAATVALPGPRP--------------
URED2_SACEN      ARVCVVSAMSAPLGGDRLAIDVSVEAGAQLEITTAAATLALRGA----------------
URED_ANADF       AWIISASHGGGLLAGDEVSLEVDVGAGAVALLSTQAGTKIYRSRG---------------
URED_SORC5       AWVFVASFGGGLVGGDELNLHARVGRGAAALLSTQASTKVYRSP----------------
URED_SYNJB       -VYYLRNPNGGLLGGDRHRIEIGLGPGSALEIRTQGAMRLHPGL----------------
URED2_SYNJA      -LYYLRNPNGGLLGGDRHHIAIELGAGAGLAIRTQGATRLHPGL----------------
URED1_BRASB      LTLYLQSASGGLYAGDRIGLDLSVARGAAFHLTTQSATVVRDGRGRG-------------
URED3_BRASO      LTLYLQSASGGLYAGDRIALDVSVARDAAFHLTTQAATVVHDGRGIG-------------
URED1_METEP      ATLYLQSASGGLYAADHLTLAIAARAGARAHVTTQAGTVVHRGGPEP-------------
URED1_METPB      ATLYLQSASGGLYAADHLTLDIAARPGARVHVTTQAGTVVHRGGPEP-------------
URED2_METRJ      ITLYLQSASGGLYRGDRLGLDIAMGPGSAAHVTTQAATVVHRSADRP-------------
URED1_PSEU2      AAVYLQSCSGGLFAGEQLHLHLHAGPGTQVHVSTGAATVAHSMLEQS-------------
URED1_PSESM      AAIYLQSCSGGLFAGETLHLQLHAGPHTQVHVSTGAATVAHSMLEQP-------------
URED2_BRASB      LSVILQTGSGAVHGEDRLTQRFTLREGAAVSVTTQGATSVHRAEPGAR------------
URED2_BRASO      LSVILQTGSGAVHGEDRLTQRLTLHAGAAVCVTTQGATSVHRAEPGAR------------
URED2_METEP      PVCPIISVGGGILQGDRYTIDIAVGEGACAHVSTQGANRIHCMDANYA------------
URED3_METPB      PVCPIISVGGGILQGDRYTIDITVGEGACAHVSTQGANRIHCMDANYA------------
URED_YERPS       PCVTMISTSGCILQGDRLATDVHVEAGACAHVTTQSATKVHMMNANYA------------
URED_YERP3       PCVTMISTSGCILQGDRLATDVHVEAGACAHVTTQSATKVHMMNANYA------------
URED_YERE8       PCVTMISTSGCILQGDRLATDVIVEAGACAHVTTQSATKVHMMNANYA------------
URED_PHOLL       PCVFMISTSGCILQGDRLALDIHVAPEAFGHVTTQSATKIHSMENNYA------------
URED2_BRUAB      PCVSIISNAGGILQGDRYAIEIDLEPDTQAHVTTQSATRIQEMDANFA------------
URED2_BRUA2      PCVSIISNAGGILQGDRYAIEIDLEPDTQAHVTTQSATRIQEMDANFA------------
URED2_BRUME      PCVSIISNAGGILQGDRYAIEIDLEPDTQAHVTTQSATRIQEMDANFA------------
URED2_BRUSU      PCVSIISNAGGILQGDRYAIEIDLEPDTQAHVTTQSATRIQEMDANFA------------
URED2_BRUC2      PCVSIISNAGGILQGDRYAIEIDLEPDTQAHVTTQSATRIQEMDANFA------------
URED2_BRUO2      PCVSIISNAGGILQGDRYAIEIDLEPDTQAHVTTQSATRIQEMDANFA------------
URED_CENSY       AHVYVLSPSGGLLQGDRYKTSISLKDKAAAHVTTQGASRIYGMNSNCA------------
URED_HALWD       ITVCLQDPTGAITQGDRHSLTVTARPDAYAHITNQSASKVQTMKASYA------------
URED_NATPD       TTLCLQEPTGGVAQGDRHSITVTAREGARARVTTQSATKVHSMQANYA------------
URED_HALMA       DTVFIQSPTGGVAQGDRHDVSITVGDEAVAHVSTQSSTKVQTMTCNYA------------
UREH_HELPY       --IMLLAVSPGMMRGDAQDVQLNIGPNCKLRITSQSFEKIHNTEDG--------------
UREH_HELPJ       --IMLLAVSPGLMKGDAQDMQLNIGPNCKLRITSQSFEKIHNTEDG--------------
UREH_HELHP       --IMLISVSAGLLKDDCQDIQIHIGKESKIRLISQSYEKIHDTQDG--------------
URED_HAEIG       LNAMQMSSSPGVLAGDLLEIDISLAKLTALSLNTQAFTRVQAMNEGD-------------
URED_HAEIN       LNAMQMSSSPGVLAGDLLEIDISLAKLTALSLNTQAFTRVQAMNEGD-------------
URED_ACTPJ       LNAMQMSSSPGLLASDLFDIEISLADDTALSLNTQAFTRVQSMNEGD-------------
URED_ACTP2       LNAMQMSSSPGLLAGDLLDIEISLADNTALSLNTQAFTRVQSMNEGD-------------
URED_ARTS2       VCYVVVNPGGAYLGADLYVIDVEVGDGAKLLLTTQSATKIYRTPGSF-------------
URED_PAEAT       VGYVMVNPGGAYLGADLFLIDVTVENNAALLLTTQSATKVYRTPGSF-------------
URED_KOCRD       VTYTVVNPGGAYLGADAYLLDVAVERDASLVLTTQSATKVYRTPQGP-------------
URED_CORGL       VCYTIIAIGGGYLGGDVYEQQFTIKDNAKALITTQSATKIYRTPQGP-------------
URED_COREF       VSYTLINPGGGFLGGDVYDIDVEVGDGAGLQLCTQSATKIYRTPQGP-------------
URED_BACC1       AYYYIMNSGGGYLKGDFYSININVGKDAKTYITSQSATKVYKTPNSY-------------
URED_LACP7       ACFYIMNPGGGYVDGDTYRMDIHLAKEAQLLLTTQSASKIYKTPKNP-------------
URED_STAA8       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAAE       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAAT       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAA3       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAAC       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAA2       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAA9       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAAR       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAAS       PTFYIVNVGGGYLDGDRYRMNVNVEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAAB       PTFYIVNVGGGYLDGDRYRMNVNIEDNAKVTLTSQGATKIYKTPSNH-------------
URED_STAES       PTFYIVNVGGGYLDGDRYRVNVNLEDNAQVTLTSQGATKIYKTPNDH-------------
URED_STAEQ       PTFYIVNVGGGYLDGDRYRVNVNLEDNAQVTLTSQGATKIYKTPNDH-------------
URED_STAS1       PTFYIVNVGGGYLDGDRYTMNFNIDSDAKVILTSQGATKIYKTLNDH-------------
URED2_STRGG      SYVYIMATGAGVAQADRYRMDFRCGPDTQVHLTTQAATKIFRMEHDY-------------
URED_HUNT2       MNLMVMSASAGVMEGDNYRIEVELDKGARVKLEGQSYQKIHRMKNGT-------------
URED_FLAJ1       LYLMLMSSSPGILDNDHYDINIQIESESRLMLESQSYQRLFNMQNG--------------
URED_UREPA       PCFQTISMGGGYVSGEIYRSDFEINDDARCIITTQSSAKAYKTVDGK-------------
URED_MYCS2       GTLTLQNAAGTVIPGDVIRQRIEVVDGGRAAVNGQGATLISGVPGGD-------------
URED_MYCGI       VTLCVQSPSGGTFSDDELRTTVACRAGSHLHLTTQSATQVFAGDGAG-------------
URED1_STRGG      LRIALVGTRAGLLAGDDLRLHVSVGPGARLDLVEPSGLVAYDHRGGR-------------
URED_OPITP       LLVQVVNPTAGILAGDRIESEITVDAGAALLITTPSASRVFRMDAGV-------------
URED_DEIRA       LMVFIVNPTGGVLGGDHSEIHVEAGAGTRVLILTQSATRVQPSPGGE-------------
URED_HERA2       SFVHLHNVAGGVLAGDQLTTTIKLAASTKAQLTTTSSTRIYRSDGEQ-------------
URED_BACHD       ATVYLVETSGGVVSGDSQTIAIYVGEGARVELIPQSATKVYPSRKQGE------------
URED_LYSSC       ATVFLMESSGGMVAGDRNEINVKLASGSRVRLKQQSALKIYPSHTGD-------------
URED1_SYNJA      -VLQLLTLGPGLMGGDQVEIRVHVAPGAKVILLNQSATKVLPARGYR-------------
URED_TRIEI       AYLYLINTSPGLLAGDNLSLSLQLEKGTSVYLTDQAAIKVHAMPMTTT------------
URED_CYTH3       CHLVFSNYGGGFVEGDSIDLTIDCKADTVSAFSSQANTRIYRSEHGK-------------
URED_ARCB4       -YIKLLNIGEGIFPKDKIRTSLSL-DNSNLIFTTESATKIYPSKKE--------------
                                :                                            

URED_ACIBC       -----------------KHAFQHIYLNVKDDSILEWMPQETMLFDGALAHSETDIHLEQT
URED_ACIBT       -----------------KQAFQHIYLNVKDDSILEWMPQETMLFDGALAHSETDIHLEQT
URED_ACIAD       -----------------KQAFQHIYLNIANDSTLEWLPQETMLFDAAYAQSETIIHLDQT
URED2_PSYCK      GTQSANSNTSNDCFNDVVSAEQHIDARLDDHAVLEWLPQESIYYDHSVSTANNRFYLAKT
URED_CITK8       -------------------AQLRQDFYLAPQATLEWLPQDTILFPGANANIQSVFHLAQE
URED_KLEP7       -------------------ALVRQQLTLAPQATLEWLPQDAIFFPGANARLFTTFHLCAS
URED_ENT38       -------------------ARLNQHFFLEENATLEWLPQDTIFFPGANAVLQSVFHLHHS
URED_PSEP1       -------------------ARLTQRFHMATGSTLEWLPQDSIFFSGARASLASRFTLEPG
URED_PSEPK       -------------------ARLAQRFHLAAGSTLEWLPQDSIFFSGARASLASRFTLEPG
URED_PSEPG       -------------------ARLTQRFHLAAGSTLEWLPQDSIFFSGARASLASRFSLEPG
URED_PSEE4       -------------------AHLAQRFHLAAGSTLEWLPQDSIFFNGAQASLDSRFSVEPG
URED_SHEHH       -------------------AWQSQELTVAKDGLLEWLPMENIFFPGANCKLLTQVNLATN
URED_ALIF1       -------------------SSQTQNLTVESDGFLEWLPQENIFFPDSQAQLKTQVELHKN
URED_ALCBS       -------------------AHVSQTLTVQAGGTLEWFPQENIFFPGARVQMDTRIDLHGD
URED_BLOFL       -------------------ILQEHIFKLKDNTSLEWLPQSSIFFPNTKVKINTIFHLEPG
URED_BLOPB       -------------------SEQKHIFRLERNTALEWVPQSSIFFPKSKAKIDTTFIIEQG
URED_ALKEH       -------------------SIQRQVFRLAPGATFEWLPMETILHGGSRSRLINRFELAEG
URED_BORBR       -------------------ASQDVHLRVAAGGRLDWLPLESIFFEEADALARNRIQLESG
URED_BORPA       -------------------ASQDVHLRVAAGGRLDWLPLESIFFEEADALARNRIQLESG
URED_BORPE       -------------------ASQDVHLRVAAGGRLDWLPLESIFFEEADALARNRIQLESG
URED_DELAS       -------------------AAQRVRLRVEEGAILEWLPQENMLFAGADATMALDLDLAPG
URED_BURCA       -------------------ATQRIGIAVGPHAKLDWLPQNNLFFDAAHAALDFTVTLGEG
URED_BURCH       -------------------ATQRIGIAVGPHAKLDWLPQNNLFFDAAHAALDFTVTLGEG
URED_BURCM       -------------------ATQRIGITVGAHAKLDWLPQNNLFFDAAHAALDFTVTLGAG
URED_BURL3       -------------------ATQRIGITVGEHAKLDWLPQNNLFFDAAHASLDFTVKLGTG
URED_BURVG       -------------------ATQRIDIKVGAHAKLDWLPQNNLFFDAAHAALDFTLSLGAH
URED_BURMA       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURM9       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURM7       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURMS       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURPS       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURP0       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURP1       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURP6       -------------------ARQRIDIDVGAHAKLDWLPQNNLFFDAAHASLEFVLALGDG
URED_BURTA       -------------------ARQRIDIDVGARAKLDWLPQNNLFFDATHASLEFVLKLGDG
URED_PARXL       -------------------AQQCVGVRVGAGGKLDWLPQNNIVFDQANAKLDFSLMLGDG
URED_CUPNH       -------------------AAQHVRLTVGAGARLDWLPQENIVFDDARARISTVLDVAPG
URED_CUPPJ       -------------------ASQHVRLTVEEGARLDWLPQENIVFDDARARIATELSIAPG
URED_CUPMC       -------------------AAQHVRIEVAAGGKLDWLPQENIVFDDARARITTDVVVAPG
URED_RALSO       -------------------AMQQVAIRLDAGARLDWLPQENIVFNQARPVIDLTLDLAPG
URED_POLAQ       -------------------ATQNVQFELGENAKLDWLPQENLFFKGANSNLITKLNLPAS
URED_AZOSB       -------------------GSLVQRIAVGDGAVCEWLPQESIVYDGAAGDLATEVDIAGD
URED_DECAR       -------------------ASQRVAFTVGEGATLEWLPQETIVFDGARARMETQVDLAAD
URED_PSEA7       -------------------SRQTLEIHLEPGATLEWLPQESIVFAGAQAELETRIQLRGD
URED_PSEAB       -------------------SRQTLEIHLEPGATLEWLPQESIVFAGAQAELETRIQLRGD
URED_PSEAE       -------------------ARQTLEIHLEPGATLEWLPQESIVFAGAQAELETRIQLRGD
URED_PSEF5       -------------------ASQTLNLQVAPGATLEWLPQETIVFSAAQAELTTRIELQGD
URED_PSEPF       -------------------AYQSLNLHVADGATLEWLPQETIVYSAAQAELTTSIELEGD
URED_PSE14       -------------------AFQQLELHVQPGATLEWLPQETIVFSNAQAELTTRIELHGD
URED2_PSEU2      -------------------AFQQLELHVQPGATLEWLPQESIVFSNAQAELSTRIELHGD
URED2_PSESM      -------------------AFQQLELHVQPGATLEWLPQETIVFSNAQAELTTRIELHGD
URED_PSEU5       -------------------AFQDLQLRVEAGATLEWLPQETIVYSAAQAELNTRIELHGD
URED_PSEMY       -------------------ARQDLRLRVEAGATLEWLPQETIVYAGAQAELHTQIELHGD
URED_NITOC       -------------------ARQNLALSTEPGGILEWLPQETIFFAGCQTALDTTIDLAED
URED_JANMA       -------------------SQQQVSLEVGADAALEWLPQETIFFNEADVRLEHNVTLAAD
URED_NITMU       -------------------ARQHVYLHAEAGGVLEWMPQETIFFNNARVMLHHEVELEKD
URED_METFK       -------------------ASQAVRFHLAANSCLEWLPQENILFDGSNVHFSSEIDLAEG
URED_PSYIN       -----------------SQQTQITQFDLEAQAKCENFPQETIVYEGADGFNSVDINLTST
URED_MARMS       -------------------QHQITQLNVAENSLMEWLPQETILYPNAHTRLENRIHLANN
URED2_OCHA4      -----------------GQSTQTTRIDVGEGGICEYLPQETIVFDGAKASIGTKVFLSGD
URED_PSEHT       -------------------WSQTTNLKVDDNATLEWLPQETLAFDGSRGVQVFNIELAKT
URED1_PSYCK      -------------------WTQHTHLKVEDGATLEWLPQETLAFDGSRGEQTVIIDLAET
URED_MARHV       -------------------WGQHTRLQVAKDAILEYLPQETIAFDGSRGLQTTTIELATG
URED_CHRSD       -------------------WGQHTHLSVRPGALLEWLPQETLCFDGARGMQSTTLDVQGD
URED_HAHCH       -------------------QCQTVRLNCADAQSLEWLPQENIIYDGAEGAQTLLLETSAA
URED_SACD2       -------------------QGQQVEFNLAAESCLEWLPQETIIFDGANGTLSTKVNLTGN
URED_LEPCP       -------------------ARQQVRARLAEGSRLEWLPLETIAYDACIAENSLRFEIAPG
URED_METPP       -------------------ALQTLTARVADGARLEWLPLETLVHDGARARNALRFELAPG
URED_ACIAC       -------------------ALQRTQATLAAGARLEWLPLEALCYSACQAENRLTLSLSPG
URED_VEREI       -------------------VLQRTCLSLAPGARLEWLPLEALCYNACNAENRLTLTLAPG
URED_POLNA       -------------------ALQRTRLSLEAGARMEWLPLEAICYSGCLAENRLTMELASG
URED_POLSJ       -------------------ALQRTHLTLEAGARMEWLPLEAICYSGCLAENHLTMTLAPG
URED_RHOFT       -------------------AVQRTRLRLEALARMEWLPLEAILYSGCQAENHLSFELAPG
URED_NOSS1       ---------------DGLQARQTIEIKIDAGACLEWLPQETILFNGAIYRQDLRVELATG
URED_TRIV2       ---------------EGLQARQTIDIKIDAGACLEWLPQETILFNGAIYRQDLRVELATG
URED_NOSP7       ---------------NGLQARQTIQMQVDPGACLEWLPQETILFNDAIYRQDLRVELATG
URED_ACAM1       ---------------NGHGAQQTVQCQLDTNAILEWLPLGTIVFDQAQFRQTLQVELGPG
URED_MICAN       ---------------NGQMAQQLIEIKIDDNASLEWLPQETIIFNGAAFRQHLRVDLGEN
URED_THEEB       ---------------AQIPVEQTLHCHVADEAVLEWLPQETIIFAGAQFHQRLRIDLAPQ
URED_SYNP2       ---------------NGETAQQDGIIHQAPGSILEYFPQEMIIFDGAEYHQSLRVNLAPG
URED_SYNY3       ---------------LGPWSEQTVNLEVRVGASVLWCPQETIIFDQARYQQNFCIKLQEQ
URED_PROM1       ---------------QGSWANQKCFFQIKKNSDFEWIPQELIVYQGGLFEQNMTVNLDLS
URED_PROMT       ---------------QGSWANQKCFFQIKQNSDFEWMPQELIVYQGGLFEQNMTVNLDPS
URED_PROM3       ---------------KGLWASQECHFELATNADLEWLPQELVVFQGGLYKQRMQVELQPK
URED_PROMM       ---------------KGRWASQECHFELETNADLEWLPQELVVFQGGLYKQRMQVELQPK
URED_SYNS3       ---------------LGTWARQQVSAELDADSDLEWLPQELVLYADALFEQNLSVTLPMD
URED_SYNS9       ---------------KGTWANQSVSCRLGSNSDLEWLPQELVVYADALVEQSLDVQLADD
URED_SYNSC       ---------------EGCFAHQQVRCSLASGSDLEWLPQELVLYADALFEQQLTVTLPQD
URED_SYNPX       ---------------DGAWTQQSVTCRLEDTSDLEWLPQELVLYADALFQQTLTVSLPDN
URED_SYNR3       ---------------QGRWAQITLQAELEAGADLEWLPQETVVFAGALLEQQQQITVAPG
URED_PROM2       ---------------KGTFSKQNNLIKILDNSHLEYLPQETIIFANGLYEQKFKVFISET
