CLUSTAL format seed alignment for MF_01385

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UREF_HELPY       MDKGKSVKSTEKSVGMPPKTPKTDNNA--HVDNEFLILQVNDAVFPIGSYTHSFGLETYI
UREF_HELPJ       MDKGKSVKSTKKSVGMPPKTPKTDNNANSHVDNEFLILQVNDAVFPIGSYTHSFGLETYI
UREF_UREPA       ------------------------MTLNSDYLNLLDLMQITNANFPIGTFSHSFGVETYI
UREF_UREP2       ------------------------MTLNSDYLNLLDLMQITNANFPIGTFSHSFGVETYI
UREF_LACP7       -----------------------------MDNYVLNLLQLCDSTFPTGAFSHSFGLETYI
UREF_GEOKA       ----------------------------MTDQQLLWLLQLSDSNFPSGAFSHSFGFETYM
UREF_STAAB       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAR       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAC       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAA8       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAS       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAE       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAT       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAW       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAA3       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAA2       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAN       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAA1       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAAM       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAA9       ----------------------------MIDHTHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAES       ----------------------------MIDHQHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAEQ       ----------------------------MIDHQHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_STAS1       ----------------------------MIDHAHLRLFQFCDSQFPTGAFSHSFGLETYI
UREF_PAEAT       ----------------------------MSATYQLALQQLTDSALPTGAFAHSLGFESYI
UREF_ARTS2       --------------------------MAAAGSYQLALQQLTDSALPTGAFAHSLGFETYI
UREF_COREF       -------------------------MESTRMTRTLAAMQLMDSALPTGAFSHSHGFETYL
UREF_CORGL       ----------------------------MDLDADFLLLHLSDSALPTGAFAHSFGFETYM
UREF_CORGB       ----------------------------MDLDADFLLLHLSDSALPTGAFAHSFGFETYM
UREF_PSEHT       -------------------MHTNTEPTQSSDLALLGLMQLISPALPIGAFAWSQGLESAF
UREF_PSYCK       -------------------MRIDDPSNAVSDLALLGLMQLISPALPIGAFAWSQGLESAF
UREF_MARHV       -------------------MATNTPTEPGGDLALLGLMQLVSPALPIGAFAWSQGLESAF
UREF_CHRSD       --------------------MSTEPVSQHDPLALAGLMQLVSPALPIGAFAWSQGLESAL
UREF_HAHCH       ----------------------------MPPLALLKLMNLISPALPVGAFAYSQGLEWAI
UREF_SACD2       ---------------------------MFNNNSLQKLMYLVSPALPVGAYAYSQGLEFAV
UREF_ALKEH       -----------------------MSTETNPGLAQRRLWQLISPTLPIGAYSYSAGLEYAV
UREF_MARMS       -------------------MDTVTTNIVTTDIRLLRLLQLSSVGLPVGGFAFSQGMEYAI
UREF_PSYIN       ----------------------MTADKQSSTLKLNRLLQLCSANLPVGGFSFSQGLEYAV
UREF_SHEHH       ------------------------MYSAHCMLPELRLYQLISPSLPVGGFTYSQGLEWAI
UREF_ALIF1       ------------------------------MLEDLRLYQLISPSLPVGSFTYSQGLEWAI
UREF_ALCBS       ----------------------------MNNSAFFRLQQLISPSLPIGAFTYSQGMEWAV
UREF_BLOFL       ------------------------MNIHRECRSLLSLIQIVSGNLPTGGFSYSKGLESAI
UREF_BLOPB       ------------------------MCADHGISSVLSLMQLVSSNFPVGSFAYSRGLEWAV
UREF_CITK8       ------------------------MTDAR---QRLRLMQLASSSLPVGSFTWSQGLEWAV
UREF_ENT38       ------------------------MEHNR---QQLRLMQLSSSSLPVGSFTWSQGLEWAV
UREF_ECO57       ------------------------MPTPE---KRLRLMQLASNSLPVGGYSWSQGLEWAV
UREF_KLEP7       ------------------------MSTAE---QRLRLMQLASSNLPVGGYSWSQGLEWAV
UREF_PSEP1       ------------------------MNSDL---ALLRLLQLASPGLPVGGFTYSQGLEWAV
UREF_PSEPK       ------------------------MNSDL---ALLRLLQLASPGLPVGGFTYSQGLEWAV
UREF_PSEPG       ------------------------MNSDL---ALLRLLQLASPGLPVGGFTYSQGLEWAV