URED_PROM0       ---------------KGTFSKQKNLIKILDNSHLEYLPQETIIFANGLYEQKFKVSISET
URED_PROMS       ---------------KGSFSKQKNLINILDNSHLEYLPQETIIFANGLYEQIFKVSISET
URED_PROM9       ---------------KGSFSKQKNYIKILDNSHLEYLPQETIIFANGLYDQKFKVFISEN
URED_PROMP       ---------------EGTFSSQKTKISILDNSHLEYLPQETIVFANGLYSQEFNIKISDN
URED3_METEP      ----------------GPCAEIVNRASVGAGGRLDWLPQETILFDRARLVRRFEADLAPD
URED2_METPB      ----------------GANATILNRIEVGPAGRLDWLPQETILFDRARLVRRFEADLAPD
URED1_METRJ      ----------------GPVSRIANTLTLGEGAGLAWLPQETILFDRARVRRRFEADLADG
URED_METS4       ----------------GPVTEIAAELRLGPRARLAWLPQETILYDGARLSRRLTAEIAPD
URED_XANP2       ----------------GLCADIQVRLVAEAGARLDWLPQETILFDRARLRRRYEIDLSAT
URED_AZOC5       ----------------GETARIDVAITVEAGAQVDWLPQETLLYDAARLARRFTVDLAPD
URED_BRADU       ----------------GPAAELNIALKVGAGAHLSWLPQETILFDRARVHRRFDIALDEA
URED_RHOP5       ----------------GPTSRLDIALKVAAGAALHWLPQETILFDQARVERRFEIDVAEG
URED3_BRASB      ----------------GKPAELDIALTAAAGAHIAWLPQETILFDRARIHRRIDIDLAAT
URED1_BRASO      ----------------GTPAELAIALRAADSAHISWLPQETILFDRARIHRRMDIDLAET
URED_RHOPB       ----------------GAPAQIRIALAAAANAHLAWLPQETILFDQARVARSIDIDLAET
URED_RHOPS       ----------------GPSAQLDITLKVADDGHLGWLPQETILFDQARVERRIDIELAPR
URED_RHOP2       ----------------GPAAQLDIALQVAEGGHLAWLPQETILFDQARVERRIDIDLAAG
URED_RHOPA       ----------------GPAAQLDIKLKVASGGHLAWLPQETILFDQARAERRIDIELADD
URED_BEII9       ----------------DKAAMLDLSLVLAPETKLAFLPQETILFDGAALSRRLDVTMAND
URED_RHIEC       ----------------AGVAEVTTRIEAGAGARVDWLPQETILFDRAALFRRLDVDLDES
URED_RHIL3       ----------------AGIAEVATSIKVGAQARVDWLPQETILFDRAALFRRLDVDLDES
URED_AGRFC       ----------------SGTATVTARISAGPGAKLHWLPQETILFDRASLNRRLEADLDQS
URED_RHIME       ----------------AGTAEIATRISVAAGAHVDWLPQETILFDRSALSRSLEVDLAAD
URED_SINMW       ----------------VDTAVVATRISVAARGHVDWLPQESILFDRSALSRSLEVDLAPD
URED_CHESB       ----------------GDDARVSTALRVGPGAHVDWLPQETILFEGSRLHRSLRVDLEDN
URED1_BRUAB      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED1_BRUA2      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED1_BRUC2      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED1_BRUSU      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED1_BRUO2      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED1_BRUME      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED_BRUSI       ----------------GGEARIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEG
URED1_OCHA4      ----------------GGEARIATRLKAAKGTRLAWLPQETILFNQSVLSRTLDVELEEG
URED_RHILO       ----------------SDQAEVRVKLTVGENGRIAWLPQETIVFDRAAFARTLDVELAAG
URED_ROSDO       ----------------GQTGEIKTNLKAEAGSRLFWLPQETILYKDAAIDRQLGVDLSTG
URED_RUEST       ----------------HQTGQMTTRLSVEPQARLRWVPQETILFQHSAFRRSLHVELADD
URED_RUEPO       ----------------GETGQVRNHLSVATGARMNWLPQETILYDGSSLDRRLSVEIEPG
URED_DINSH       ----------------AGTGEMRVHLTLGSGARLDWLPQETILFDGSATRRCTEVEMAAD
URED_JANSC       ----------------GPMGRVSTRLTIGQGATLHWVPQEMILFDGVALERDLSVEMAGD
URED_RHOS4       ----------------AGAARVEVLHEVGRDGWLDWLPQETILFEGAALERETQISLAPG
URED_RHOS1       ----------------AGAARVEVLHEVGRDGWLDWLPQETILFEGAALERETQISLAPG
URED_RHOS5       ----------------RGVAQVRVAHEVGAGGWLDWLPQETILFEDSALDRRTEIVLGPG
URED_PARDP       ----------------DAPAQIRLHLQVGEGGWLDWLPQETILYDGARLGRETAVDLAPG
URED_MAGMM       ----------------GADSTVQIALHVEAGAFLEWLPQETILFDQGRLRRTTQVYLGEN
URED_FRAAA       ---------------GPGPSRLTVTAEVADGGELDLGPEPTVVADGADHQISTDVRLAAT
URED_FRACC       ---------------GPGPSRFTVSARVAPGGALDFAPEPTVAARGSDHLLVTDVHLATT
URED_FRASN       ---------------GAGPSTFALRAQVGPAAMLSFLPEPTVVARGARHRMTTEIILAAD
URED1_SACEN      ---------------RTGHSRATVRIEVEAGGTVEYLPEATVVSGRADHRADMRVELAEH
URED_STRAW       ---------------AKGEARYDVLLDVAAGGELRWLPEQLISAGGSELYVSTRIDLEPG
URED_STRCO       ---------------DKAGARYDVRLTVDDDAELYWLPEQLISAGGSDLTVTTSVDLAAG
URED3_STRGG      ---------------DADPSTYGVDLTVGEGAVLHWLPEQLVSAHGSDLRMTTRVRLAPT
URED2_SACEN      ---------------TTDHATYDVTLTVGEQATLYWLPQPLISTRGSNLRQTYTVDLAPT
URED_ANADF       -----------------EVASQGLSARVGAGALLAALPHPVSCFSGARFRQEQRFELARG
URED_SORC5       -----------------LVSRQRLEAEVQAGGLLVAIPDPVVCFAGSRYEQDIDVALADD
URED_SYNJB       -------------------IRQQVKVKLAPTSQLIWIPHPTIPGAGADFRQQVQIELDPT
URED2_SYNJA      -------------------IRQQAKVKLAPTSQLIWIPHPTIPGAGADFRQQVQIELDPS
URED1_BRASB      ------------------AVQRLA-VNVEAGAFCAVTSDPYVLFPGAELALASEATVADD
URED3_BRASO      ------------------ALQRQT-ITVDSGAFCAITTDPYVLFPGAELALDTVATVADD
URED1_METEP      ------------------SRQETR-LTIAADAFLALNPDPLILFPGAHLAVSTEITAEPG
URED1_METPB      ------------------TRQDTR-LAIAADAFLALNPDPLILFPGAHLAVSTDITAEPG
URED2_METRJ      ------------------ARQDTR-IRVAADAFLHCVPDPLILFPGAALSATTQITLEPG
URED1_PSEU2      ------------------ARQTVT-LVAEADALLEYLPMATILFPQTRLHSQVNVTLHPG
URED1_PSESM      ------------------ARQTVT-LIAETGALLEYLPMATILFPQARLHSVVNVTLHPN
URED2_BRASB      ------------------AVEQVQ-LRVAAGASLDYRPEPRILFPDAALCQVLELDCAAD
URED2_BRASO      ------------------AVEHVL-LHVEAGASLDYRPEPRILFPDAALCQVLDLECAAD
URED2_METEP      ------------------SQHQT--VTVAAGGYLEYLPDFTIPYRGSRFLSRTDLVVAAD
URED3_METPB      ------------------AQHQN--VTVEAGGYLEYLPDVTIPYRGSRFLSRTEIVVAED
URED_YERPS       ------------------SQIQN--FIVEEGGYLEFMPDPLIPHRNSRFITDTTISIHPT
URED_YERP3       ------------------SQIQN--FIVEEGGYLEFMPDPLIPHRNSRFITDTTISIHPT
URED_YERE8       ------------------SQIQN--FTVEEGGYLEFMPDPLIPHRNSRFITDTTINIHPT
URED_PHOLL       ------------------AQVQT--IQIEQGGYLEMMPDPVIPHSGSRFITDTQITIHPT
URED2_BRUAB      ------------------TQTQTQTITLGANSYLEYIPHPIIPHKHSRFVQQTEVTIHPT
URED2_BRUA2      ------------------TQTQTQTITLGANSYLEYIPHPIIPHKHSRFVQQTEVTIHPT
URED2_BRUME      ------------------TQTQT--ITLGANSYLEYIPHPIIPHKHSRFVQQTEVTIHPT
URED2_BRUSU      ------------------TQTQT--ITLGANSYLEYIPHPIIPHKHSRFVQQTEVTIHPT
URED2_BRUC2      ------------------TQTQT--ITLGANSYLEYIPHPIIPHKHSRFVQQTEVTIHPT
URED2_BRUO2      ------------------TQTQT--ITLGANSYLEYIPHPIIPHKHSRFVQQTEVTIHPT
URED_CENSY       ------------------IHKMD--ISAGKGCYLEYIPDQVIPYAKSRYFQEVRLAIDDD
URED_HALWD       ------------------HLEAT--LIAESGAYLEYLPEPTILNEDARCLQTTTVEMAPD
URED_NATPD       ------------------HLDAT--LEAGPDAHLEYVPGPTIVNEDARCLQTVAVDLAPS
URED_HALMA       ------------------AADTT--LSVGAGGHLDYVPEPTILHADSRYLQELSVDLAPG
UREH_HELPY       ------------------FASRDMHIVVGENAFLDFAPFPLIPFENAHFKGNTTISLRSS
UREH_HELPJ       ------------------FASRDMHIVVGENAFLDFAPFPLIPFENAHFKGNTTISLRSS
UREH_HELHP       ------------------YASKHTQITIEENAFLDYAPLPILPFKDSSFKNTTDIYLSKN
URED_HAEIG       ------------------SAMQTTHILLAENSRLFYLPHPLVLHKDSVFKQKTLIEMDEQ
URED_HAEIN       ------------------SAMQTTHILLAENSRLFYLPHPLVLHRDSVFKQQTQIEMGEQ
URED_ACTPJ       ------------------YATQKTCIKLGKNSRLFYLPHPLVLHKDSSFKQTTEIEMSEQ
URED_ACTP2       ------------------YATQKTCIKLGKNSRLFYLPHPLVLHKDSGFKQTTEIEMSEQ
URED_ARTS2       -------------------AEQRVCLRLGEGAQLELAPDQLIAYREASYRQNTRITVRPS
URED_PAEAT       -------------------AEQRMSVRLGEGSRLELMPDQLIAYREASYRQNSRISLHPT
URED_KOCRD       -------------------ATQDMTVRLGPGSCLEHVPDQLIVYRGGSYLQRTRVDMDPA
URED_CORGL       -------------------ATQHTEINVGENAVLEYLADQTIAYREATYHQFTKVALHPS
URED_COREF       -------------------AVQQTVVKLGKRALLESVPDPVIVYRGGTYRQSTRVEMDES
URED_BACC1       -------------------ALQELNFYIGQNAAMEYLPDPLIMYKDAAYKQKTNIYMQNN
URED_LACP7       -------------------VVQEINITLKEGSLLEYLPDPIIGYKNSRYKQKTIVHMEKG
URED_STAA8       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAAE       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAAT       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAA3       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAAC       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAA2       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAA9       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAAR       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAAS       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTFNLNNS
URED_STAAB       -------------------VEQYQTFNLKDNAYLEYVADPIIAYENAKFYQHNTLNLNNS
URED_STAES       -------------------VEQYQTFNLSNQSYMEFVADPIIAYENAKFFQHNTFNLKED
URED_STAEQ       -------------------VEQYQTFNLSNQSYMEFVADPIIAYENAKFFQHNTFNLKED
URED_STAS1       -------------------VEQYQTFNIKNNGYAEYVGDPIIAFENAKFYQHNVFNLEST
URED2_STRGG      -------------------ASQRVHLSAEAGSYVEYLPDPLIPFKGSRFYQRTEVTVAPG
URED_HUNT2       -------------------AVQYNSFTLADGAFLDYAPNPTIPFADSAFYSNTECRMEEG
URED_FLAJ1       -------------------AVQQMNVSLADKSTFSYVQHPIVPHEQSIFKAYNVFNLTDN
URED_UREPA       ------------------TSEQHTNITLGKNSILEYISDNVIVYEDGKFAQFNNFKMDSS
URED_MYCS2       ------------------ASAEETELYVDAHSWLRFDPAPRILTAHARHRQRTEVCVAHR
URED_MYCGI       -------------------ARHHLDFTVDRGAALEYYPGTVIPHTDSTFTQTIEVNVETG
URED1_STRGG      -------------------SAWRARIDIAAGGRLDWDGKPFVVAHGAWVDRTMEVTLAPG
URED_OPITP       -------------------ATCRQHFTVAAGAWLEVMPGPLVPHRGSDYRQSTIVELTRG
URED_DEIRA       ------------------WATQELHFHVGVGARLEYYPERTLPFAGSRFRQHLRADLGAG
URED_HERA2       ------------------IAYQQVQATLAEQSLLEYWPDTTIPFAESLYQQQTRIDLAAD
URED_BACHD       ------------------SSTQQVWLRVDEGAAAFWKPESIIPFRKASFLQSTRFHLHSS
URED_LYSSC       ------------------HCTQAITVEMADEARLEWLPEVTIPFERAKFQADTTIRMKES
URED1_SYNJA      --------------------PVVQRLLFRVEGFLEYYPGLTIPHPASALDQRMEVSLGTE
URED_TRIEI       ------------------KANTNIKIKVEAGARLELVAEPIILFADAALEQTTYIQLHSR
URED_CYTH3       ------------------TCKQTITGTVGENALVVFMGDPVVPHQKSIFEQHLFWKLEKN
URED_ARCB4       ------------------YGIQKIDIVLKNNSNLEFINDELILYKDSRYIQFFNLKSDEN
                                                                             

URED_ACIBC       ASFIGWDMLVLGRQARAE----NFVQ--------GSYHNQFKLW--RKN-----------
URED_ACIBT       ASFIGWDMLVLGRQARAE----NFVQ--------GSYHNQFKLW--RKN-----------
URED_ACIAD       ASFMGWDMLVLGRQARLE----TFEQ--------GCYANRFKLY--RNH-----------
URED2_PSYCK      ASLLTWDIAVFGRQAYQE----TFAN--------GHYANRLEIW--RES-----------
URED_CITK8       SRLLAWDLLCLGRPVMQE----TFSH--------GTLRNRLEVW--RDG-----------
URED_KLEP7       SRLLAWDLLCLGRPVIGE----TFSH--------GTLSNRLEVW--VDD-----------
URED_ENT38       SRLLAWELFCLGRPVINE----TFSH--------GTIESRLEVW--LDD-----------
URED_PSEP1       ARLLAWETLCLGRPVMHE----RFDH--------GALDSLLHIE--LPD-----------
URED_PSEPK       ARLLAWETLCLGRPVMHE----RFDH--------GALDSLLHIE--LPD-----------
URED_PSEPG       ARLLAWETLCLGRPVMHE----RFDH--------GTLDSLLHIE--LPD-----------
URED_PSEE4       ARLLAWETLCLGRPVMGE----RFDQ--------GAIDSRLCID--LPG-----------
URED_SHEHH       ARFIGWEMQCFGRPMLAE----TFDN--------GQVLGQTFIH--RDH-----------
URED_ALIF1       AHFIGWEMNCFGRPVLDE----IFEN--------GFVTGRTNIK--VDD-----------
URED_ALCBS       AHFMGWEISCLGRPVNSE----VFHE--------GKIDARFRIS--RDR-----------
URED_BLOFL       ARIIIGEILCFGSDGWLD----NYGSP-------DVIDIFLRIC--LPY-----------
URED_BLOPB       SRVISFDMLCFG-NLSLG----SSTYP-------EEVDIHLNIC--LSD-----------
URED_ALKEH       ARLIAWEMVALGRPGSGD----HFPR--------GVLDQRLAVN--CEQ-----------
URED_BORBR       AAAIGWDLIQLGRVNQSG----HWSQ--------GRLHTATELY--VDG-----------
URED_BORPA       AAAIGWDLIQLGRVNQSG----HWSQ--------GRLHTATELY--VDG-----------
URED_BORPE       AAAIGWDLIQLGRVNQSG----HWSQ--------GRLHTATELY--VDG-----------
URED_DELAS       ARAIGWDAVVLGRYGAGE----HWNHTGAAPTAAARLQLHNRLA--CGG-----------
URED_BURCA       ASAIGWDATQIGRQAAGE----TWAA--------GRIASTSALVA-ADG-----------
URED_BURCH       ASAIGWDATQIGRQAAGE----TWAA--------GRIASTSALVA-ADG-----------
URED_BURCM       ASAIGWDATQLGRQAAGE----TWSA--------GRIASRSALVD-ADG-----------
URED_BURL3       ATAIGWDASQLGRQAAGE----TWSA--------GRVASTSALVD-ADG-----------
URED_BURVG       ASAIGWDATQLGRQAAGE----TWSA--------GRIASHATLVD-ADG-----------
URED_BURMA       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURM9       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURM7       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURMS       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURPS       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURP0       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURP1       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURP6       ASVLGWDATQLGRQAAGE----AWSA--------GSIASFSKIVG-PSG-----------
URED_BURTA       ASVLGWDAAQLGRQAAGE----AWST--------GSVASFSKIVG-PSG-----------
URED_PARXL       ATALGWDATQLGRQAAGE----RWSE--------GSLHAVSRIVG-ADG-----------
URED_CUPNH       GSAIGWDAVVLGRQASGE----QWTR--------GALWLDTRVG--TGE-----------
URED_CUPPJ       GSAIGWDAVVLGRQASGE----QWNR--------GVLWLDTQVR--CNG-----------
URED_CUPMC       GSAIGWDAVVLGRQASGE----RWAS--------GALWLDTRVG--DPD-----------
URED_RALSO       AAAIGWDITMLGRHAAGE----SWQE--------GRIAMHTRLR--CEG-----------