UREF_PSEPW       ------------------------MNSDL---ALLRLLQLASPGLPVGGFTYSQGLEWAV
UREF_PSEE4       ------------------------MNTDL---ALLRLLQLASPGLPVGGFTYSQGLEWAV
UREF2_OCHA4      ------------------------MPMHSPALPMLHLMRLVSPSQPVGAFSYSRGLEWAV
UREF_PSEAE       ------------------------------MNSIWARLRLASSQLPIGGYSYSQGLEAAL
UREF_PSEAB       ------------------------------MNSIWARLRLASSQLPIGGYSYSQGLEAAL
UREF_PSEA7       ------------------------------MNSIWARLRLASSQLPIGGYSYSQGLEAAL
UREF_PSEMY       ------------------------------MKPAWALLRLASPQLPIGGYSYSQGLEWAI
UREF2_PSESM      ------------------------------MNSAWALLRLASPQLPIGGYSYSQGLEMAV
UREF_NITOC       ------------------------------MNSLWPLLRLASPQLPIGAYTYSQGLESAI
UREF_JANMA       ----------------------------MQAQALLHLLQLSSPSLPIGAYSYSQGLEAAI
UREF_NITMU       ---------------------------MKEYRALLALLHLASPSLPIGAYTYSQGLESAI
UREF_POLSJ       --------------------MPASPAAQLPAASLLQLIWLASPALPVGGFSYSEGLETAV
UREF_RHOFT       ----------------------------MNATSLLQLMWLASPALPIGGFSYSEGLEAAV
UREF_ACIAC       -----MAPAPDPAPAGSAAPDPASAPQGLPAASLLQLIWLASPALPVGGFSYSEGLEIAV
UREF_METPP       ------------------MPRVRRPAAPTGAATLLALMWLASPALPVGGFSYSEGLEPAV
UREF_BORBR       -------------------------------------MHLSSPALPIGGFSYSQGLEAAI
UREF_BORPA       -------------------------------------MHLSSPALPIGGFSYSQGLEAAI
UREF_CUPNH       ---------------------------MTQLHQLISLLHLASPSLPIGGFSYSQGLEAAI
UREF_CUPPJ       ---------------------------MTPLRQLISLLHLASPALPIGGFSYSQGLEAAI
UREF_CUPMC       ---------------------------MTALPQLISLLHLASPALPIGGFSYSQGLEAAI
UREF_RALSO       ---------------------------MTSAAQLTALLHLASPALPVGAFSYSQGLEAAV
UREF_DELAS       -------------------------MADLSIQGLCALLHLASPQLPVGGFSYSQGLEAAI
UREF_POLAQ       --------------------------MSIDLNEITALMQLASPALPIGGYSYSQGLEAAI
UREF_BURA4       ----------------------------MTTTELVALLHLASPALPIGAFSYSQGFEAAL
UREF_BURCM       ----------------------------MTTTELVALLHLASPALPIGAFSYSQGFEAAL
UREF_BURVG       ----------------------------MTTTELVALLHLASPALPIGAFSYSQGFEAAL
UREF_BURL3       ----------------------------MTTTELVALLHLASPALPIGAYSYSQGLEAAL
UREF_BURCA       ----------------------------MTTTELVALLHLASPALPIGAYSYSQGLEAAL
UREF_BURCH       ----------------------------MTTTELVALLHLASPALPIGAYSYSQGLEAAL
UREF_BURCC       ----------------------------MTTTELVVLLHLASPALPIGAYSYSQGLEAAL
UREF_BURM1       ----------------------------MTTTELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURPS       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURP0       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURP1       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURP6       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURMA       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURM7       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_BURMS       ----------------------------MDTAELVALLHLASPALPIGAFSYSQGLEAAL
UREF_PARXL       ----------------------------MRIAELTALLHLASPALPIGAFSYSQGLEAAI
UREF_AZOSB       ----------------------MSTNPAGGLLPLIRLLQLASPALPVGAYTYSQGLEWAV
UREF_DECAR       ---------------------------MKTCLQLARLLQLASPTLPVGAYTYSQGLEWAV
UREF_METFK       ---------------------------MSKSRSLVRLLQLASPMLPVGAYSYSQGLEWGI
UREF_NOSS1       -----------------------MDTTTLTDHHFLHILQLASSALPVGAYSYSEGLETLV
UREF_TRIV2       -----------------------MDTITLTDHHFLHILQLASSALPVGAYSYSEGLETLV
UREF_ACAM1       -----------------------MDTTQ-------RLLQLTSPALPVGAYSYSEGLEWLV
UREF_MICAN       ----------------------MLDQKE-----LLCLLQLASPILPVGAYSYSEGLETLV
UREF_SYNY3       ----------------------MLSGSA-----QLKLLQLVSPTLPVGAYNYSEGLEWLI
UREF_SYNP2       -----------------------MQQLI--------LWQLINSNFPLGAYNYSEGLEYLV
UREF_THEEB       ----------------------MLTDSA-----LLTLLQWVSPALPIGGFNYSEGLETLI
UREF_RHIEC       ------------------------MSEDRELQALLRLTAWLSPAFPIGSFAYSGGLERAV