URED_POLAQ       ASFIGWDALMLGRHASGE----EWSS--------GHIHLLNEIR--RDG-----------
URED_AZOSB       GVFIGSEMTCFGRSGAGE----RYTR--------GDFAMRTRIR--RDG-----------
URED_DECAR       SRYIGWDILCLGRVAAGE----RFEK--------GRFDLFLQVN--RDQ-----------
URED_PSEA7       ARLFYWDMVALGRPASGE----RFAS--------GHFVAALDIR--RDD-----------
URED_PSEAB       ARLFYWDMVALGRPASGE----RFAS--------GHFVAALDIR--RDD-----------
URED_PSEAE       ARLFYWDMVALGRPASGE----RFAS--------GHFVAALDIR--RDD-----------
URED_PSEF5       ARLFYWDIIALGRPASGE----RFEQ--------GHFQAHLDLY--RDG-----------
URED_PSEPF       ARLFYWDVVALGRPASGE----RFDL--------GHFQAHLDIR--RDG-----------
URED_PSE14       AKLCYWDVVALGRPASGE----RFEQ--------GHFQSHLDIR--RDG-----------
URED2_PSEU2      AKLCYWDVVALGRPASGE----RFEH--------GHFQSHLDIR--RDG-----------
URED2_PSESM      ARLCYWDVVALGRPASGE----RFEH--------GHFQSHLDIR--RDG-----------
URED_PSEU5       ARLFYWDIVALGRPAAGE----RFDA--------GHFQARLDIR--RDD-----------
URED_PSEMY       ARLFYWDIVALGRPAADE----RFAS--------GHFQAALDVR--RDG-----------
URED_NITOC       AKVIAWDIIALGRPASGE----RFNS--------GRIYQRFRLR--RNG-----------
URED_JANMA       ARYIGGEILCFGRTASGE----TFDS--------GRVAQRTSIR--RGG-----------
URED_NITMU       SVYMSCEILCFGRTAFGE----SFDS--------GEIKQHTSIR--QEG-----------
URED_METFK       AVFCGWDILCFGRQARGE----RWSE--------GELRQVMQVR--REG-----------
URED_PSYIN       SVYLGWDITCLGLPNSDQ----TFIK--------GKYCQLNRLF--CDA-----------
URED_MARMS       AKFIGWEITCFGLPANQE----DFAQ--------GHAEQGFEIR--QNG-----------
URED2_OCHA4      AVYLGWDIISLGRPACQE----SFDT--------GEVRQRIEIF--RDG-----------
URED_PSEHT       AKCLGWEILGLGRPASDL----PFAT--------GCIEQRFKLT--QDG-----------
URED1_PSYCK      AKCLGWEIIGLGRPASDL----PYVS--------GMIEQRFQLS--QKG-----------
URED_MARHV       ARTLGWEVLALGRPASDL----PFAT--------GALEQRFHLS--LDG-----------
URED_CHRSD       GCCVGWEVLALGRPASQL----PFVS--------GRVEQRFALT--RDG-----------
URED_HAHCH       SRFIAWEITALGRPAADA----PFAS--------GAFTQTTRIL--RDS-----------
URED_SACD2       AQYFGWDIIRLGRVASGE----PFNT--------GTCAQRLQLW--RDG-----------
URED_LEPCP       AMMMGWDLLALGLPAAGK----PWQR--------GSYLQQLEL-----------------
URED_METPP       AEMLGWDLLALGLPAAGE----RYAS--------GCFEQSIEVRS-AAH-----------
URED_ACIAC       AECIAWDVTALGLPHSGQ----PFAT--------GRFTQHIEV-----------------
URED_VEREI       AECMGADVTALGLPHAGQ----PFVA--------GRFVQHIEI-----------------
URED_POLNA       AELIGWDVTAFGLPAASL----PFAH--------GHFCQHIEM-----------------
URED_POLSJ       AELIGWDITALGLPAASL----PFAH--------GSFCQHIEV-----------------
URED_RHOFT       AELIAWDVTALGLPHAGL----PFVR--------GRFCQHIEL-----------------
URED_NOSS1       ANFLGWEITRFGRSARGEKFYQ------------GEWRSHTEIWQQG-------------
URED_TRIV2       ANFLGWEITRFGRSARGEKFYQ------------GEWRSHTEIWRQG-------------
URED_NOSP7       ASWLGWEITRFGRSARGEKFLQ------------GEWRSHTEIWQQS-------------
URED_ACAM1       AIFCGWDLTRFGRSARGERFMQ------------GDWRSHTEIWQQG-------------
URED_MICAN       SSWLGWEITRFGRSARGEKFLA------------GEWHSNWEIWRSG-------------
URED_THEEB       AQVGLWEMTRFGRTARGEVFNR------------GYWRYHTEVWQGG-------------
URED_SYNP2       AVWCGWEVLRFGRTARGEKFIS------------GNWRGLTEIWQDD-------------
URED_SYNY3       ARFKGWEIVRLGRTARGEKFTQ------------GHWRSSWEIWQGD-------------
URED_PROM1       SSFLCVDLVRLGRTAAEEQLGN------------GVWRSSLEIFRDNNQ-----------
URED_PROMT       SSFLCVDLVRLGRTAAEEQLGS------------GVWRSSLEIFRDNNQ-----------
URED_PROM3       ASFLSAEVVRLGRTAAGETLNE------------GAWRSSLEICRQTPI-----------
URED_PROMM       ASFLCAEVVRLGRTAAGETLNE------------GAWRSSLEICRQTPI-----------
URED_SYNS3       GSFLSAEIVRLGRTAANETLGQ------------GCWRSDVQIQRQTSE-----------
URED_SYNS9       ASFLSAEIVRLGRTAAGEDLGQ------------GCWRSAVSLRRIGEN-----------
URED_SYNSC       ASFLSAEIVRLGRTAAGETLQQ------------GRWRSSLTIQRLAGE-----------
URED_SYNPX       ASFLSAEIVRLGRTAAGEQLNR------------GRWRSCLEIQRDGAH-----------
URED_SYNR3       ASWLGADVVRLGRTARGEDLGA------------GRFCNSLSIRR---------------
URED_PROM2       SSFLFTDLIRLGRSSSGESIES------------GVFRSKLEIVRNNDL-----------
URED_PROM0       SSFLFTDLIRLGRSSSGESIES------------GVFRSKLEIMRNNDL-----------
URED_PROMS       SSFLFTDLIRLGRSSSGESIES------------GVFRSRLEIIRNNDL-----------
URED_PROM9       SSFLFTDLIRLGRSSSGESIES------------GVFRSKLEIIRNNDL-----------
URED_PROMP       SSFLFTDLIRLGRSSAGESIES------------GVFRSKLEIMRNGNL-----------
URED3_METEP      ASLLVAEIAVLGRAARGESLEQ------------ALFEDRWRIRRDGR------------
URED2_METPB      ASLLVAEIAVLGRAARGERLEQ------------ALFEDRWRIRRGGR------------
URED1_METRJ      AALIAAEVVAFGRAARGERIVD------------GLFADSWRIRRGGR------------
URED_METS4       AALTLFEALVFGRSARGETVRE------------GEIRDAWRLARGGR------------
URED_XANP2       ASFLSFEALMLGRLAHGDAMGE------------GHLEDHWRLRRDGA------------
URED_AZOC5       ATFLAFEAIAFGRVARGEEMRT------------GHLEDHWQVTRGGG------------
URED_BRADU       ASLLLCEIVVFGRTAMGERMEQ------------GEFVDRWRLSRGGR------------
URED_RHOP5       AALLLAEIVVFGRAAMGERMLS------------GSFVDRWRLRRGGR------------
URED3_BRASB      ASLLLCEIVVFGRTAMGERMRE------------GEFVDRWRLRRGGR------------
URED1_BRASO      ASLLLCEIVVFGRTAMGERMRE------------GEFVDRWRLRRGGK------------
URED_RHOPB       ASLLLCEIVVFGRAAMGERMLS------------GEFVDRWRLRRGGR------------
URED_RHOPS       ASLLLCESVIFGRSAMGETMRH------------GRFIDRWRLRVGGK------------
URED_RHOP2       ASLLLCESVIFGRSAMGETMRS------------GRFTDRWRLRIGGK------------
URED_RHOPA       ASLLLSEMVIFGRSAMGETMQH------------GRFVDRWRMRRGGK------------
URED_BEII9       ASLLLVETLVLGRLAHGESAIS------------CDFRDSWRIRRGGR------------
URED_RHIEC       AEFLAVEAVLLGRKAMGETVDT------------GLFRDRWRIRRSGR------------
URED_RHIL3       AEFLAVEAVLLGRKAMGEAVVS------------GLFRDRWRIRRSGQ------------
URED_AGRFC       SEFIAVEAVLLGRQAMGEAMTH------------GLFRDRWRIRHGGR------------
URED_RHIME       ASFLAVEAVLIGRKAMGEEVRA------------GLFRDNWRIRSGGR------------
URED_SINMW       ASFLALEAVLIGRKAMGETVRS------------GLFRDHWRIRSGGA------------
URED_CHESB       ATFTAVEAVLLGREAMGETARK------------AHLRDRWRIYRDGK------------
URED1_BRUAB      AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED1_BRUA2      AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED1_BRUC2      AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED1_BRUSU      AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED1_BRUO2      AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED1_BRUME      AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED_BRUSI       AQMLVVEATVFGRLAMGERVVA------------ARFADRWRVRLGGR------------
URED1_OCHA4      AEILVVEATIFGRLAMGERVDE------------AMFSDRWRVRLGGRP-----------
URED_RHILO       AEALVLEATVFGRLAMGERASQ------------GTFRDRWRVRQDGF------------
URED_ROSDO       AEFLMVEPVLFGRRAMGEDVST------------LAFRDRIDIRRDGA------------
URED_RUEST       AELLLVEPLVFGRVAMGEHLSA------------LRFHDQIQIRRAGR------------
URED_RUEPO       ASLLMVEPLVFGRIEMGESLND------------ARFCDRIEITRRGR------------
URED_DINSH       ATLLWCETLVFGRAAMGEALSR------------FAFRDDRQVRRDGK------------
URED_JANSC       AELVMLETLVLGRAAMGEVLRD------------LHLRDRRRVTRGGK------------
URED_RHOS4       AGCLMVESVVLGRAAMGETLSR------------LAFRDRRSILRGGK------------
URED_RHOS1       AGCLMVESVVLGRAAMGETLSR------------LAFRDRRSILRAGK------------
URED_RHOS5       AGCLMVESVVLGRAAMGETLSR------------LAFRDLRQITRGGR------------
URED_PARDP       AGCLLLEPIILGRLAMGETIRH------------LQLTDRRIVRQDGR------------
URED_MAGMM       ARLLAGEMVLFGRSAHGEQLRQ------------GLLRDSWLVHREGA------------
URED_FRAAA       ARLRLREEILLGRFGEPG----------------GSILSTLRVDVAGGAEGPGADLAGGP
URED_FRACC       AWLRLREEIVLGRFGETT----------------GSIRSTLRVDMDAHAE---VDPPSEP
URED_FRASN       ARLRYREEIILGRFGEPG----------------GDLETSLRVDVDQAPGPAPTTDAGTA
URED1_SACEN      ARARCREVLVLGRYGERP----------------GVLTTSTHVVRA--------------
URED_STRAW       ARLVFREEQVLGRVGEEP----------------GRLTSRLTLRIGG-------------
URED_STRCO       ARLLLREEQVLGRAGEEP----------------GRLTSRLTLRIDG-------------
URED3_STRGG      ARLLLREEQILGRHGEPT----------------GALTTRLTVHHAG-------------
URED2_SACEN      ARLILREELILGRAHEPP----------------GDLSSHLTVHRDG-------------
URED_ANADF       ASLLWLDALVAGRIARGERWA------------FDEYRSRIEVAIDGR------------
URED_SORC5       ASLVLVDALSSGRSARGERWA------------FDRYASRVRVSRGGR------------
URED_SYNJB       ARLAYAEIWTAGRLAMDERWQ------------FEHLANCLQVWVTAGI-----------
URED2_SYNJA      ARLAYAEIWTAGRLAMGECWQ------------FRRLSSSLRVWVAAGS-----------
URED1_BRASB      AVLCMADGFAVHD---PHARGRS----------FTEFSSRLRIR----------------
URED3_BRASO      AVLCVADGFAVHD---PRASGRA----------FSEFSGRLRVL----------------
URED1_METEP      ARAIVTESVACHD---PVGEGRP----------FDRLDLGLTIR----------------
URED1_METPB      ARAIVTESVACHD---PLGQDRP----------FDRLDLGLTIR----------------
URED2_METRJ      ARAVVSESIACHD---PEGRGRP----------FDRVELGLGIE----------------
URED1_PSEU2      ARVLLCDAFCLHT---PHGSEGL----------PDFYRADLQVY----------------
URED1_PSESM      ARVMLCDAFCLHV---PPGSAGL----------PGFYRADLHIR----------------
URED2_BRASB      AVALVTDAFTMHD---PDGQGRL----------FRELDSTVIVR----------------
URED2_BRASO      AAALVTDAFTMHD---PDGQGRL----------FRELDSKLIVR----------------
URED2_METEP      ATLLYGEMVLAGRKHHHVEERFG----------FDLLSMDVNL-----------------
URED3_METPB      ATLLYGEMVLAGRKHHHAEERFG----------FDLLSMDVTL-----------------
URED_YERPS       ATAIYSEVLMSGRKYHHADERFG----------FDVYSSRVAA-----------------
URED_YERP3       ATAIYSEVLMSGRKYHHADERFG----------FDVYSSRVAA-----------------
URED_YERE8       ATAIYSEVLMSGRKYHHADERFG----------FDVYSSRVAAHVFLGK-----------
URED_PHOLL       ATLIYSEIIMSGRKYHLADQGFK----------FDVYSSRITA-----------------
URED2_BRUAB      ATLIYSEVLMAGRKYYGTGELFH----------YDLFSSKFHA-----------------
URED2_BRUA2      ATLIYSEVLMAGRKYYGTGELFH----------YDLFSSKFHA-----------------
URED2_BRUME      ATLIYSEVLMAGRKYYGTGELFH----------YDLFSSKFHA-----------------
URED2_BRUSU      ATLIYSEVLMAGRKYYGTGELFH----------YDLFSSKFHA-----------------
URED2_BRUC2      ATLIYSEVLMAGRKYYGTGELFH----------YDLFSSKFHA-----------------
URED2_BRUO2      ATLIYSEVLMAGRKYYGTGELFH----------YDLFSSKFHA-----------------
URED_CENSY       AAAVYSEVVTPGR--VAMGESFL----------YDILCTSVRCE----------------
URED_HALWD       ATVIVGDVFVPDG--LSAHEPFS----------FDHYHSRTDA-----------------
URED_NATPD       ATVVVADVFVPGG--LSAHEPFD----------FDHYHSRLEA-----------------
URED_HALMA       ATAVVSDVVVPGR--LARGERFE----------FERYLSRVRA-----------------
UREH_HELPY       SQLLYSEIIVAGRVARNEL------------FKFNRLHTKISILQDEK------------
UREH_HELPJ       SQLLYSEIIVAGRVARNEL------------FKFNRLHTKISILQDEK------------
UREH_HELHP       ARLHYSEIICAGRVAMGEI------------FDFSELSSRLRIYKENH------------
URED_HAEIG       SELIYGEIVAIGRVLNDER------------FAFRQFSSHLKIYALQNDG----------
URED_HAEIN       SELIYGEIVAIGRVLNDER------------FAFRQFSSHLKIYALQNDG----------
URED_ACTPJ       SELIYGEIVAIGRVLNGER------------FAFRHFASYLRI-SYQN------------
URED_ACTP2       SELIYGEIVAIGRVLNGER------------FAFRHFASYLRI-SYQN------------
URED_ARTS2       SSLVMAEVVTPGWSPDGAS------------FRYEELRLRNEIQVETP------------
URED_PAEAT       SSLIMAEVITPGWSPDGAS------------FKYQEVRLRNEIWIDDE------------
URED_KOCRD       ASLLLAEVVTPGWSPSGES------------FAYDELRLRTEVRVTPPEVPAPAAPDRGA
URED_CORGL       ATFVMSEQITPGWHPDGKH------------FAYDEMRLHTEITDSTT------------
URED_COREF       SVFLSAEIVTPGWSPDATH------------FGFDRLHMRTEVMMQGR------------
URED_BACC1       STLILCDSVTPGWSPNMEK------------FTYQYFDSLTKIYMENK------------
URED_LACP7       TSLIATDIITSGWDPKGNL------------FSYHMLDLNTKVYLEDN------------
URED_STAA8       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAAE       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAAT       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAA3       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAAC       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAA2       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAA9       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAAR       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAAS       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAAB       SSLFYTDILTPGYSKTGEA------------FKYQYMHLINEIYIEDE------------
URED_STAES       SAMFYTDILTPGYSSNGQD------------FTYNYMHLINEIYIDNQ------------
URED_STAEQ       SAIFYTDILTPGYSSNGQD------------FTYNYMHLTNEIYIDNQ------------
URED_STAS1       ASLFYTDILTPGYSKSDKR------------FSYTYMHLLNEIYVDDA------------
URED2_STRGG      ATVVVADTLTAGRLARGER------------HAYRVLATDLHISRPDG------------
URED_HUNT2       SAFIYSEILAAGRVKSGE------------IFRFREYHSGIKIYYGGEL-----------
URED_FLAJ1       CSLTVGEIITCGRKHSGEVFL------------FSKFQNLTEVFHNGK------------
URED_UREPA       ATLIYTECFGPGWSPHGSAYQ------------YEKMYLNTKIYYDDK------------
URED_MYCS2       GCAVVVDAVVLHPDLDAATF--------------GSIESTVTVR----------------
URED_MYCGI       GLYLGWEAVAAGRLAHGERYG------------YHTYDSAILARVDG-------------