UREF_RHIL3       ------------------------MTRDRELQALLRLTAWLSPAFPIGSFAYSGGLERAV
UREF_AGRFC       ------------------------MSAESGVAALLRLMAWLSPAFPVGGFSYSGGLEKAV
UREF_RHIME       ------------------------MAEHADTQSLLRLVTWLSPAFPVGSFSYSGGLEQAI
UREF_SINMW       ------------------------MAEHADTQALLRLVTWLSPAFPVGSFSYSGGLEQAI
UREF1_BRUAB      -------------------MTIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF1_BRUA2      -------------------MTIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF2_BRUME      -------------------MTIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF_BRUO2       -------------------MTIITPITNDPTTALLRLMAWLSPVFPAGSFSYSHGLERAV
UREF1_BRUC2      -------------------MIIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF1_BRUSU      -------------------MIIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF1_BRUSI      -------------------MIIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF1_OCHA4      -------------------MNIITTTTTDTTTALLRLMAWLSPVFPVGSFSYSHGLERAV
UREF_RHILO       ------------------------MTDQPSSIALLRLMAWLSPAFPVGGFAYSHGLECAV
UREF_CHESB       ------------------------MTTTTELQSLQRLLTWASPAFPVGSFAYSAGLETAI
UREF_AZOC5       ----------------------MTMAETGAPPSALALFAWLSPGFPVGAYAYSHALEWAA
UREF_XANP2       -----------MQGRAGAGEAAGAGSEADAPVSLLPLFAWLTPSFPVGAYAYSHTLEWAV
UREF_METEP       ----------MPAVMPMTTVTDIRTITRTPMIDALRLMAWLSPTYPVGAFAYSHGLEWAV
UREF_METPB       ------------------------------MIDALRLMAWLSPTYPVGAFAYSHGLEWAV
UREF_METRJ       -------------------------MPPAEALEALRLMAWLSPGYPVGAYAYSHGLEWAV
UREF_METS4       ----MDEADPGEAEAAQAEAAQDGAAQDGAARDALLLLSWLSPGYPVGAYAYSHGLEWAA
UREF_BRASB       -------------MTASERPHVSAAMTELDHPALYRLMTWLSPAFPVGGFAYSSGIEWAV
UREF_BRASO       -------------MTTNDAGRIPSAAGGAELAALYRLLTWLSPAFPIGGFSYSSGLEWAV
UREF_BRADU       ------------MLMTTNEPVNAGDLAAREAAALYRLMTWLSPAFPVGGFSYSSGIEWAV
UREF_RHOPS       -----------MSTSRAPETTSAAPLSAEQSASLYRLMTWLSPAFPVGAFSYSSGLEWAV
UREF_RHOP2       ----------------MPEAT-AGPLSAEQGASLYRLMTWLSPAFPVGAFSYSSGLEWAV
UREF_RHOPA       -------------MSTEPEAS-AQPLPAQQSAALFRLMTWLSPAFPVGAFSYSSGIEWAV
UREF_RHOPB       -------------MATSTNSQDDAALSAAQAAALYRLMTWLSPAFPVGAFSYSSGIEWAV
UREF_RHOP5       ----------------MTDATDPGALSAALAAALYRLMTWLSPSFPVGAFAYSSGLEWAV
UREF_RHOS4       -----------------------------MSAALLSLVQWLSPAFPTGAFAYSHGLEWAI
UREF_RHOS1       -----------------------------MSAALLSLVQWLSPAFPTGAFAYSHGLEWAI
UREF_RHOS5       -----------------------------MSRALLTLVQWLSPAFPTGAFAYSHGLEWAI
UREF_DINSH       -----------------------------MIAARLRLSQWLSPSFPVSGYAYSHGLEQAI
UREF_JANSC       --------------------MSDGAFDAGRTGGLLRLSQWLSPAFPVSAYAYSHGLEAEI
UREF_PARDP       ------------------------MTTITPEAARLRLAQYLSPAFPTGGFAWSQGLEWAM
UREF_ROSDO       -------------------MTIHTSRIIMSTDAFLTLTQWLSPGFPVGAYAYSHGLEQVI
UREF_RUEST       ----------------------------MTSEATLKLMQWLSPAYPVGAFAYSHGLEGAV
UREF_RUEPO       -------------------------MATPTEKQILTLAQWFSPAYPVGAFAYSHGLEWSV
UREF_GRABC       ------------------MIDDFAPTSSTGDAALYRLLSWLSPAYPVGAYTYSHGLETAV
UREF_MAGMM       ---------------------------MSTEAALLKLQSWFSPSFPVGGYTYSHGLEYGV
UREF_YERPE       ----------------------------MNASDLIRIMQFGDSVLPVGAFTFSNGVESAI
UREF_YERPS       ----------------------------MNASDLIRIMQFGDSVLPVGAFTFSNGVESAI
UREF2_BRUA2      -------------MTMRTATITEFSSSYRSLPGLLHLLQFGDSALPIGGFSFSNGLESAI
UREF2_BRUC2      -------------MTMRTATITEFSSSYRSLPGLLHLLQFGDSALPIGGFSFSNGLESAI
UREF2_BRUSU      -------------MTMRTATITEFSSSYRSLPGLLHLLQFGDSALPIGGFSFSNGLESAI
UREF2_BRUAB      -------------MTMRTATITEFSSSYRSLPGLLHLLQFGDSALPIGGFSFSNGLESAI
UREF2_BRUSI      -------------MTMRTATITEFSSSYRSLPGLLHLLQFGDSALPIGGFSFSNGLESAI
UREF1_BRUME      ---------------MRTATITEFSSSYRSLPGLLHLLQFGDSALPIGGFSFSNGLESAI