URED1_STRGG      ARMLWRDTLVLGRSGERG----------------GRVRTRTRAEYDGRE-----------
URED_OPITP       AGGFFVDQLMPGRAAHGEAWA------------WRRLCLEFECRLDGR------------
URED_DEIRA       AEFGLLETLASGRVQMGERLA------------WADYRSEVSVYAAQER-----------
URED_HERA2       AGLCWWEFLAPGREAYGERFA------------YRQLRLDCDIYALGRP-----------
URED_BACHD       STFFYGDMLTPGRVHHNERFQ------------YEQVDSLVEIYLDET------------
URED_LYSSC       STLIWGEIVAPGREMRGEVFD------------YQAYQSKYKVYVEEQ------------
URED1_SYNJA      ASFSWMEMYALGRLARGEV------------GKFKWIRARTAIFGQ--------------
URED_TRIEI       AELFWSEIILPGRLARGEWYE------------FRYYLSQLEITSMTEE-----------
URED_CYTH3       AVLLVIDWFEAGRILNGER------------FAFDSFFTELKIESNG-------------
URED_ARCB4       STFFYTDILSRGRSFENFDF--------------SNMLIKNSFFCEKS------------
                       :                                                     

URED_ACIBC       -----------------------------------KLLVADTLYFEGGDR--------WL
URED_ACIBT       -----------------------------------KLLVADTLYFEGGDR--------WL
URED_ACIAD       -----------------------------------KLLVADTLRFKGKDR--------WL
URED2_PSYCK      -----------------------------------DLLVSECTAQQANTR--------WF
URED_CITK8       -----------------------------------TPLLIERLHLEG-------------
URED_KLEP7       -----------------------------------EPLLVERLQLQE-------------
URED_ENT38       -----------------------------------EPLLIERQHLAD-------------
URED_PSEP1       -----------------------------------EVGLHERLRLAG-------------
URED_PSEPK       -----------------------------------EVGLHERLRLEG-------------
URED_PSEPG       -----------------------------------EVGLHERLRIAG-------------
URED_PSEE4       -----------------------------------EPGLHERLRIEG-------------
URED_SHEHH       -----------------------------------RVLLAETLRVKSQSH---------I
URED_ALIF1       -----------------------------------QLLLSESMYIDSIDE---------I
URED_ALCBS       -----------------------------------KPLLIERLKVDQPSH---------L
URED_BLOFL       -----------------------------------CSGLRDRLKIDS------------Q
URED_BLOPB       -----------------------------------SIGLQERLRINE------------L
URED_ALKEH       -----------------------------------MPLLRERLSLNADDP-------L-R
URED_BORBR       -----------------------------------RLLWVDQGLVG-AQD-------DVR
URED_BORPA       -----------------------------------RLLWVDQGLVG-AQD-------DVR
URED_BORPE       -----------------------------------RLLWVDQGLVG-AQD-------DVR
URED_DELAS       -----------------------------------RPLWLEQGELH-AGH-------ALL
URED_BURCA       -----------------------------------RPLWTERALLD-ARD-------PLR
URED_BURCH       -----------------------------------RPLWTERALLD-ARD-------PLR
URED_BURCM       -----------------------------------RPLWTERALLD-AHD-------PLR
URED_BURL3       -----------------------------------RPLWTERALLD-AHD-------PLR
URED_BURVG       -----------------------------------RPLWTERALLD-AHD-------PLR
URED_BURMA       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURM9       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURM7       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURMS       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURPS       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURP0       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURP1       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURP6       -----------------------------------RPLWVERARLD-AGD-------PLR
URED_BURTA       -----------------------------------RALWVERARLD-ARD-------PLR
URED_PARXL       -----------------------------------ELLWFERASLA-AND-------SLR
URED_CUPNH       -----------------------------------RALWIEQSHLE-AES-------PLR
URED_CUPPJ       -----------------------------------HALWIEQSQLD-AGS-------PLR
URED_CUPMC       -----------------------------------RALWIEQSHFD-GAS-------PLR
URED_RALSO       -----------------------------------QPLWIESTAFD-AQS-------PVL
URED_POLAQ       -----------------------------------QLIWIENGHID-AED-------PYS
URED_AZOSB       -----------------------------------RTLWLERGRVE-GGG-------ALL
URED_DECAR       -----------------------------------RPIWIERGGFD-GSD-------PML
URED_PSEA7       -----------------------------------RLLWHERQRID-GGD-------RLL
URED_PSEAB       -----------------------------------RLLWHERQRID-GGD-------RLL
URED_PSEAE       -----------------------------------RLLWHERQRID-GGD-------RLL
URED_PSEF5       -----------------------------------RPLWHERQRIG-GGD-------GLL
URED_PSEPF       -----------------------------------RLLWHERQRIV-GAD-------GLL
URED_PSE14       -----------------------------------TLLWHERQRII-GGD-------GLL
URED2_PSEU2      -----------------------------------TLLWHERQRII-GGD-------GLL
URED2_PSESM      -----------------------------------TLLWHERQRII-GAD-------GLL
URED_PSEU5       -----------------------------------RLIWHERQRIA-GAD-------ALL
URED_PSEMY       -----------------------------------RLLWHERQRVS-GGD-------GLL
URED_NITOC       -----------------------------------RLLWSERMQLL-GGS-------RLL
URED_JANMA       -----------------------------------KLLWFEQGALQ-ARS-------TSM
URED_NITMU       -----------------------------------KLVWFEKLRLE-GGS-------KAM
URED_METFK       -----------------------------------RLIWNERLFAQ-PDS-------LVM
URED_PSYIN       -----------------------------------KLIYHDRISLS-PSN-------NLL
URED_MARMS       -----------------------------------RLKVRERLVIDDSSR-------TIF
URED2_OCHA4      -----------------------------------KPIWFEQFRLHGADP-------ALN
URED_PSEHT       -----------------------------------KPLWLERQNLD-PTH-------PRF
URED1_PSYCK      -----------------------------------RPLWLERQAID-PTH-------PRF
URED_MARHV       -----------------------------------QPLWLERQLLD-PKH-------RRF
URED_CHRSD       -----------------------------------RPLWRERQPLD-PMH-------PRF
URED_HAHCH       -----------------------------------APCFFERVALR-GEG-------PGF
URED_SACD2       -----------------------------------LPLFIEKTKFE-ASS-------NMH
URED_LEPCP       -----------------------------------PGIWLERARIDAADA-------RLL
URED_METPP       -----------------------------------PLPWLERGVLDFDDPRHAPVTQRLL
URED_ACIAC       -----------------------------------PGIWLERGTIDAADG-------LLM
URED_VEREI       -----------------------------------PGLWREHGVIDATDQ-------RLL
URED_POLNA       -----------------------------------PGVWLERARIAAGDT-------LLM
URED_POLSJ       -----------------------------------PGVWLERARIQASDT-------LLM
URED_RHOFT       -----------------------------------PGVWLERGVIDAADT-------RLL
URED_NOSS1       -----------------------------------VPLWIDRQWLPGNDA--------VF
URED_TRIV2       -----------------------------------VPLWIDRQWLPGNEA--------VF
URED_NOSP7       -----------------------------------VPLWIDRQCLRGSED--------IF
URED_ACAM1       -----------------------------------APLWIDRQWLPGQPD--------IW
URED_MICAN       -----------------------------------QPLWLDRSCLLGGK---------MI
URED_THEEB       -----------------------------------VPLWIDRQRIEGTKM--------ML
URED_SYNP2       -----------------------------------ELLWGDRQWLPGHPE--------VF
URED_SYNY3       -----------------------------------KLIWGERQQLIGSEQ--------LY
URED_PROM1       -----------------------------------GKHYEFSDRLELSGE--------AL
URED_PROMT       -----------------------------------GKHYEFSDRLELSGE--------AL
URED_PROM3       -----------------------------------GRQWELVDQLELNSD--------VL
URED_PROMM       -----------------------------------GRQWELVDQLELNSE--------VL
URED_SYNS3       -----------------------------------GRRWELVDRLEISDD--------AL
URED_SYNS9       -----------------------------------GTRWEQVDRLELSGD--------AL
URED_SYNSC       -----------------------------------SSTWELADRVELGGA--------SL
URED_SYNPX       -----------------------------------QPRWELVDRLELGDT--------SL
URED_SYNR3       -----------------------------------GEQWSVVERLSLEQE--------QL
URED_PROM2       -----------------------------------YDDWEYVDQIELSKA--------SY
URED_PROM0       -----------------------------------YDDWEYVDQIELSKE--------SY
URED_PROMS       -----------------------------------LDDWEYVDQIELSKA--------SF
URED_PROM9       -----------------------------------YDDWEYVDQIELSKA--------SY
URED_PROMP       -----------------------------------CDDWEFVDQIELTKF--------SF
URED3_METEP      --------------------------------------LVYADSLRLDGAV-----TALM
URED2_METPB      --------------------------------------LVYADSLRLDGAV-----SDLM
URED1_METRJ      --------------------------------------LAYADSVLLEGPI-----SDHL
URED_METS4       --------------------------------------LVYADTLRLDGAV-----AAHL
URED_XANP2       --------------------------------------LIFADALRLAGPM-----GALL
URED_AZOC5       --------------------------------------LIYADAVRVSGPL-----GELL
URED_BRADU       --------------------------------------LVFAETVRLGGDI-----GAKL
URED_RHOP5       --------------------------------------LMFAETVRLDGDI-----GQKL
URED3_BRASB      --------------------------------------LVFAETVRLDGDI-----GGKL
URED1_BRASO      --------------------------------------LVFAETVRLDGDI-----GDKL
URED_RHOPB       --------------------------------------LVFAETVRLDGDI-----GATL
URED_RHOPS       --------------------------------------LVFAETVRLDGEI-----GALL
URED_RHOP2       --------------------------------------LVFAETVRLDGDI-----GALL
URED_RHOPA       --------------------------------------LVFAETVRLDGDI-----ASLF
URED_BEII9       --------------------------------------LVFAEESRIEGPL-----NRTF
URED_RHIEC       --------------------------------------LIHAEELRFSEGV-----AALS
URED_RHIL3       --------------------------------------LIHAEELRLSEGV-----AALA
URED_AGRFC       --------------------------------------LVHAEELLLEGEV-----AELT
URED_RHIME       --------------------------------------LIHAENLALAGDI-----AALA
URED_SINMW       --------------------------------------LVHAENLALAGDI-----AALG
URED_CHESB       --------------------------------------LVHAEETRLAGEE-----FERE
URED1_BRUAB      --------------------------------------VIHAEEFRLGPDV-----GAEL
URED1_BRUA2      --------------------------------------VIHAEEFRLGPDV-----GAEL
URED1_BRUC2      --------------------------------------VIHAEEFRLGPDV-----GAEL
URED1_BRUSU      --------------------------------------VIHAEEFRLGPDV-----GAEL
URED1_BRUO2      --------------------------------------VIHAEEFRLGPDV-----GAEL
URED1_BRUME      --------------------------------------VIHAEEFRLGPDV-----GAEL
URED_BRUSI       --------------------------------------VIHAEEFRLGPDV-----GAEL
URED1_OCHA4      -----------------------------------DGRLVHAEEFRLGPDI-----GAEL
URED_RHILO       --------------------------------------LIHAEDFRIGPDI-----TGAL
URED_ROSDO       --------------------------------------PIYLDAIHLQGDV-----ATHL
URED_RUEST       --------------------------------------ILFRDAIRLDGDA-----MAQL
URED_RUEPO       --------------------------------------PIFLDATRLQGGI-----AAHL
URED_DINSH       --------------------------------------LVLWEPLTLDATH-----LAPR
URED_JANSC       --------------------------------------LAMVEAIGLGPDD-----FASS
URED_RHOS4       --------------------------------------PVVVEPLALDDRA-----LAAA
URED_RHOS1       --------------------------------------PVLVEPLALDDRA-----LAAA
URED_RHOS5       --------------------------------------PVLVEPLALDDRA-----LAAA
URED_PARDP       --------------------------------------MIHHDALALDDAA-----LSRL
URED_MAGMM       --------------------------------------LVWADLLKLEGDL-----QHPL
URED_FRAAA       FG----------------------------------WVPLLRQELLLGPQV------PGL
URED_FRACC       -------------------------------------TPLLRQDLVLGPEI------PGL
URED_FRASN       PA------------------------------PGPRRRPLLHQELRLGPRV------PGV
URED1_SACEN      ------------------------------------GTPLLRQRLDIGEQ-------RLA
URED_STRAW       ------------------------------------RAVLDQELACGPGAP------GGW
URED_STRCO       ------------------------------------RGVLDQELLCGPGAP------GGW
URED3_STRGG      ------------------------------------RPLLDQQLAYGPGAP------GGW
URED2_SACEN      ------------------------------------RPLLAQHTTFGSTAP------G-W
URED_ANADF       ---------------------------------TVLADALRLVPGEGPPIV------ARL
URED_SORC5       ---------------------------------AVLLDATRLDPAHGA-LP------ERM
URED_SYNJB       ------------------------------------PSSPEGRKLWLQEHIDLHFPHRQV
URED2_SYNJA      ------------------------------------PSASRQKKLWLQEHIDLRFPHQHV
URED1_BRASB      ---------------------------------RPDGRLLLQDAGRISGED---------
URED3_BRASO      ---------------------------------RPDGHLLLHDAGRVSGDE---------
URED1_METEP      ---------------------------------DPEGRALVRERSRIDGRA---------
URED1_METPB      ---------------------------------TPEGRALVRERSRIDGAA---------
URED2_METRJ      ---------------------------------TAAGAVLVRERARIAGAE---------