UREF_HAEIN       ----------------------MAQTLNRSLTDLGALLHLVDPTLPIGGFNHSNGLETFV
UREF_TRIEI       -------------------------MINSDISEQLALMQLSDSFFPTGSFTFSHGLETLV
UREF1_PSESM      ---------------------------MNTLSSLLLALQQADSFFPGGAVAWSWGLETLV
UREF_MYCTU       ------------------------------MTSLAVLLTLADSRLPTGAHVHSGGIEEAI
                                                              * .    *  .*   

UREF_HELPY       QQK-----------------KVTNKESALEYLKANLSSQFLYTEMLSLKLTYESALQ---
UREF_HELPJ       QQK-----------------KVTNKESALEYLKANLSSQFLYTEMLSLKLTYESTLQ---
UREF_UREPA       RKD-----------------IVFDGESLIKALLLYMNEQLLHGDLLAIYQIFKLLPK---
UREF_UREP2       RKD-----------------IVFDGESLIKALLLYMNEQLLHGDLLAIYQIFKLLPK---
UREF_LACP7       QDG-----------------IIFNKETFSKWNKAYIKEQLVYSDGLACRLAYEALEN---
UREF_GEOKA       YNE-----------------QICDAKTFREALVVYIQTQLTYTDGLACRIAYEQLEA---
UREF_STAAB       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAR       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAC       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAA8       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAS       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAE       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAT       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAW       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAA3       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAA2       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAN       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAA1       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAAM       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAA9       QRN-----------------IIHDDHTFIAWLKMFLQEQLTYSDGLAMRLVYDALEN---
UREF_STAES       QRE-----------------TVHDTETFIKWLHLFINEQLTYSDGIAMRIVYHALIN---
UREF_STAEQ       QRE-----------------TVHDTETFIKWLHLFINEQLTYSDGIAMRIVYHALIN---
UREF_STAS1       QRD-----------------TVHDEESFQQWLVLFLNEQLTYADGLTMRLVYDALNE---
UREF_PAEAT       HRG-----------------LVRDESTFSTWLQAFVSQQLSYSDGLALRFLFEGVD----
UREF_ARTS2       ERG-----------------LVHDEASFGVWLSAFVGQQLSYSDGLAIRFLYEGVS----
UREF_COREF       HRG-----------------VIHDASSFGVWLQMFIQQQLTFTDAVVIREVFRSTSL---
UREF_CORGL       DAE-----------------RITNAEEFQDWLKVLLKVQLTSSDALAMRMFYATPTV---
UREF_CORGB       DAE-----------------RITNAEEFQDWLKVLLKVQLTSSDALAMRMFYATPTA---
UREF_PSEHT       ELG-----------------WVTNEQQLGEWLEGVLDDGLTRCELPVLARLQNCWAK---
UREF_PSYCK       ELG-----------------WVNNEAQLGEWLEGVLGDGLTRCELPVLARLQRCWAN---
UREF_MARHV       ELG-----------------WVNNEAELAQWIEGVLEDGLSRCELPLLARLQTAWAN---
UREF_CHRSD       ELG-----------------WVDDEASLGEWLAGVLDDGLTRCELPVLARVHRAWAE---
UREF_HAHCH       DHG-----------------GIDTPEKIHDWLQGVISQGLGKTDLPVLFKLLQAWGA---
UREF_SACD2       DGG-----------------WLKTEADVSAWIAGVMENSLAELDMPVLVRIYKAWQQ---
UREF_ALKEH       EAG-----------------WLRNADAVADWLQGQLHHALAPVDIPALARLHAAWQS---
UREF_MARMS       DQG-----------------WVKNKTEVSDWIGLQLQQSLARVDLPVLRLCMDAAKQ---
UREF_PSYIN       EMN-----------------WISGQKSTFEWIELNLSESLSRTDLAILKRLYQALDS---
UREF_SHEHH       DKG-----------------WVTTATELENWLKSQMLESLTCLELPVLVRIQGYLAA---
UREF_ALIF1       EKG-----------------WVTNVTELKHWLSNQLMDSLATLELPVLAKLTQLLQQ---
UREF_ALCBS       ECG-----------------WIKNADDLHCWLESLLQSSVQTLELPVLARLYHASCH---
UREF_BLOFL       EYG-----------------WVKSLEDFLNWQKQWIHEQLIYIDWPMLKRCYYYTKI---
UREF_BLOPB       ENN-----------------WVNSVETFYSWQQQWIDGPLIYLEWPMLKRCYYYAQI---
UREF_CITK8       EIG-----------------WVKNAEDFAHWQTQQLEQNFFTVDLPIFARLYHACER---
UREF_ENT38       EAG-----------------WITTDAEFKRWQIQQMEQSFFCVDLPLFIRLYRACEQ---
UREF_ECO57       EAG-----------------WVEDSAAFEHWQQLQMEQSFFAVDLPLLARLYRACEA---
UREF_KLEP7       EAG-----------------WVPDVAAFERWQRRQMTEGFFTVDLPLFARLYRACEQ---
UREF_PSEP1       EAG-----------------WVRGVDSFVGWQREQVHDTLACLDWPVLARLYRACQA---