URED1_PSEU2      ---------------------------------SPAGKLLAGDRLAITGAD---------
URED1_PSESM      ---------------------------------CPAGTLLAGDRLALTGAD---------
URED2_BRASB      ---------------------------------RPSQEPLLIDRMQLCDPG---------
URED2_BRASO      ---------------------------------RQGKEPLLIDRMHLRDPA---------
URED2_METEP      --------------------------------RRPGGHKLVAEKILIEKGD---------
URED3_METPB      --------------------------------RRPGGRKLFAEKILIERGD---------
URED_YERPS       --------------------------------QNLAGKELFVEKYVLEPKV---------
URED_YERP3       --------------------------------QNLAGKELFVEKYVLEPKV---------
URED_YERE8       --------------------------------EQPAGKELFVEKYVLEPKS---------
URED_PHOLL       --------------------------------TDFDGKILFTERYVLEPKK---------
URED2_BRUAB      --------------------------------AHTDGTSLFTEKFIVEPAR---------
URED2_BRUA2      --------------------------------AHTDGTSLFTEKFIVEPAR---------
URED2_BRUME      --------------------------------AHTDGTSLFTEKFIVEPAR---------
URED2_BRUSU      --------------------------------AHTDGTSLFTEKFIVEPAR---------
URED2_BRUC2      --------------------------------AHTDGTSLFTEKFIVEPAR---------
URED2_BRUO2      --------------------------------AHTDGTSLFTEKFIVEPAR---------
URED_CENSY       ---------------------------------NQDGSLRFAENARAEPRR---------
URED_HALWD       ---------------------------------RVEQRLICADAVNLQPAQ---------
URED_NATPD       ---------------------------------RCEERLVCADAVDLHPAD---------
URED_HALMA       ---------------------------------TGPDGHLFEDATHLTPGD---------
UREH_HELPY       --------------------------------------PIYYDNTILDPKT------TDL
UREH_HELPJ       --------------------------------------PIYYDNTILDPKT------TNM
UREH_HELHP       --------------------------------------LVFFENMNLKPAQ------MAM
URED_HAEIG       -----------------------------------KKRPLVSDCIQWLPSK------MNL
URED_HAEIN       -----------------------------------KKRPLVSDCIQWLPSK------MNL
URED_ACTPJ       -------------------------------------RPIIADRIQWLPAK------MAL
URED_ACTP2       -------------------------------------QPLVTDRIQWLPAK------MAL
URED_ARTS2       ----------------GG------------------TGLLALDNLLIRP----------P
URED_PAEAT       ----------------NG------------------AKLLALDNLLIRP----------P
URED_KOCRD       PAAEAQDRPADPCHVPGGPDRAASSGGTGAAPAGERARRLVVDQLRIRPD---------A
URED_CORGL       ------------------------------------GRLVLLDNLLLRP-----------
URED_COREF       --------------------------------------MVLLDNLRMVP-----------
URED_BACC1       --------------------------------------LVVYDHLLLNP----------F
URED_LACP7       --------------------------------------LILLDHIRLTP----------G
URED_STAA8       --------------------------------------LVTYDNLLLNP----------N
URED_STAAE       --------------------------------------LVTYDNLLLNP----------N
URED_STAAT       --------------------------------------LVTYDNLLLNP----------N
URED_STAA3       --------------------------------------LVTYDNLLLNP----------N
URED_STAAC       --------------------------------------LVTYDNLLLNP----------N
URED_STAA2       --------------------------------------LVTYDNLLLNP----------N
URED_STAA9       --------------------------------------LVTYDNLLLNP----------N
URED_STAAR       --------------------------------------LVTYDNLLLNP----------N
URED_STAAS       --------------------------------------LVTYDNLLLNP----------N
URED_STAAB       --------------------------------------LVTYDNLLLNP----------N
URED_STAES       --------------------------------------LVVFDNMMLSP----------D
URED_STAEQ       --------------------------------------LVVFDNMMLSP----------D
URED_STAS1       --------------------------------------LVTFDNMLLDP----------Q
URED2_STRGG      -------------------------------------TLLAIDTLRLVPGR--------R
URED_HUNT2       -------------------------------------IFLENQFLFPKVQN--------L
URED_FLAJ1       --------------------------------------LVVKDNVLLQPLL---------
URED_UREPA       --------------------------------------LVLFDNLKFQPRK---------
URED_MYCS2       --------------------------------------SPGGALLAMDAQV--------L
URED_MYCGI       -------------------------------------RAVARDRQVIRPGT---------
URED1_STRGG      ---------------------------------------LLVEDLDLTDPD-------IR
URED_OPITP       --------------------------------------LLVRERVDQSGEE--------L
URED_DEIRA       -------------------------------------VYLDRQHFRPGPHS---------
URED_HERA2       ---------------------------------------ILLDRMRLQPSL--------Q
URED_BACHD       --------------------------------------LVVHDRVHLQPKD-------QL
URED_LYSSC       --------------------------------------LIAFDSIHFKPQE------MNF
URED1_SYNJA      -------------------------------------VPFYMDALELLPEE--------L
URED_TRIEI       --------------------------------------ICFRDAIHLEGKQ---------
URED_CYTH3       -------------------------------------VPIVWDRFKMDPSQ---------
URED_ARCB4       --------------------------------------MEYMEKFDVKGAE--------L
                                                                             

URED_ACIBC       SSCLGMN----NQAVMASFWAVPPEK----------FRSSFYLEQHIELIRELIMR----
URED_ACIBT       SSCLGMN----NQAVMASFWAVPPEK----------FRSSFYLEQHIELIRELIMR----
URED_ACIAD       SSCLGMN----GHAVMGSFWAVAPEK----------YRATLYLEQHIELIRELMMR----
URED2_PSYCK      TSPLGLN----DQHVHGSFWAIPSTEVIAPELQNNPLKLGQYLDATITEIRNLIDT----
URED_CITK8       GSLHTVA----RHPWSGTLLCYPA--------------TEKMLDGVREQIAPLGDY----
URED_KLEP7       GELSSVA----ERPWVGTLLCYPA--------------TDALLDGVRDALAPLGLY----
URED_ENT38       GDLTTVA----NHPWIGTLLCYPA--------------SDALLEGVREKLVTLDNF----
URED_PSEP1       GHLGKLG----GHPLLATFCAAPA--------------DQAVLEQVRPLLDELGNP----
URED_PSEPK       GHLGKLG----GHPLLATFCAAPA--------------NQAVLEQVRPLLDELGNP----
URED_PSEPG       GHLDKLG----GHPLLATFCAAPA--------------DQAVLEQVRSLLDELGNP----
URED_PSEE4       GRLDKVG----GHPLVATFCATPA--------------DQAVLEQVRQQLEALDTP----
URED_SHEHH       DQAAALR----NFAMSGSLYITPI--------------EPELIDKINQVIDEQQLRFGSE
URED_ALIF1       KHAAGMR----HYPMLGNLYIYPA--------------SEALEEKLRTLIDENFHE--QP
URED_ALCBS       NAASGLR----NFPMQAIFVATGS--------------NEELLEQARECIEKQATD----
URED_BLOFL       NYIDKLH----GFKISASLFAAPS--------------NKETLKVVRSLITSTVDI----
URED_BLOPB       NCVMKLG----GFRISALLFAVPS--------------DEKTLYKVRKLITSVKHF----
URED_ALKEH       TAPWGLQ----GQAVFATLLASPA--------------PDGLEHDLRDALQVPPGV----
URED_BORBR       RQVSGLA----GFPVHAALWSFGP-------------RLDAEQ---NEELAGLMPW----
URED_BORPA       RQVSGLA----GFPVHAALWSFGP-------------RLDAEQ---NEELAGLMPW----
URED_BORPE       RQVSGLA----GFPVHAALWSFGP-------------RLDAEQ---NEELAGLMPW----
URED_DELAS       SSPVAWA----GLPIQASLWAVAP-------------EPLAAMEPLSEQLAASLPW----
URED_BURCA       GALQGLA----GFPAYGTPWAAGA-------------ACDAAL---AEALAARMPF----
URED_BURCH       GALQGLA----GFPAYGTLWAAGA-------------ACDAAL---AEALAARMPF----
URED_BURCM       GALQGLA----GFPVYGTLWAAGA-------------ACDAAL---AEALAARMPF----
URED_BURL3       GALQGLA----GFPAYGTLWAAGA-------------ACDAAL---AESLAARMPF----
URED_BURVG       GALQGLA----GFPVYGTLWAAGA-------------ACDAAL---AESLAARMPF----
URED_BURMA       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURM9       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURM7       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURMS       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURPS       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURP0       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURP1       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURP6       AAPQGLG----GFAVYGTLWALGA-------------ACTEAL---AESIAPALPF----
URED_BURTA       AAPQGLG----GFPVYGTLWALGP-------------ACTNAL---AESIAPALPF----
URED_PARXL       EAAQGLD----GFSAYGTLWAVGA-------------ACDDAL---AEALTAQLGF----
URED_CUPNH       TAVAGLD----GLNVLGTLWAVGE-------------GATQEL---AEALAEQLPY----
URED_CUPPJ       GAVAGLD----GMSVLGTLWAVGH-------------GATQEL---AESLAERLPY----
URED_CUPMC       GAVAGMD----GLHILGTLWAIGP-------------GATQEL---AEALAEHLPY----
URED_RALSO       GATTGMA----GFHVVGTLWAVGA-------------GATEAL---AETLAEQLPY----
URED_POLAQ       KSLPQLG----SWPVCATLLALGP-------------QCSNHL---AENLSEMMPW----
URED_AZOSB       DSPVGLA----GWPVTATLLVAAK-------------TVDAAL---LEACRE-VP-----
URED_DECAR       ISPAGWA----GATVCGTLLCAFPEWP----------MQASAL---LEACRKIVP-----
URED_PSEA7       DSPIGLA----GHPVLATLVASGE--------------IDTDL---LQRCRALP------
URED_PSEAB       DSPIGLA----GHPVLATLVASGE--------------IDTDL---LQRCRALP------
URED_PSEAE       DSPIGLA----GHPVLATLVASGE--------------IDTDL---LQRCRALP------
URED_PSEF5       DSPIGLD----GQPVFATLLVTGE--------------IDSEL---LERCRALA------
URED_PSEPF       DSPIGLD----GHPVFATLLVTGE--------------IDAEL---LERCRSLG------
URED_PSE14       DSPIGLD----GKTVFATLLLTGE--------------VSSDL---LEACRSLSM-----
URED2_PSEU2      DSPIGLD----GRTVFATLLMTGE--------------VGSEL---LEACRSLSM-----
URED2_PSESM      DSPIGLD----GKTVFATLLLTGD--------------VDSDL---LEVCRSLSM-----
URED_PSEU5       DSPIGLD----GRSVFATLIASGE--------------LDADL---LERCRGLP------
URED_PSEMY       DSPIGLN----GQPVFATLLVSGE--------------VDNEL---LERCREVNI-----
URED_NITOC       ESPIGFA----GYPVAGTLLASGE--------------LNDQQ---LTACRSLPI-----
URED_JANMA       HSPLSLA----GYTVCATLIAVGK-------------TMNGAF---LNELREESSALA--
URED_NITMU       NGRLALA----GRAVCATFIMSGK-------------PLPAQA---IDLVREEAVRIG--
URED_METFK       RSGIGLK----GMPVNGSLVVAAG-------------TVPVEI---IEACRAIEA-----
URED_PSYIN       AHPAGLA----GNTVFATFLAYAPILHNNP-----EHSNKPQQHKALVMQIRAKITAE--
URED_MARMS       AAKAGLA----GKPINGLMIAGPFDLTN---------ASHSASHDELIDSLRKHCAQH--
URED2_OCHA4      AAFAFCA----KPIVATMVYAGPADESA--------------------LHAIREAVGD--
URED_PSEHT       NGKWGQG----GATVHGTFWT---------------VGLSDPTAAIAALREQLPPSN---
URED1_PSYCK      LGKWGQG----GATVHATLWA---------------VGLSDPADTITELRDKIPANH---
URED_MARHV       NGPWGQG----GATVQATLWA---------------VGLDDEAAAIDVLRAQLPDHN---
URED_CHRSD       HGYWGQG----GSTVQATLWA---------------VGLTAPQAAVEALRECLPASR---
URED_HAHCH       QEPWGLQ----GQQVYGSLLAGYVQDSP-------QKRLQQCREAL-QANTAIAALGD--
URED_SACD2       REKWGLQ----NANTCATLTA----------------TLQLTRDSIDEMLEALAQLGV--
URED_LEPCP       DSPLGWA----GQRVLGTFWLAGGDALP-------KGLSDALIESARALIGDSALAATA-
URED_METPP       ASPLGWA----GHTVLATLWFASGTALA-------SARRDALIDAARAPDSAAQPGAEPL
URED_ACIAC       DGRLGLA----GHRCLASVFFVAGEALP-------RERREAALDAARAVIDAHALRETA-
URED_VEREI       RSPLGLA----GHCCMASLFFGAGSALS-------QARRDSALDAARAVIDAHALKTTA-
URED_POLNA       DSPLGLA----GQRCMASIFFVAGSKLE-------RNRRQQALDVAREVIEAHALRATA-
URED_POLSJ       SSPLGMA----GHRCVASLFFVAGSKLD-------RHRRQQALDTARQIIEAHPLSATA-
URED_RHOFT       GSPLGLA----GQRCMASLFFVTGSALE-------RPRRDLALDGARQILQAHALQSSA-
URED_NOSS1       HSPHGLA----GQPIVGSLVWLGSPIS------------TEIIEKARNLGNTQ-------
URED_TRIV2       HSPHGLA----GQPIVGSLVWLGSAVS------------TEIIAKARNLGNTQ-------
URED_NOSP7       HSPHGLA----GKPIVGSLVWVGGAVS------------AEIVEKTRSLWNGE-------
URED_ACAM1       ESPHGLA----GQPVVGSFLWVGQGVE------------PNLVQTARDLWQPTTDG----
URED_MICAN       EGFSGLN----DSALIGTLVYIGQPVG------------RNLIEKVRDFSLEG-------
URED_THEEB       TAMNALQ----GCPLMGTLAWVGREVS------------SEQIQRLRDLAMGIQ------
URED_SYNP2       AAWNGLN----NQPVVGSLALVGLEIS------------EAQMAELRQTMATIQQ-----
URED_SYNY3       ESPNALA----GFTCLGTYVDLSRSFD------------QDLVHQAQEIIHSQGRS----
URED_PROM1       KSIHGLE----QKPVFGSLTWITPKKIK----------QKDLSDLLVECREQRAGL----
URED_PROMT       KSIHGLE----QKPVFGSLTWITPKKIM----------QKDLSDLLVECRQQRAGL----
URED_PROM3       QNLHGMG----RQPVFGSFVWAAPDPLT----------AEVMETLLRNCRTDRANL----
URED_PROMM       QSLHGMG----TQPVFGSFVWAAPHPLT----------ADVMEILLRNCRTDRANL----
URED_SYNS3       KGFHGLN----QQPVFGTLVWAAPFPLQ----------TTKINNLLDDIRQDRKAL----
URED_SYNS9       HHRHGLN----GDAVFGTLIWAAPAPLT----------NPTLKSLLTNARNDRAGL----
URED_SYNSC       ESPHGLG----GAPVFGTLVWAAPMAMG----------AETTASVLEGARADREGL----
URED_SYNPX       NDPHGLG----GAPVFGSLVWAAPMPLT----------GEQITLLLAGARHDRDGL----
URED_SYNR3       PNPHGMG----GEPVLGTLIWIAPEPLE----------NEQLAQLLKGGRADREGL----
URED_PROM2       VAKSGMD----YMPVFGSLIWICEKDFS----------KSNINNLVGNIKKIFNET----
URED_PROM0       AAKSGMD----YMPVFGSLIWVCEKDFS----------ASKINNLVGNIKKIFNET----
URED_PROMS       VAKSGMD----YMPVFGSLIWICEKDFS----------KSKINNLVRKIKKIFNKT----
URED_PROM9       EAKSGMD----YMPVFGSLIWVCEKDFS----------KLKINNLVGNIKKFFKES----
URED_PROMP       EAKSGMD----FKPVFGSLIWICEKEFP----------ITKISYLKEKIKIIFKEN----
URED3_METEP      NRRAIGG----GARALATILDLSLRA-------------EGRLDEARA-LLDALPA----
URED2_METPB      ARAATGG----GARALATLLDLAPGA-------------EARLDEART-LLDALPA----
URED1_METRJ      ARPAIGG----GARACATILDVSPGA-------------EARLEEARARLAEAASP----
URED_METS4       ARPAIAG----GARAVATLVHAAPDA-------------ESRLDGLRGLIAAAGCAA---
URED_XANP2       ARPAVAG----GNRALATLLYVAPDA-------------EARLEEARALLDAARCE----