UREF_PSEPK       EAG-----------------WVRGVDSFAGWQREQVHDTLACLDWPVLARLYHACQA---
UREF_PSEPG       EAG-----------------WVRGVDGFVAWQREQVHDTLACLDWPVLARLYHACQA---
UREF_PSEPW       EAG-----------------WVRDIKSFSAWQREQMNDTLAYLDWPVLARLYYACKA---
UREF_PSEE4       EAG-----------------WVRSVAGFAAWQREQLHDTLGYLDWPVLARLYRACQA---
UREF2_OCHA4      HAG-----------------TVTNEESCAGWVFGLLEHSYAVLDGAIFWRMISALMR---
UREF_PSEAE       DNG-----------------WVRDAESARTWLVDQLQLNLARFEAPLLAGLLRAALI---
UREF_PSEAB       DNG-----------------WVRDAESARTWLVDQLQLNLARFEAPLLAGLLRAALI---
UREF_PSEA7       DNG-----------------WVRDAESARTWLVDQLQLNLARFEAPLLAGLLRAALA---
UREF_PSEMY       DSG-----------------LIQDADAAERWLADQLTLNLARFEAPLLLAHCRAAHE---
UREF2_PSESM      EQS-----------------IVIDPQTAGRWIGDQLLLNLARFEAPLLLAHCEAAAV---
UREF_NITOC       DQG-----------------IVWDADSVRLWLSDQLAMNIACFEAPLFARMLEAAAQ---
UREF_JANMA       ENG-----------------TVKDEVGARRWIIDVLHEVVARFEAPVLWRLLQAFET---
UREF_NITMU       EQG-----------------LVRDETSAREWLVEML-GIFTDFELPILQRLLKAFSE---
UREF_POLSJ       ERA-----------------GVTTEVLAGDWLRDQLHLSLARGDLAVIAQAIPAWRV---
UREF_RHOFT       DTA-----------------RVATEEEASEWLLDQLDLSLTRSDLAVLAQSMPAWQC---
UREF_ACIAC       ECA-----------------GVTNESAAAAWLQEQLMLTQARGDLAVVHQALAAWRA---
UREF_METPP       EAG-----------------LVSDEATAQAWLLDQLLLGLGRGELAVVAQAVAAWRR---
UREF_BORBR       ELG-----------------LVHDEASTLAWIESQLVTVMARAEAPLWCLLFEAWRA---
UREF_BORPA       ELG-----------------LVHDEASTLAWIESQLVTVMARAEAPLWCLLFEAWRA---
UREF_CUPNH       DCG-----------------SVHDAASAERWIRDNLLHVQAQCEAPLWLLLHRCWKA---
UREF_CUPPJ       DIG-----------------CVRDADTAERWIRDSLLYVQAQCEAPLWLLLHRGWQA---
UREF_CUPMC       DCE-----------------LVRDATTAERWIRDNLLHVQAQCEAPVWLLLHRAWQT---
UREF_RALSO       EAR-----------------HVHDEASAARWIAEGLA-VLAACEAPLWLLQYADWQA---
UREF_DELAS       EHG-----------------LVTDAGTARTWIADALAHGFARCEAPLWLLLRRAWSA---
UREF_POLAQ       DSG-----------------IVKDASTAEAWIKDVFLGVFARSEAPLWLLSYKAWAK---
UREF_BURA4       DAN-----------------LIRDADTARDWIASGLTDVLAHGELPFLAHQLARWHA---
UREF_BURCM       DAN-----------------LIRDADTARDWIAGGLTDVLAHGELPFLAHQLARWHA---
UREF_BURVG       DAN-----------------LIRDADTARDWIASGLTDVLAHGELPFLAHQLARWHA---
UREF_BURL3       DAN-----------------LIHDADTARDWIASGLTDVLAHGELPFLAHQLARWHA---
UREF_BURCA       DAN-----------------LIRDADSARDWIASGLTDVLAHGELPFLAHQLARWQT---
UREF_BURCH       DAN-----------------LIRDADSARDWIASGLTDVLAHGELPFLAHQLARWQT---
UREF_BURCC       DAN-----------------LIRDADSARDWIASGLTDVLAHGELPFLAHQLARWQT---
UREF_BURM1       DAN-----------------LIHDADSARNWIASGLTDVLAHGELPFLAHQLARWQA---
UREF_BURPS       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_BURP0       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_BURP1       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_BURP6       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_BURMA       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_BURM7       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_BURMS       DAP-----------------LIRDADGARDWIASGLADVLAQGELPFLAHQLARWHA---
UREF_PARXL       EAQ-----------------LITDADSAREWIASGLTDVLARGELPFLAHQMERWRT---
UREF_AZOSB       ECG-----------------TVRTEADARRWIGDVLEWSLARFEAPLVARLLAAWAD---
UREF_DECAR       ESG-----------------VIRDEASAGRWIADLMHHGIGCYEAPMVAALMTAWSA---
UREF_METFK       ESG-----------------EVHDLESAQAWIGDVLQVYQGGFELPVLSRCYRAWQR---
UREF_NOSS1       ENG-----------------TITSQSTLQQWLEAELSYGAIRLEAAVMVRAYQAATM---
UREF_TRIV2       ESG-----------------TITSQSTLQQWLEAELSYGAIRLEAAVMVRSYQATIM---
UREF_ACAM1       DQG-----------------TIDNESHLRTWLLQELAYGSIRMEAAVMVRGYRAST----
UREF_MICAN       EKG-----------------IISNSASLNDWLERSLCQGSIRLETAVLLRVYRCFCQ---
UREF_SYNY3       ERG-----------------NITNADTLGAWITQELCRGSITVDTAIMVRAHRLAGQMPK