URED_AZOC5       RRPTVAA----GNRAWATLLYVAPDA-------------EARLDEARALMESARSE----
URED_BRADU       ARSAVAK----GGAAIGTAL-IVPGD-------------EALIERIREASESFAGE----
URED_RHOP5       ARPAIAN----GGAAIGTAL-IVPGD-------------EKLVERLREAAQHFRGE----
URED3_BRASB      AHPAIAN----GAAAIGTAL-IVPGD-------------AALVERIRESLPAFRGE----
URED1_BRASO      AQPAIAN----GATAIGTAL-IVPGD-------------GALVERIRESLPASRGE----
URED_RHOPB       AHRAVAN----GAAAIGTAL-IVPGD-------------EALVQRIRDSAPSFSGE----
URED_RHOPS       DRPAVAK----GGVAVGTAL-IAPGD-------------SELVERLRENADLFGAE----
URED_RHOP2       GRPAVAK----GGVAIGTAL-IAPGD-------------AALVARLREDADGFGAE----
URED_RHOPA       GRPAVLN----GGVAIGTAL-IVPGD-------------AALVERLREAADTFGAE----
URED_BEII9       DQPSLGH----GRRAMAFLLAVAPDA-------------EARLESLRARLAPFEPA----
URED_RHIEC       ARQAVLG----GQVAFATLLYAGPLA-------------EAYLGRVRSLLEGAM------
URED_RHIL3       ARQAVLG----GQVAFATLLYAGPLL-------------EAYLSKVRPLVEGSM------
URED_AGRFC       AKPAVLA----GQVAFATLLYIGPLS-------------EALLPKIRA-IAGES------
URED_RHIME       SRRAVLD----GAAAFATLVYAAPDC-------------ESQLSKLRLALAGHAL-----
URED_SINMW       SRRAVLD----GAVAFATLVYVAPDC-------------EALLPRLRTSLAEHAL-----
URED_CHESB       G-ISLLA----GNNAFATILAIGPDA-------------EEKLTALRSILGPSVH-----
URED1_BRUAB      QAPAVAG----GACAMATVLMVCEQA-------------GRYLETARAIIGEEG------
URED1_BRUA2      QAPAVAG----GACAMATVLMVCEQA-------------GRYLETARAIIGEEG------
URED1_BRUC2      QAPAVAG----GACAMATVLMVCEQA-------------GRHLETARAIIGEEG------
URED1_BRUSU      QAPAVAG----GACAMATVLMVCEQA-------------GRHLETARAIIGEEG------
URED1_BRUO2      QAPAVAG----GACAMATVLMVCEQA-------------GRHLETARAIIGEEG------
URED1_BRUME      QATAVAG----GACAMATVLMVCEQA-------------GRHLETARAIIGEEG------
URED_BRUSI       QAPAVAG----GACAMATVLMVCEQA-------------GRHLETARAIIGEEG------
URED1_OCHA4      QARPVAD----AACAVATVLLISGEA-------------GKHLEAARQIIGEEG------
URED_RHILO       ARPAAAG----GVIAVATLLLVSPRA-------------EALLDPVREIVGHQG------
URED_ROSDO       DRPAIAD----GARAMASLVWVSAEA-------------EGRIDALRRIIGRS-------
URED_RUEST       KRPGIAGVLSGPCTAMVTLVLASPGA-------------EAALAWLRTQLPAGKEAY---
URED_RUEPO       AKPFIAN----GAGAMALLVYLAENA-------------EAVLPRLRQMLPEC-------
URED_DINSH       ---ACLGG----ARAIATVAFLAPDA-------------EAARDTVRRLAPE--------
URED_JANSC       S-PAGLNG----AVATASLTLMAQDA-------------EDRLNALRAVLPT--------
URED_RHOS4       GGAAMLGG----ARALATLAMVGPGA-------------EDALGPARAALGEA-------
URED_RHOS1       GGAAMLGG----ARALATLAMVGPGA-------------EDALGPARAALGEA-------
URED_RHOS5       AGAAVLGG----LRALATLALVGPGA-------------EDALGPARAVLDEP-------
URED_PARDP       HHPAMLGK----ARAMASLALIAPHA-------------ADLLEPARAVLDEP-------
URED_MAGMM       QHPAALA----GAKGCATLLLAGEEA-------------AQLLEPLRGWLAEAGMEG---
URED_FRAAA       RGPAQLG----GARAVGSLLVVAP---------------AWAGAGPDAAVAEGVA-----
URED_FRACC       TGPALLG----SARALGSLLVAGPDPVGSPAARRESVPAKRAESGAQAAVADGVA-----
URED_FRASN       AGPAVLA----GARAVGSVLVAGP---------------ATGLEPVTAAVGDSVA-----
URED1_SACEN      ASAGYLA----GARVLAAETVVWD------------------HDPAAPAGGQWWS-----
URED_STRAW       DGPAVLG----GHRALGQLVVVRPEFE--------------REPVRARLLGESAA-----
URED_STRCO       DGPAGLA----GHRAVGQLVVVRPGFA--------------TEPPAARVFEEGAA-----
URED3_STRGG      DGPAVLA----GHRAVGQLLLADPSFG--------------DAPLPARLLGPTAA-----
URED2_SACEN      DGPAVLG----EHRATGQILIVDPAFA--------------NAPPATRLLGDEPANGEG-
URED_ANADF       PGVELLA----TVVALGPAVASAARELLERV----------AASPAERDAGVLAA-----
URED_SORC5       GRFDALA----TLVALGPRAASAAEALLAP------------RPPPERRAELVAS-----
URED_SYNJB       SAASVLG----SHLCWGSLYLLGDWP-------------EPTWLTVHISGTESPYW----
URED2_SYNJA      STASVLG----SHLCWGSLYLLGDWP-------------EPTWPTVHVSGTESPHW----
URED1_BRASB      -LQGA---LGRFA-AAANLVLIAPPDR-----------LPPVK-ELQQA-ADRCGAL---
URED3_BRASO      -LHGA---LGPFA-AAANLIIVAPPDR-----------LPSVK-SLQQA-ADGCGAL---
URED1_METEP      -FTAPDSPMGPHR-AYGTMVVLGAPDD-----------ARLAGLHLRQA-ADAAGCL---
URED1_METPB      -FVGPDSPMGGHR-AYGTMVVLGAPED-----------ARLAGPLLRQA-SDTAGCL---
URED2_METRJ      -FHAPDSPLGPWR-AYGAMVILGPAPC-----------LPDPG-DVQAA-ADRTGCR---
URED1_PSEU2      -LQRRLPGVSGQRQALATFMLVGQGLP-----------IEDLKRTLRETLRDVADSY---
URED1_PSESM      -LQRRLPGVSAELQALATFMLVGQDLP-----------VDELKRALRDALRVVPESY---
URED2_BRASB      -TALFK----GRRAFGSAVLMLPDMHD-----------RAAIRLRVIDTLAHIDDLY---
URED2_BRASO      -TALFN----GRRAFGSAVLMLPPTHD-----------RAAIRLRLADAFARIDDLY---
URED2_METEP      -PTIAFAAVMRGFDAFANILCVTPPET-----------AARIKERFEPHFPIEAPRAL--
URED3_METPB      -PTIAFAAVMRGFDVFANILCVTPPGT-----------AARIKERFETNFSSDAPRAV--
URED_YERPS       -ESLDAVGVMQTFDAFGNVILLTPKEH-----------HDRILARVPAHFDIKGGIA---
URED_YERP3       -ESLDAVGVMQTFDAFGNVILLTPKEH-----------HDRILARVPAHFDIKGGIA---
URED_YERE8       -ESLDAIGVMQSFDAFGNVILLTPKQH-----------HERILARVPAHFDIKGGIA---
URED_PHOLL       -QSLNSVGVMGPFHVFGNVILLTPQLH-----------HDRILARMAPQYDAETGIA---
URED2_BRUAB      -GNVSRLGAMGSFHVFGNLILLTPKTH-----------ADRLFETIDPVFDMDEGIA---
URED2_BRUA2      -GNVSRLGAMGSFHVFGNLILLTPKTH-----------ADRLFETIDPVFDMDEGIA---
URED2_BRUME      -GNVSRLGAMGSFHVFGNLILLTPKTH-----------ADRLFETIDPVFDMDEGIA---
URED2_BRUSU      -GNVSRLGAMGSFHVFGNLILLTPKTH-----------ADRLFETIDPVFDMDEGIA---
URED2_BRUC2      -GNVSRLGAMGSFHVFGNLILLTPKTH-----------ADRLFETIDPVFDMDEGIA---
URED2_BRUO2      -GNVSRLGAMGSFHVFCNLILLTPKTH-----------ADRLFETIDPVFDMDEGIA---
URED_CENSY       -MNLRGEAVLGGYSVHGTVYVMAPPES-----------ARTIEYTAGRIISHTDGIL---
URED_HALWD       -RDPRNLATIGEYTVIGNLYVFSPGAD-----------VEAIAEMVHQRLT-DHEG-A--
URED_NATPD       -GDPRDPATVADYDVVGTLYVLAPEAD-----------TEVLAEAIHARFD-AHDAVT--
URED_HALMA       -EDPTAPGVLGEFTVYGTTFVLAPDHD-----------EAELSDALHAVVT-DGDA-R--
UREH_HELPY       NNMCMFD----GYTHYLNLVLVNC---------------PIELSGVRECIEESE------
UREH_HELPJ       NNMCMFD----GYTHYLNLVLVNC---------------PIELSGARELIEESE------
UREH_HELHP       QNICLFD----KYTHALSMVIFDD---------------LIEVQALEQKIKNS-------
URED_HAEIG       TALSQME----NYSHQGSLTYLNL---------------AKNNAEIKQQVQALQQQSAE-
URED_HAEIN       TALSQME----NYSHQGSLTYLNL---------------AKNNAEIKQQVQALQQQSTE-
URED_ACTPJ       TSLSQME----DFSHQGSLTYVNL---------------AKNAVEIKAMVSELQALAAE-
URED_ACTP2       TSLSQME----DFSHQGSLTYVNL---------------AKNAVEIKAMVSELQALAAE-
URED_ARTS2       LNDVTGMGFMEGYSHLGSLVVVDARVE------------QALADEFHALTAGHDACT---
URED_PAEAT       LGDVTGMGFMEGFSHLGSLVVVDPRVN------------QGLADELDLIARDFDAYT---
URED_KOCRD       HGGMSGVGFMEGFSHTGQLLVADARLD------------DELYERLCELVDASGTHS---
URED_CORGL       DSREGSFGWTEQYTHSGQMIVMGEGVD------------KQLVAELNEQLAAHPDVY---
URED_COREF       DVDISGIGVMEGFSHSGTLILIAPPLC------------NDVVFHAATNIVESVRWS---
URED_BACC1       KESLDQMGILNQYSHYGTFIVINENVT------------NDLIAALKTSFSNTN------
URED_LACP7       SQSLSSIGQFEEYSHLGTMIVVSEYTD------------ESLISMLYDVMETQNL-----
URED_STAA8       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAAE       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAAT       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAA3       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAAC       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAA2       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAA9       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAAR       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAAS       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAAB       KQSINEIGYMEHYSHYGSAYFIHEDVN------------QKLIDSVYETISSYSNTF---
URED_STAES       KSRLDGIGYMENYTHLGSAYFIHPDVN------------QSFIDDIYAAVADFQKQY---
URED_STAEQ       KSRLDGIGYMENYTHLGSAYFIHPDVN------------QSFIDDIYVAVADFQKQY---
URED_STAS1       KQNVDGLGYMEDYTHLGSCYFIHPSVN------------QKFIEQVYEEIKHFQHKY---
URED2_STRGG      GGGVLGPAVFAGHDLVASLFAVTDRVP-----------ATVLADALHDALAGLGLL----
URED_HUNT2       EGIGFFE----GFTHQASMGFFCKQIS------------DELIDKLCVMLTAMEDVQ---
URED_FLAJ1       -ADVQTLGQMEGFTHQATLMYINTGI-------------EDVESCIELAYAELQSEE---
URED_UREPA       -NDESAFGIMDGYHYCGTMIVINQQVI------------EDDVIKIRDLVKEKYPDM---
URED_MYCS2       DAPPVTG----RFTAFGTVYFVGA----------------GFTGGHHEGPTDPPGVY---
URED_MYCGI       -DAMSLL----EGDYLATLLVVAPGAD-----------IEALLRRLRATLDDGSG-----
URED1_STRGG      ELPGVLG----PNRIVGSVTALGTRP-------------PGPPHPYRTDLAGPGAQ----
URED_OPITP       RALAELAGSGAAACFANAILIPGAEAD------------EDWRAAVEGLHRDGAWV----
URED_DEIRA       RAPGVLG----GNDYFASGVWVAG---------------DSAAGRPAAESPTTAPGW---
URED_HERA2       QLSNPLYFGKYSYLATGYICRVGWDAVQ----------WKALEAELMAFAASQTKLG---
URED_BACHD       QTIGRLD----GYSYYGAVWMHAPILK------------GAHLEQWMENGGQNDR-----
URED_LYSSC       AALGLLE----KALYIGSLWIVSPLVK------------NLNMRDLQDLIQQEQS-----
URED1_SYNJA      GPNHPGVLEGHPYLVCGFWNWESHPFF-----------EETENGLLGVGLTAFRH-----
URED_TRIEI       -NIFKHRDLFAAKPVLANLIVVQPHSDL-----------EVLSQKLENLEAANCPDL---
URED_CYTH3       -NNMNSPGAFLDHSSYINIFLAGDENLT---------RVKSIETQLRFLAAQYFHEHIE-
URED_ARCB4       KDYINRKS--SSNFIFAKIYIKTNNNE------------EFLNRIYLEKFESFTYTK---
                                                                             

URED_ACIBC       --------------MDVPVTLTLLED--------VLCARFLGNDVRRCHDAFAAIRAKLR
URED_ACIBT       --------------MDVPVTLTLLED--------VLCARFLGNDVRRCHDAFAAIRAKLR
URED_ACIAD       --------------MDVPVTLTLLDD--------VVCARFLGDDVRACHDAFAAIRARLR
URED2_PSYCK      --------------QSLPIHCTHNFQ--------GINCRYLGADVRACFEAFYQIRELIR
URED_CITK8       ------------------AGATLIDS--------LLALRFLGHDNLLIQRVMRAVWQSLR
URED_KLEP7       ------------------AGASLTDR--------LLTVRFLSDDNLICQRVMRDVWQFLR
URED_ENT38       ------------------AGATLTDG--------LLSIRFLSHDNLICQRAMREIWQCLR
URED_PSEP1       ------------------AGATLLGS--------LLVIRVLDHDNQHLQRTLQRLWHVLR
URED_PSEPK       ------------------AGATLLGS--------LLVIRVLDHDNQHLQRTLQRLWHVLR
URED_PSEPG       ------------------AGATLLGS--------LLVIRLLDHDNQHLQRTLQRLWHVLR
URED_PSEE4       ------------------AGATLLGP--------LLVIRLLDHDNQHLQRNLQRLWHLLR
URED_SHEHH       ILLGSSEIGSASTSSAMSLTSTAEDS--------LIVVRALGQQTEPMMASFVQIWRCVR
URED_ALIF1       ELFGSS---------NPICGITEIDG--------LLVIRYLGHQTEPMMACFSTLWQHTR
URED_ALCBS       ----------------MPCGLTLIDD--------ILVMRVLGTRCEKIQALMLPVWQLLR
URED_BLOFL       ----------------QIGGVTLIDE--------LLVVRLLSNNNQRIKELLYHIWSVIR
URED_BLOPB       ----------------QVGGATLLDE--------ILVVRLLGNDNQYLKKMLHHIWYTIR
URED_ALKEH       ----------------RMGATRCPEG--------LLAVRVLGPGVEPVRKTLEQAWRTIR
URED_BORBR       -------------SDTLRGAATTMP---YDATQSLCLVRCLGVHMEDVRAVMTDAWAYLR
URED_BORPA       -------------SDTLRGAATTMP---YDATQSLCLVRCLGVHMEDVRAVMTDAWAYLR
URED_BORPE       -------------SDTLRGAATTMP---YDATQSLCLVRCLGVHMEDVRAVMTDAWAYLR
URED_DELAS       -------------SDEVRAGASLLAG--QGGAPSVLLLRVLARRMEAARAVLHEGWRLLR
URED_BURCA       -------------DDTLRAAATCVT-------PGVVLVRAISTSMEALQRHFTDCWLRLR
URED_BURCH       -------------DDTLRAAATCVT-------PGVVLVRAISTSMEALQRHFTDCWLRLR
URED_BURCM       -------------DDTLRAGATCVT-------PGVVLVRALSTSMEALQRHFADCWLYLR
URED_BURL3       -------------DATLRAGATCVT-------PGVVLVRALSTSMEALQRHFTDCWLHLR
URED_BURVG       -------------DDTLRAGATCVT-------PGVVLVRTLATSMEALQRHFTDCWLALR
URED_BURMA       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURM9       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURM7       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURMS       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURPS       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURP0       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURP1       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURP6       -------------DDALRAGVTCVA-------PGTLLIRALAHSMEALQRLLAEQWLALR
URED_BURTA       -------------DDALRAGVTCIA-------PGTMLIRALAHSMEALQHLFAEQWLALR
URED_PARXL       -------------DESIRAAASCVT-------SGVLVVRAVSRSMEMLQKALTRCWVQLR
URED_CUPNH       -------------TPELRAGVTCLA----TSGQSMLLLRVLGRQMEAVRHVMVDSWQALR
URED_CUPPJ       -------------AAGLRAGVTCLS----SPAQSMLLVRVLGRQMEAVRHVMVDAWSALR
URED_CUPMC       -------------RADLRAGVTCLAGYGTATAQSMLLLRVLGSDMEAVRHLMIDAWTVLR
URED_RALSO       -------------RDDLRAGVTCLTQ-DAPGRPSVLLLRVLARRPEDARALLSQTWLALR
URED_POLAQ       -------------TNSIRAGVTLMP-------QGIVIVRAVSIDIEMARNFMIDVWSKLR
URED_AZOSB       -------------AEAGEGAATLLPG--------LLVARYRGPACEPGRNWFNRLWTLLR
URED_DECAR       -------------ADGAQHGLSALPG--------VLIARYLGNSSEAARLWFAELWTILR
URED_PSEA7       --------------CAGRGNLSQLPGG-------LLVARCLADEALHARAWLIELWRLLR
URED_PSEAB       --------------CAGRGNLSQLPGG-------LLVARCLADEALHARAWLIELWRLLR
URED_PSEAE       --------------CAGRGNLSQLPGG-------LLVARCLADEALHARAWLIELWRLLR
URED_PSEF5       --------------HPVRGDLSQLPG--------LLVARCLASEALQARAWLIELWRLLR
URED_PSEPF       --------------HEVRGDLTQLPG--------LLVARCLASEALLARAWLIDLWRLLR
URED_PSE14       -------------PNPVRGDLTQLPG--------LVVARCLADEALHARAWLIQIWKYLR
URED2_PSEU2      -------------PNPVRGDLTQLPG--------LLVARCLADEALHARAWLIQIWKCLR
URED2_PSESM      -------------PSPVRGNLTQLPG--------LIVARCLADEALHARAWLIEIWKRLR
URED_PSEU5       --------------SRVRGDLTQLPG--------LIVARCLADEALHTRAWLIDLWRLLR
URED_PSEMY       --------------DGVRGDLSQLAG--------LLVARCLASEALKARAWLIALWRLLR
URED_NITOC       --------------EGGRGGLSQLPG--------LVVARFLGEETEAARNWFIALWQELR
URED_JANMA       -------------Q-GGRSGATQMKQ--------VLVARYLGHSSETARLWMTRAWQRIR
URED_NITMU       -------------GESGQVGITQLKS--------LLVARFLGDSSEVARHVMLCIWRAVR
URED_METFK       -------------RGDAHYGVTALPE--------ILSARYIGASSEAAKEYFERLWQVLR
URED_PSYIN       -------------SAQEKVSITEING--------LLVIRYLGHHAQECKQLFISLWQLLR
URED_MARMS       -------------NSVSGVSL--VGE--------YIFVRSLHHDSEQVKQLFIQCWREIR
URED2_OCHA4      -------------AARNLFSVSRLER--------VIVCRYLGGRMSEAKTLFRKAWEVLR
URED_PSEHT       -----------------NWAATYRRD--------VLLVRYLGHERNQVWKLFEQVRNILR
URED1_PSYCK      -----------------NWAVTYRRG--------VLLLRYLGMERNEAWDLLQQAREILR
URED_MARHV       -----------------RWAVTRRRG--------VLLLRYLGTERNEAWALCEQAWHLLR
URED_CHRSD       -----------------HWAVTQRRD--------VLLLRYLGDERNAAWEICQQAWEVLR
URED_HAHCH       -------------SKDLRWTLTRKDD--------LIILRALCQQSEPIKRLFMAAWSLLR
URED_SACD2       -------------TNTGEWGLTQKES--------LFIVRYLGNSITDCRKGFEFIWQQTR
URED_LEPCP       -------------------GVSAPHAN-------TVVLRVLAPRVEPAMHLLGAIRAAWR
URED_METPP       -------------------GVTAPHDH-------VVVLRMLGARVEPLMQRLRAVRGRWR
URED_ACIAC       -------------------GATSPHPQ-------VVVVRVLAPVVEPAMELLRRAWGAWR
URED_VEREI       -------------------GATSPCDQ-------VLVLRLLAPQVEPAMQLLRQVRAAWR
URED_POLNA       -------------------GATSPDGQ-------VVVVRVLAPLVEPAMTLLRQVWQAWR
URED_POLSJ       -------------------GATSPDGQ-------VVVVRVLAPVVEPAMALLRQVWLAWR
URED_RHOFT       -------------------GVTCPNPR-------VVVLRVLAPQVEMAMDLLKKVWAVWR
URED_NOSS1       ---------------GEAGVT-SLENG--------FLCRYRGASTSEVRNWFTSVWQLLR
URED_TRIV2       ---------------GEKGVT-SLENG--------FLCRYRGASTSEVRNWFTDVWQLLR
URED_NOSP7       ---------------GEVGAS-RLQHG--------LLCRYRGSSTSEVRNWFIDVWQLLR
URED_ACAM1       ---------------AEMGVT-RLPLG--------LVCRYRGPSSQAARQWFIQVWNLLR
URED_MICAN       ----------------ERGVTNTLGDG--------LLCRYRGNSSGEVRQWFQQVWQILR
URED_THEEB       ---------------GEMGVS-TLIRG--------VVCRYRGHSMAELRRWFVAAWQLLR
URED_SYNP2       ---------------GLGGIT-QLPKG--------VLCRYRGPSSTEVKRWFISLWQNWR
URED_SYNY3       ---------------PQFGLTLTATQG--------LIARYRGNSTQEVKDIFTQLSQVIS
URED_PROM1       ---------------EGFMTCSLLENG--------ISARYTGSSTQSARFWFYRIWSLTR
URED_PROMT       ---------------EGFMTCSLLENG--------ISARYTGSSTQSARFWFYRIWSLTR
URED_PROM3       ---------------EGSMACGGLDQG--------LVARYIGPSSQAARQWFTRIWARTR
URED_PROMM       ---------------EGSMACGGLDQG--------LVARYIGPSSQAARQWFSRLWARTR
URED_SYNS3       ---------------EGQMHCGALPQG--------LIARYSGFSSRDARFWFSRIWARTR
URED_SYNS9       ---------------EGQMQCSRLEQG--------LIARYVGPSSRDARFWFSRIWARTR
URED_SYNSC       ---------------TGTMRCGALNQG--------LIARYSGESSRDARFWFSRIWERTR
URED_SYNPX       ---------------EGTMRCSSLDQG--------LIARYAGHSSRDARFWFSRIWARTR
URED_SYNR3       ---------------SGTMAIGPLEPG--------LIARYRGGSSQAARLWFFRLWRRIR
URED_PROM2       ---------------ENNLSIGILENG--------ISVRFLGSSSQDARKCFFCIWKQIR
URED_PROM0       ---------------DNNLSIGILENG--------ISVRFLGSSSQEARKCFFCIWKQIR
URED_PROMS       ---------------NNNLSIGILENG--------ISVRFLGSSSQDARKCFFRIWKQIR
URED_PROM9       ---------------DNHLSIGILENG--------ISVRFLGSSSQEARKCFFCIWKQIR
URED_PROMP       ---------------NNYLSLGTLENG--------LSIRFLGTSSQDARKCFFSIWTQIR
URED3_METEP      ---------------QVEAGASAWNGH--------LAVRMLAPTVAPLRDAAARFLAAWR
URED2_METPB      ---------------GVEAGASAWNGH--------LAVRMLAPAIAPLREAAARFLAVWR
URED1_METRJ      ---------------GTTAAASAWNGH--------LAVRALGDAVGPLRGLVARFLAGYR
URED_METS4       --------------LGVEAGASAWNGL--------LVLRLLAPESAPLRRAATRILEGFR
URED_XANP2       ------------------AGASAWNGL--------LCVRLLAPDIETLRRDATSFLMAFR
URED_AZOC5       ------------------CGASAWNGL--------LAARWLAPDIETLRRDAVAFLNAFR
URED_BRADU       ------------------VGISAWNGF--------AMARFCAQDAARLRADMMAVLA-RT
URED_RHOP5       ------------------VGISAWNGF--------AMARFCAQDAVRLRADMMAVLG-RT
URED3_BRASB      ------------------AGLSAWNGF--------AMARFCAQDAASLRADMMAVLGCAS
URED1_BRASO      ------------------AGLSAWNGF--------AMARFCAQDAASLRADMMAVLGCAS
URED_RHOPB       ------------------VGISAWNGF--------AMARFCAQDAARLRTDMMAVLGCAS
URED_RHOPS       ------------------VGITAWNGI--------AMARFCAQDAARLRADMMAVLRRAA
URED_RHOP2       ------------------VGITAWNGI--------AMARFCAQDAAKLRADMMAVLRRAA
URED_RHOPA       ------------------VGISAWNGF--------AMARFCAQNAARLRADMMTILGRAA
URED_BEII9       ----------------CPHGVSAWNGM--------LVARLMAASPEVLRCALLAGLGLWR
URED_RHIEC       --------------GGASAW----GDK--------LVVRLAAADGFTLRKILIPVISVLR
URED_RHIL3       --------------GGASAW----NGK--------LVVRLAAADGFSLRKILIPVISALR
URED_AGRFC       --------------GGASEW----QGK--------LVVRVSAADGFSLRKLLFPIISLLR
URED_RHIME       --------------SGVSHYDVGGRDK--------IVARVAAADGFALRKILIPLISHLR
URED_SINMW       --------------SGVSHFAVNGRDK--------IVARVVAADGFALRKILIPLISHLR
URED_CHESB       --------------AAASAI----GER--------LVLRVVAPSGLMLRRTIIPAIALLS
URED1_BRUAB      ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED1_BRUA2      ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED1_BRUC2      ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED1_BRUSU      ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED1_BRUO2      ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED1_BRUME      ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED_BRUSI       ---------------GCSLWRVGKASK--------LVVRLYAPDSYALRRRLCPLVALLN
URED1_OCHA4      ---------------GASLWQVGPATK--------LMMRLHAPDSYTLRKRLGPLLALLN
URED_RHILO       ---------------GASVWSVKASGK--------LLARLYAGDGYQLRQRLVPLVGLLN
URED_ROSDO       --------------GGVSML---HPDV--------LVMRLLAADGYILRRSLIPVLDLIT
URED_RUEST       --------------GGASLL---APNL--------LHMRLLARDSFVLRQSLLPILDKLT
URED_RUEPO       --------------AGASLI---GEDL--------LVMRVLAADSFLLRQSLLPALRLLN
URED_DINSH       ---------------GVDWAVSAWDGK--------LVLRAFAPDAQPLKHALAQVLHVLR
URED_JANSC       ---------------DVRSAASAWDGR--------LTARFLAPQAYPLRRAVARAVEQVT
URED_RHOS4       ---------------GVEAAASAFDGK--------LVLRLLAADGWPLRRQVARLLTVLR
URED_RHOS1       ---------------GVEAAASAFDGK--------LVLRLLAADGWPLRRQVARLLTVLR
URED_RHOS5       ---------------GVEAAASAFDGK--------LLVRMLALDGWPLRRQVARVLGVLR
URED_PARDP       ---------------GVTGAASAPPGR--------LILRLLADDGWPLRRQVIRLLRVLR
URED_MAGMM       --------------PSVKVAAGVVHGL--------LVVRWLGWDARLLRQGYGQMWSWLR
URED_FRAAA       --------------------RLPLTGPG-------YLVSALADDAVTLRRRLTALADPTG
URED_FRACC       --------------------LLPLAGPG-------YLISALAENAVTLRRRLEQGPAPAT
URED_FRASN       --------------------LMPLAGPG-------VLVCALADDALALRRRLDSLAGVLT
URED1_SACEN      --------------------LAPLSGGG-------ALATSVAADAVTAQRGLAEALGHHP
URED_STRAW       --------------------LTPLGGAA-------ALVTALAPDALLLRRVLDEALSSLG
URED_STRCO       --------------------VMPLAGPA-------ALVTAVAPDALRLRRLLDGALASLD
URED3_STRGG      --------------------LTPLAGPA-------VLVTAVAADARLLRGMLDEAMRELL
URED2_SACEN      -------------------IVAPLAGPA-------VLATALAPTATPLRHLLDDAVRPRT
URED_ANADF       --------------------ASPLRDG--------LLLRVASRSVEAGLAFLRQRLAFVE
URED_SORC5       --------------------ASPLRGGG-------AVVRVAGTSVERVAGFLRGALAFLA
URED_SYNJB       ----------------LVKSPDPICKG--------WILRQVGPQAEAIWRHFGQVALQLA
URED2_SYNJA      ----------------LVKSPDPVCQG--------WILRQVGPQAEAIWQQFGQVVQQLA
URED1_BRASB      ------------------AGASAAPNES------GLVLRVLASDGGTLSCAMEAAFHVAA
URED3_BRASO      ------------------AGASRAPNDA------GLVLRILAPDGGTLSRATDAAFHVAA
URED1_METEP      ------------------TGVSPLPNGA------GLGLRLLAPDGGTLSAGMDAVFRIVF
URED1_METPB      ------------------TGVSVLPNGA------GLGLRLLAPDGGTLSAGMEAVFRIVF
URED2_METRJ      ------------------AGLSPLPNAA------GLGLRLLAPDGGTLAAGLEAAAGRAF
URED1_PSEU2      ------------------QGVSALPNDC------GVSVRVMSADAVALRNALHLAWACVR
URED1_PSESM      ------------------LGVSALPNDC------GVSVRIMTADAVALRSALHLAWACAR
URED2_BRASB      ------------------AAASLLPQSV------GIGIRLAARELRQLRAGFDAVAALVR
URED2_BRASO      ------------------AAASLLQDGA------GIGVRFAAREVRQLRAGFDAVAAVVR
URED2_METEP      ------------------SGVSRLPNAA------GLMLRAVGVETYDVRHEVRRFWRIVR
URED3_METPB      ------------------SGVSRLPNAA------GLMLRAVGVETYDVRNEVRRFWRIVR
URED_YERPS       ------------------SGATRLPNDC------GLVFKALGIDSAGVKAEIRQFWKIAR
URED_YERP3       ------------------SGATRLPNDC------GLVFKALGIDSAGVKAEIRQFWKIAR
URED_YERE8       ------------------SGATRLPNDC------GLVFKALGIDSAGVKNEIRQFWKIAR
URED_PHOLL       ------------------SGTSRLPHQC------GLIFKVLGKETYQVKAGIRLFWRIAR
URED2_BRUAB      ------------------WGASRLPNDA------GLLFKVLGMESAPVRAAIRKIWEAAR
URED2_BRUA2      ------------------WGASRLPNDA------GLLFKVLGMESAPVRAAIRKIWEAAR
URED2_BRUME      ------------------WGASRLPNDA------GLLFKVLGMESAPVRAAIRKIWEAAR
URED2_BRUSU      ------------------WGASRLPNDA------GLLFKVLGMESAPVRAAIRKIWEAAR
URED2_BRUC2      ------------------WGASRLPNDA------GLLFKVLGMESAPVRAAIRKIWEAAR
URED2_BRUO2      ------------------WGASRLPNDA------GLLFKVMGMESAPVRAAIRKIWEAAR
URED_CENSY       ------------------GGTSLLPGGA------GITARLLSHRTDSIFKCIEGIAGACR
URED_HALWD       ------------------AGVSTLRNEA------GITVRALGDRSTDVTAAIEAAWDETR
URED_NATPD       ------------------AGVSALPYES------GVSVRVLGTRSADVTDAVRDAWDASR
URED_HALMA       ------------------AGATALPNGA------GVAVRALGDRAETVQATLHAAWDHAR
UREH_HELPY       ---------------GVDGAVSETASSH-------LCVKALAKGSEPLLHLREKIARLVT
UREH_HELPJ       ---------------GVDGAVSKIASSH-------LCLKALAKGSEPLLHLREKIARLVT
UREH_HELHP       ---------------SLNVGISTN-NGG-------IIIKALDNQSERLLQFKKDLAL---
URED_HAEIG       -------------EKDLLIGISQLNEYG-------LMVRVLGCRAEQIQKLFEKIGRLLK
URED_HAEIN       -------------EKDLLIGISQLNEYG-------LMVRVLGCRAEANSEII--------
URED_ACTPJ       -------------QKNMLIGVSQLNEGG-------LMVRVLAHRADIIQHLFERIGQVLK
URED_ACTP2       -------------QKNMLIGVSQLNEGG-------LMVRVLAHRADIIQHLFERIGQVLK
URED_ARTS2       ---------------GVSLTASVG--G-----TTGLVLRSLSNSTEELNRLLGACTALLR
URED_PAEAT       ---------------GMSLTATIA--G-----STGLVLRSLSNSTEELNNLLGACAGVLR
URED_KOCRD       ---------------GITRAGTGEPYG-----VRCVCVRSLAHSTSAITALHRAVVDELR
URED_CORGL       ---------------GAVNFLSAPGTL-----LRGFIARTLSNRTEELINLHEHIASLLR
URED_COREF       ---------------GVGELECGLTRV-----HGGFVVRSLAYRSGRIQQIHEAIIELYR
URED_BACC1       ---------------NMKIGIASTT-------CKGFVIRILSHNTEDMESIFFQCHRFVR
URED_LACP7       ---------------KCRYGLSMLS-------KPGFMLRVLASSTQEVMRAFDICHKLIR
URED_STAA8       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAAE       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAAT       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAA3       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAAC       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAA2       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAA9       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAAR       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAAS       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGIIQSYIA
URED_STAAB       ---------------DCRVAISQLP-------THGFAVRIFAYRTQIIEKILGTIQSYIA
URED_STAES       ---------------DCRIGISQLP-------THGLAVRILTKRTQIIEEILTRVQSYIN
URED_STAEQ       ---------------DCRIGISQLP-------THGLAVRILTKRTQIIEEILTRVQSYIN
URED_STAS1       ---------------DCRFGITHLP-------THGFSLRILSNKTQVIESIITAVQCYVV
URED2_STRGG      ------------------HGVSVLPRDC------GAWVRVLDDSPIRIAGAQEAVRQAVR
URED_HUNT2       ------------------FGLSKTKKYG-------FVVRILGNSSDRLESILKLIRNILY
URED_FLAJ1       ---------------NIAFGVSKPFANG-------MIVRVLGNGGEQLYNAFRKIQRKLW
URED_UREPA       ---------------DMIFGVSRMDIPG-------LGLRVLANTYYHVEKINAVAHDYFR
URED_MYCS2       ------------------TAVTELPNGA------GCAVRIAAADGGTLRTYLRLLSAETA
URED_MYCGI       ----------------VSGGAGRLPAHA------GVFLRLIAQRAPDLHRARTDLFAAAR
URED1_STRGG      -------------------------------------VRLLDTEAPAMEAELSALCEHWR
URED_OPITP       -------------------GVSALREAG-------WSIKVIAPDGAYLRETLRAIRAVLA
URED_DEIRA       --------------------ASGLSAGG------AVWARGVAATGPALDHAARQLREQVR
URED_HERA2       ---------------RCLWGVSCLAAHG-------LVIRGLSSNSRDLLATAFDYWRFAK
URED_BACHD       ------------------FAYTCVAEGL-------IHVRWLSESSWRLRAALNDLYTAFR
URED_LYSSC       ----------------LQASVTKLTDQA-------IHCRWLAKEQRTLHKEINRMFEQMT
URED1_SYNJA      -----------------------------------SFLRGIGNKEVTQRALKIWSQERAL
URED_TRIEI       -----------------LLGSSILPNNK------GLLLRALASKTPQIKKYIKYALNCVR
URED_CYTH3       ----------------NKSESLIRIGSAVKVNEQVFMIRCSAKNNDLLQPFVKALAEHMS