UREF_SYNP2       ESA-----------------GCSEVESFQDWLGLHLRYGSIRAEVSIVLRIVQAIAS---
UREF_THEEB       AQG-----------------QITSAAALQDWLGFELAFGSAQWETAVMARVYRAIAK---
UREF_RHIEC       ADG-----------------LVTDAASLANWIGTLIGHGSVWNDAVLLTESHRRQA----
UREF_RHIL3       ADG-----------------LVTDAALLAAWIGTLVGNGSVWNDAVLLAESHRQQA----
UREF_AGRFC       EDG-----------------RVCDAAGLGGWVETLLRHGSLWNDAVFLAHAWRSSQ----
UREF_RHIME       HDR-----------------LVTGADDLRLWCETLLDHGTTWNDALLLAEGYRACD----
UREF_SINMW       HQG-----------------LVTSADDLRLWCETLLERGNTWNDALLLSESYRAYG----
UREF1_BRUAB      HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAM----
UREF1_BRUA2      HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAM----
UREF2_BRUME      HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCTM----
UREF_BRUO2       HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAM----
UREF1_BRUC2      HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAM----
UREF1_BRUSU      HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAM----
UREF1_BRUSI      HDG-----------------LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAM----
UREF1_OCHA4      HDG-----------------YVADTATMSDWLRWLVTRGSGWNDAVLCAESWRRAV----
UREF_RHILO       HDG-----------------LVADATSLANWLETLVKMGSGWNDAVLFCESWRRAR----
UREF_CHESB       ADR-----------------RVKDAATARDWIEGNLLAGAARNDAILMAEACRAYL----
UREF_AZOC5       EAG-----------------DITDESSLESWLRDLMLLGFGRADGILLAHAYGAGAA---
UREF_XANP2       EAG-----------------DIRDEESLGTFLGDLLALGFGRSDAILAAHAHRAAAV---
UREF_METEP       ECG-----------------DVRDAATLSDWLADVLEWGAGRNDMILCAAAHRATEA---
UREF_METPB       ECG-----------------DVRDAATLADWLSDVLERGAGRNDMILCACAHRAVAA---
UREF_METRJ       EAG-----------------DVRDEASLTAWLRDVCERGALRNDLILAAQAHAAART---
UREF_METS4       EAG-----------------DVRDEASLGAWLADVLSHGAARNDAILAAHAHGAGLA---
UREF_BRASB       EAG-----------------DVDDAASLRGWLSTMLTDGSGFCDAVFLVHAHRAMEL---
UREF_BRASO       EAG-----------------DICDAAALRGWLATMLTDGSGFCDAAFLVHAHRATEL---
UREF_BRADU       EAG-----------------DITDTATLADWLDTMLGDGSGFCDATFLVQAYRATEA---
UREF_RHOPS       EAG-----------------DVIDAPSLRDWLTAMLEHGAGFCDGVFLAHAYRAVAA---
UREF_RHOP2       EAG-----------------DVADAASLRDWLGAMLEHGAGFCDGVFLAQAYRAVEA---
UREF_RHOPA       EAG-----------------DVEGAASLRDWLDAMLQHGAGFCDAVLLCYAYRATER---
UREF_RHOPB       EAG-----------------DVVDAPTLQAWLAAMLSHGTGFCDAVLLAHAHRAVIS---
UREF_RHOP5       EAG-----------------DIKDAATLTDWLSAMLSDGAGFCDGVVLAQAYRAASA---
UREF_RHOS4       SEG-----------------EVRDAASARRWIADVLAFGAGRTDAILL--AHAL------
UREF_RHOS1       SEG-----------------EVRDAASARRWIADVLAFGAGRTDAILL--AHAL------
UREF_RHOS5       AEG-----------------EVQDAAGVEQWVADILRFGSGRTDAILL--AHAL------
UREF_DINSH       STG-----------------DIADAEDLLAWLQALLTSGACQADGVLV--ARAA------
UREF_JANSC       CHG-----------------RVRDGADVAAWIEGVVRRGAGRTDAIVM--LSAMQ-----
UREF_PARDP       DQG-----------------AVT-RATLPQWLEDWLDHGAGWCDAVLL--SLALR-----
UREF_ROSDO       DCG-----------------DMRDAKALQDWVEDILEHGSGTSDGILLAASYKA------
UREF_RUEST       SEG-----------------HVRDGDTLSDWLSDLLTHGGARSDALLLACAYRTE-----
UREF_RUEPO       EAG-----------------DVVDARTAQAWITDVLQHGAGWNDCLFIGSAYRAA-----
UREF_GRABC       EDG-----------------LVHHRQSLADYVATVLHDGAAAIDGPLLAASWRAAQA---
UREF_MAGMM       ECG-----------------LIHHRESLQTWLEGLLQWGAGHGEGVLFHGAYGAAVR---
UREF_YERPE       QTG-----------------IVHDVATLKGFVLTALKQAASCDGMGVVVAHRAVVAD---
UREF_YERPS       QTG-----------------IVHDVATLKGFVLTALKQAASCDGMGVVAAHRAVVAD---
UREF2_BRUA2      QQN-----------------LVHDKETLREFTLTAMNQAATSDGIALLTAHRAARAD---
UREF2_BRUC2      QQN-----------------LVHDKETLREFTLTAMNQAATSDGIALLTAHRAARAD---
UREF2_BRUSU      QQN-----------------LVHDKETLREFTLTAMNQAATSDGIALLTAHRAARAD---
UREF2_BRUAB      QQN-----------------LVHDKETLREFTLTAMNQAATSDGIALLTAHRAARAD---
UREF2_BRUSI      QQN-----------------LVHDKETLREFTLTAMNQAATSDGIALLTAHRAARAD---