URED_ARCB4       ------------------------NKK-------IILGVISSNNMFELKNQIFKIWELYR
                                                                             

URED_ACIBC       RYWFDLD-EEFPRIWKT-----------------------
URED_ACIBT       RYWFDLD-EEFPRIWKT-----------------------
URED_ACIAD       RYWFDLD-EEFPRIWRT-----------------------
URED2_PSYCK      SKWYKLE-PHRPRIWDT-----------------------
URED_CITK8       PQLTQKP-PLLPRIWQT-----------------------
URED_KLEP7       PHLTGKS-PVLPRIWLT-----------------------
URED_ENT38       PHVIAKT-PHPPRIWQT-----------------------
URED_PSEP1       PAILGLP-ACPPRIWAT-----------------------
URED_PSEPK       PAILGLP-ACPPRIWAT-----------------------
URED_PSEPG       PAILGLP-ACPPRIWAT-----------------------
URED_PSEE4       PAVLGLA-PCPPRIWAT-----------------------
URED_SHEHH       LHWFGEL-PEVPRIWST-----------------------
URED_ALIF1       QHWLGKL-PEVPRIWAT-----------------------
URED_ALCBS       QATLNKP-AVIPRIWNT-----------------------
URED_BLOFL       PIIIGQE-AVMPRVWFT-----------------------
URED_BLOPB       PFIIGKK-AMLPRIWLT-----------------------
URED_ALKEH       EPVVGLP-PCPPRIWST-----------------------
URED_BORBR       PRVLDTP-AVVPRLWAT-----------------------
URED_BORPA       PRVLDTP-AVVPRLWAT-----------------------
URED_BORPE       PRVLDTP-AVVPRLWAT-----------------------
URED_DELAS       PALLNQQ-ARPPRLWAT-----------------------
URED_BURCA       PIVHDVD-ARPLRLWQT-----------------------
URED_BURCH       PIVHDVD-ARPLRLWQT-----------------------
URED_BURCM       PIVHGVD-ARPLRLWQT-----------------------
URED_BURL3       PIVHGVD-ARPLRLWQT-----------------------
URED_BURVG       PIVHRVD-ARPLRLWQT-----------------------
URED_BURMA       PIVHGVD-PKPLRLWQT-----------------------
URED_BURM9       PIVHGVD-PKPLRLWQT-----------------------
URED_BURM7       PIVHGVD-PKPLRLWQT-----------------------
URED_BURMS       PIVHGVD-PKPLRLWQT-----------------------
URED_BURPS       PIVHGVD-PKPLRLWQT-----------------------
URED_BURP0       PIVHGVD-PKPLRLWQT-----------------------
URED_BURP1       PIVHGVD-PKPLRLWQT-----------------------
URED_BURP6       PIVHGVD-PKPLRLWQT-----------------------
URED_BURTA       PIVHGID-AKPLRLWQT-----------------------
URED_PARXL       PVVHGVQ-GVPLRIWAT-----------------------
URED_CUPNH       MPIHGVA-ARPLRLWAT-----------------------
URED_CUPPJ       EPIHGVP-ARPLRLWAT-----------------------
URED_CUPMC       QPMHGVP-ARPLRLWST-----------------------
URED_RALSO       EPIHGVA-GRPLRLWAT-----------------------
URED_POLAQ       PIIHGVP-AQPLRLWAS-----------------------
URED_AZOSB       PPLAGRA-ATLPRIWHT-----------------------
URED_DECAR       PACCGRP-AVIPRIWNT-----------------------
URED_PSEA7       PALLGRE-AVPPRIWST-----------------------
URED_PSEAB       PALLGRE-AVPPRIWST-----------------------
URED_PSEAE       PALLGRE-AVPPRIWST-----------------------
URED_PSEF5       PALLGRE-ARPPRIWNT-----------------------
URED_PSEPF       PALLGRE-ALPPRIWNT-----------------------
URED_PSE14       PALLGRQ-AVTPRIWNT-----------------------
URED2_PSEU2      PALLGRE-AVTPRIWNT-----------------------
URED2_PSESM      PALLGRE-AVMPRIWNT-----------------------
URED_PSEU5       PALLGRE-AVPPRIWST-----------------------
URED_PSEMY       PALLGRE-AVPPRIWST-----------------------
URED_NITOC       PALLGRS-VSIPRIWNT-----------------------
URED_JANMA       PELMQRD-AVIPRIWNT-----------------------
URED_NITMU       PITLGRP-AIVPRSWNT-----------------------
URED_METFK       PWYAARP-ATRPRIWNT-----------------------
URED_PSYIN       PLLLNKT-AVQPRIWHT-----------------------
URED_MARMS       PALINKE-SNEPRIWAT-----------------------
URED2_OCHA4      ETGLGKP-AAAPRIWAT-----------------------
URED_PSEHT       PLLSGHQ-ATIPRIWLT-----------------------
URED1_PSYCK      PRLMDVK-AVTPRIWLT-----------------------
URED_MARHV       PMLASVP-AHTPRIWLT-----------------------
URED_CHRSD       PWLSSRQ-ASVPRIWMT-----------------------
URED_HAHCH       PALIGVE-SHPPRIWAT-----------------------
URED_SACD2       AVFNGKP-AEVPRIWRT-----------------------
URED_LEPCP       SIAWHLD-PCVPRIWRT-----------------------
URED_METPP       RLAWDCA-GAEPRVWRT-----------------------
URED_ACIAC       EHLWGLQ-PRQPRIWAM-----------------------
URED_VEREI       AALWQLD-AEPPRIWAM-----------------------
URED_POLNA       SHFWQQP-AALPRIWSM-----------------------
URED_POLSJ       SHFWQQA-ASSPRIWSM-----------------------
URED_RHOFT       QVLWNQA-AVQPRIWAM-----------------------
URED_NOSS1       GEFFSRG-KCIPRVWQT-----------------------
URED_TRIV2       VEFFSRS-KCTPRVWQT-----------------------
URED_NOSP7       VSFLNRG-NCIPRVWQV-----------------------
URED_ACAM1       STHLGRP-ACPPRVWPL-----------------------
URED_MICAN       REMSDQE-AIIPRVWLSW----------------------
URED_THEEB       PGQGSHPLVCYPRVWPR-----------------------
URED_SYNP2       SLYSPQP-PTLSRVWQTY----------------------
URED_SYNY3       P---------------------------------------
URED_PROM1       ILRKLSM-PEYMRIWPMQEN-PSRDKKCPS----------
URED_PROMT       VLRKLSM-PEYMRIWPMQEN-PSRDIKCPL----------
URED_PROM3       QLRRLST-PQPPREWPLQEE--------------------
URED_PROMM       QLRRLST-PQPPREWPLQEEGTFSNERFTKDHQSPSASPH
URED_SYNS3       QARNLAS-PKIPRVWPLQEY-PLRP---------------
URED_SYNS9       AQRQLSE-PRIPRVWPLQEQ-PLRQQVFIENIASSNAATH
URED_SYNSC       TIRGLTR-PRIPRVWPLQEQ-PLRRQTSTVNAFEAAAETH
URED_SYNPX       ALRGLST-PRIPRVWPLQEQ-PLTGQPFTANASPTAATTH
URED_SYNR3       AVQGLSE-PSWPRTWPFQEAELALNPEPATTATTAAR---
URED_PROM2       SVCGFCE-PKYQGVWPLQDPMNY-----------------
URED_PROM0       SVSGFCE-PKYQGVWPLQDSMNY-----------------
URED_PROMS       SVSGFCE-PKYQGVWPLQDSMNY-----------------
URED_PROM9       SVCGFCE-PKYQGVWPLQDSMNY-----------------
URED_PROMP       TVCGFCK-PEYQGVWPLQDL--------------------
URED3_METEP      GQP-------MPRVWQT-----------------------
URED2_METPB      DRP-------MPRVWQS-----------------------
URED1_METRJ      ALP-------MPRVWQS-----------------------
URED_METS4       GLP-------LPRVWQT-----------------------
URED_XANP2       NAP-------LPRVWAT-----------------------
URED_AZOC5       GAP-------LPRVWAL-----------------------
URED_BRADU       GAA-------LPRLWLN-----------------------
URED_RHOP5       GAA-------LPRLWLN-----------------------
URED3_BRASB      AVP-------LPRLWLN-----------------------
URED1_BRASO      AVP-------LPRLWLN-----------------------
URED_RHOPB       GTA-------LPRLWLS-----------------------
URED_RHOPS       GRA-------LPRLWLS-----------------------
URED_RHOP2       GRA-------LPRLWLG-----------------------
URED_RHOPA       GRA-------LPRLWLS-----------------------
URED_BEII9       DD--------IARLWL------------------------
URED_RHIEC       NGAP------VPKVWNL-----------------------
URED_RHIL3       NGAP------VPKVWNL-----------------------
URED_AGRFC       NGAP------VPKVWNL-----------------------
URED_RHIME       KDAS------VPKVWTL-----------------------
URED_SINMW       KGAS------VPRVWTL-----------------------
URED_CHESB       GAGA------LPRLWSI-----------------------
URED1_BRUAB      GKAG------LPKVWTI-----------------------
URED1_BRUA2      GKAG------LPKVWTI-----------------------
URED1_BRUC2      GKAG------LPKVWTI-----------------------
URED1_BRUSU      GKAG------LPKVWTI-----------------------
URED1_BRUO2      GKAG------LPKVWTI-----------------------
URED1_BRUME      GKAG------LPKVWTI-----------------------
URED_BRUSI       GKAG------LPKVWTI-----------------------
URED1_OCHA4      GKAG------LPKVWTF-----------------------
URED_RHILO       GRAG------LPKLWSL-----------------------
URED_ROSDO       DDT-------LPQSWRL-----------------------
URED_RUEST       EGS-------LPRCWRL-----------------------
URED_RUEPO       NNE-------IPRCWTI-----------------------
URED_DINSH       EGAS------LPRVWQL-----------------------
URED_JANSC       CGA-------LPRVWQI-----------------------
URED_RHOS4       GRA-------LPRVWQV-----------------------
URED_RHOS1       GRA-------LPRVWQV-----------------------
URED_RHOS5       GRA-------LPRVWQD-----------------------
URED_PARDP       PDP-------LPRIWQV-----------------------
URED_MAGMM       GQLGRPA--RMPRLWDI-----------------------
URED_FRAAA       ----------------------------------------
URED_FRACC       V---------------------------------------
URED_FRASN       GSLADPLPVGS-----------------------------
URED1_SACEN      DAEALTRELW------------------------------
URED_STRAW       ----------------------------------------
URED_STRCO       ----------------------------------------
URED3_STRGG      DTLKA-----------------------------------
URED2_SACEN      PCST------------------------------------
URED_ANADF       AVTGADPFARTP----------------------------
URED_SORC5       GELGDDPFARKW----------------------------
URED_SYNJB       QAKGGSP-----QGW-------------------------
URED2_SYNJA      AAQRSSS-----QGW-------------------------
URED1_BRASB      AGALGVALARRRK---------------------------
URED3_BRASO      AAALGVTLSRRRK---------------------------
URED1_METEP      ETLSGCAPGRRRK---------------------------
URED1_METPB      EALSGCGPGRRRK---------------------------
URED2_METRJ      AALTGLAPARRRK---------------------------
URED1_PSEU2      QQLTGLAPRVRRK---------------------------
URED1_PSESM      QQLTGIAPRVRRK---------------------------
URED2_BRASB      EIDLGARAAQAPSAAATARPTAA-----------------
URED2_BRASO      EIDLGARAAQAPRAAATARPTAA-----------------
URED2_METEP      EEARDRSLPAEPYWR-------------------------
URED3_METPB      EEVRGRPLPAEPYWR-------------------------
URED_YERPS       EEILGVTLPEQFLWR-------------------------
URED_YERP3       EEILGVTLPEQFLWR-------------------------
URED_YERE8       EEILGVTLPEKFLWR-------------------------
URED_PHOLL       EEILGVTLPEPFIWR-------------------------
URED2_BRUAB      QEVTGASLPENFLWA-------------------------
URED2_BRUA2      QEVTGASLPENFLWA-------------------------
URED2_BRUME      QEVTGASLPENFLWA-------------------------
URED2_BRUSU      QEVTGASLPENFLWA-------------------------
URED2_BRUC2      QEVTSASLPENFLWA-------------------------
URED2_BRUO2      QEVTGASLPENFLWA-------------------------
URED_CENSY       MEMTGAAYPGIRKC--------------------------
URED_HALWD       RELLGVGAPLGDR---------------------------
URED_NATPD       QELLGVGIPADRRY--------------------------
URED_HALMA       IELLDAPAPSGRKY--------------------------
UREH_HELPY       QTTTQKV---------------------------------
UREH_HELPJ       QTTTQKV---------------------------------
UREH_HELHP       ----------------------------------------
URED_HAEIG       SV--------------------------------------
URED_HAEIN       ----------------------------------------
URED_ACTPJ       AQSNIV----------------------------------
URED_ACTP2       AQSNIV----------------------------------
URED_ARTS2       ---ERWYGQSPLNLRKY-----------------------
URED_PAEAT       ---ERWYGQAPLNLRKY-----------------------
URED_KOCRD       ---QRWRGQSPLRLRKY-----------------------
URED_CORGL       ---GRWRGQEPVNLRKY-----------------------
URED_COREF       HETAKWRGAESASSMHYS----------------------
URED_BACC1       ---ENCLHEELTSYRKY-----------------------
URED_LACP7       ---MKWYKRSPVFLGKY-----------------------
URED_STAA8       ---ENIYDRKLDFLRKY-----------------------
URED_STAAE       ---ENIYDRKLDFLRKY-----------------------
URED_STAAT       ---ENIYDRKLDFLRKY-----------------------
URED_STAA3       ---ENIYDRKLDFLRKY-----------------------
URED_STAAC       ---ENIYDRKLDFLRKY-----------------------
URED_STAA2       ---ENIYDRKLDFLRKY-----------------------
URED_STAA9       ---ENIYDRKLDFLRKY-----------------------
URED_STAAR       ---ENIYDRKLDFLRKY-----------------------
URED_STAAS       ---ENIYDRKLDFLRKY-----------------------
URED_STAAB       ---ENIYDRKLDFLRKY-----------------------
URED_STAES       ---QTIYHRQINFLRKY-----------------------
URED_STAEQ       ---QTIYHRQINFLRKY-----------------------
URED_STAS1       ---KQIFDRDVDFLRKY-----------------------
URED2_STRGG      RLLTGRPAPDLRKP--------------------------
URED_HUNT2       ----------------------------------------
URED_FLAJ1       IAEEKLNIKSQVTDLAENYI--------------------
URED_UREPA       RKLFNKKPLILRKP--------------------------
URED_MYCS2       FQRASTRTFTDGMPFRRSQV--------------------
URED_MYCGI       RELLPGKDES------------------------------
URED1_STRGG      TENDHA----------------------------------
URED_OPITP       EAFPRMRCDPRRL---------------------------
URED_DEIRA       HDLFGAAPLVLRR---------------------------
URED_HERA2       QALYGTTPNLPRKIY-------------------------
URED_BACHD       TFALKGE---------------------------------
URED_LYSSC       ALL-------------------------------------
URED1_SYNJA      RGLPAVDVMRYSSAL-------------------------
URED_TRIEI       NLTNRSSLPYISK---------------------------
URED_CYTH3       DKELLGFNPFEGRN--------------------------
URED_ARCB4       KELNKSKFNLGKQ---------------------------