UREF1_BRUME      QQN-----------------LVHDKETLREFTLTAMNQAATSDRIALLTAHRAARAD---
UREF_HAEIN       QQR-----------------VVESKATLEEYVQTQLLQNWIYNDGAYLSLAFDAMCE---
UREF_TRIEI       QTG-----------------KIQSQPEILYFLQILLRNKVGVSDVVALIHSYRGCKN---
UREF1_PSESM      ADGRLGAGERVTARRRQRAVRLDRSAAVRGFVEGQLRHRWHSFDRVFLLAAWNAADD---
UREF_MYCTU       AAG-----------------MVTGLATLEAFLKRRVRTHGLLTASIAAAVHRGELAV---
                                                                             

UREF_HELPY       ------QDLKKILGVEEVIMLSTSPMELRLANQKLGNRFIKTLQAMNE-LDMGE------
UREF_HELPJ       ------QDLKKILGIEEVIMLSTSPMELRLANQKLGNRFIKTLQAMNE-LDMGA------
UREF_UREPA       ------QKINAIWEIDQMINFQGLARETREGQRRIGQQMVKIYNELFNCELLVE------
UREF_UREP2       ------QKINAIWEIDQMINFQGLARETREGQRRIGQQMVKIYNELFNCELLVE------
UREF_LACP7       ------NDMDTIWMLDGMLRAQILARESREGSRIIGERLLTLGNQLYPSSRLTS------
UREF_GEOKA       ------NSMEGLQRLNETLFALCLAKETREGTRMIGERLWKLCRDIYGVDEL--------
UREF_STAAB       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRIVKLALELYNSPWIAW------
UREF_STAAR       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNNPWIAW------
UREF_STAAC       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAA8       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAAS       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAAE       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAAT       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAAW       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAA3       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAA2       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAAN       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAA1       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAAM       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAA9       ------DDTQKVLHIDKLMFVQNLPKETRVGAKQMGTRMVKLALELYNSPWIAW------
UREF_STAES       ------NDKDKILDINQKLFVQNLPKETRIGAKQMGTRMVKLALDLYDSEWIQW------
UREF_STAEQ       ------NDKDKILDINQKLFVQNLPKETRIGAKQMGTRMVKLALDLYDSEWIQW------
UREF_STAS1       ------NDTKAILKLDRILFVQNLPKETRQGSKQMGNRMVKLASELYDSDWINW------
UREF_PAEAT       -----------VGLLDGVLSAQLLAREVREASLKMGGRLLEIGGEVFPSAELEA------
UREF_ARTS2       -----------FAELDALLTAQLLPRQLREASTKMGTRLLEIGTEVFPSPELAE------
UREF_COREF       ------KR---VGELDQLITAQAVPEQIRTAGKTMGIRMLEIAEQGYPDPALIW------
UREF_CORGL       ------SE---LKRLDERLFAGTPAREIREANARMGTRMAEIVAETYSVPLIVE------
UREF_CORGB       ------SE---LKRLDERLFAGTPAREVREANARMGTRMAEIVAETYSVPLIIE------
UREF_PSEHT       ------SDSEGLSYWNDWLHANRETAELSDEDTRLGLALMRLLNSLQLQPQIEQG---HA
UREF_PSYCK       ------NDGDGLAFWNDWLHANRETAELSDEDTRLGQALIRLLNSLELQPQKALG---HV
UREF_MARHV       ------DDGATIAHWNQWLHATRETAELSDEDTRLGGALKTLLGNLNLLPD-------QT
UREF_CHRSD       ------GDAQALAHWNDWLQANRETRELLEEEQRLGGTLVRLLRSLDQVPV-------TP
UREF_HAHCH       ------NDHEQINSWNAWLLAARETQELLDEDRHVGKALAKLLRDLNVPGA-------EP
UREF_SACD2       ------GDIEQVKYWNHFLRAGRETHELLLEDDQLGIALKRLLISLEIPHA---------
UREF_ALKEH       ------DDAVAVHYWSQWLRACRETKELREEDRHVGQALARLLRDLDLPEA-------AP
UREF_MARMS       ------QNTERLFELNDLVLACRETKELRLNDTAMGEALFRLMSSLQ-IDT--PF---KR
UREF_PSYIN       ------SDFTAFKLANQHLIACRESSELRFADLAMGKAFVRLLKQLDSLDSE-PY---SE
UREF_SHEHH       ------NDYAQAQAWCNYLAASRETKELRLEEHQRGIAFVRLLPKLGIALTSE------L
UREF_ALIF1       ------EEWQQAQDWCDFIIANRETKELRLEERQRGLAFSMLLPKLGIELNQT------T
UREF_ALCBS       ------QDREAFTHWAHTLLAWRETRELRMEECQRGHALTMVLDRLPDAANWP------E
UREF_BLOFL       ------NDSKNFKKCALQILSYRDTYELRLEEQRRGKAMEKLISQWYDPISD-------S
UREF_BLOPB       ------RDEMNFFQCALRILSYRDTHELRLEERQRGKALSRIILQWYPFTDGG------T
UREF_CITK8       ------NDVTAARRWSAYLLACRETRELREEERSRGAAFTRLVVDWVPDCPQ-------T
UREF_ENT38       ------NDAVSARRWTAYLLACRETRELREEERNRGAAFTRLIKSWEPDCPQ-------E
UREF_ECO57       ------GDPDSAGRWTAYLLACRETRELRDEERNRGAAFTRLLVDWQPDCPA-------E
UREF_KLEP7       ------GDIAAAQRWTAYLLACRETRELREEERNRGAAFARLLSDWQPDCPP-------P
UREF_PSEP1       ------EDAEAFGHWSRFLLANRETAELRLEEQQRGAALARLLDGWQLGQAP-------A
UREF_PSEPK       ------KDAEAFGHWSRFLLANRETAELRLEEQQRGAALARLLDGWQLGQAP-------A
UREF_PSEPG       ------EDAAAFGHWSRFLLANRETAELRLEEQQRGAALARLLDGWQLGQAP-------A
UREF_PSEPW       ------DDADAFARWSRFLLANRETAELRLEEQQRGAALARLLDGWQLGQAP-------A
UREF_PSEE4       ------DDAEVFAYWSRFLLANRETSELRLEETQRGSALARLLDGWQLGQDP-------A
UREF2_OCHA4      ------NDDAEFCRLNDWLGASRESSELELEDRRMGESLRTLLSELGVERAR-------S
UREF_PSEAE       ------GDWAACDAASERHRASRETRELAQESRQMGFSLHQLLEALPE--LDAP---GRA
UREF_PSEAB       ------GDWAACDAASERHRASRETRELAQESRQMGFSLHQLLEALPE--LDAP---GRA
UREF_PSEA7       ------GDWAACDAASERHRASRETRELAQESRQMGFSLQQLLEALPE--LDDA---GRA
UREF_PSEMY       ------GNWPHLQELAERHRASRETRELALESRQMGYSLRQLLEGLPE--LDEA---ARE
UREF2_PSESM      ------GDWGQLLQVSEQHRASRETRELHQESRQMGYSLQQLLNGLPE--LDRD---ARR
UREF_NITOC       ------GQWQQLFYWAEEYVASRETRELYQESRQMGFSLVQLLNDLPE--LDEA---MRH
UREF_JANMA       ------RDAAAVESWTERFIAARDTAEFRAETIQMGYSLGKLCSDLQL--GDAE---MLA
UREF_NITMU       ------RDEAAVSFWTECFVASRETSEFRAETVQMGYSLAKLVIDLKL--GDDS---MRA
UREF_POLSJ       ------GDVQRIRELNDWVLQTRETSEMRAQAEQMGRSLLDWLRNHDG--ANAQ---HIT
UREF_RHOFT       ------GDTARISQLNAWVLQTRESNELRAQTEQMGRSLLEWLRNHTT--ATAE---QIE
UREF_ACIAC       ------GDAERVRALNDWVLHTRETSELRLQTEQMGRSLADWLRNQHA--GDAEALSDVA
UREF_METPP       ------GDATRVRELNDWLLSTRESAELRLQTEQMGRSLGAWLQQRPG--TDAA---ALA
UREF_BORBR       ------GDDAAAHGWNQWFHASRETRELRQETEQMGRSLARLAQELGW--GTAA---TRA
UREF_BORPA       ------GDDAAAHGWNQWFHASRETRELRQETEQMGRSLARLAQELGW--GTAA---TRA
UREF_CUPNH       ------GDAAQVRTWNDWFRATRETSELRLETEQMGWSLSRLIAQMEW--GAPV---LRE
UREF_CUPPJ       ------MDVDAVREWNGWFHATRETAELRLETEQMGWSLAKLVGQMGW--GGDA---LRE
UREF_CUPMC       ------QDHASVRQWNDWFHATRETSELRLETEQMGWSLAKLIAQMGW--GDDA---SRD
UREF_RALSO       ------GRLDAVAERDGWFLATRETRELRLETAQMGWSLARLIAQMGW--GAPA---MRD
UREF_DELAS       ------GDEGAVHEWNQWFIASRDSREARAETLQMGWSLHSLLRSVPW--GGEA---FAP
UREF_POLAQ       ------NDVDSVHNLNDYFLASRETSELRSETEQMGWSLLQIAQSLGW--GGEC---LTQ
UREF_BURA4       ------HDADALARENAWFIASRESAELRRETEQMGWSLAQLCTSLEW--GDAA---RRA
UREF_BURCM       ------HDADALARENAWFVASRESAELRRETEQMGWSLAQLCTSLEW--GDTA---RRA
UREF_BURVG       ------HDADALARENAWFVASRESAELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURL3       ------HDTPALVTENAWFIASRESAELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURCA       ------HDTHALAAENAWFVASRESAELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURCH       ------HDTHALAAENAWFVASRESAELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURCC       ------HDTHALAAENAWFVASRESAELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURM1       ------HDAPALAAENAWFVASRESSELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURPS       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURP0       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURP1       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURP6       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURMA       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURM7       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_BURMS       ------HDAAALADANDEFVASRESFELRRETEQMGWSLAQLCASLEW--GDAA---RRA
UREF_PARXL       ------HDAESLRVANSEFLASRESAELRRETEQMGWSLRQLCVSLEW--GDAD---RRA
UREF_AZOSB       ------GDDAEVARLNEDFLASRETSELRAETVQMGYSLVRLLADLDAFAGLPGW---KA
UREF_DECAR       ------GDVDEIECLNAEFLASRESAELRAETVQMGFSMRRLLRDLRD-DTLAAV---AT
UREF_METFK       ------GDVEALNEWNAFYLAGRDNAEALAESRQMGYSLKRLLLEFEE--LSGAW---AT
UREF_NOSS1       ------DDMETLCYWNLWLSAARETQELRNSSWQMGRSLMQLLGKIQ-----------PE
UREF_TRIV2       ------GEMETLRYWNLWLSAARETQELRNSSWQMGRSLMQLLGKIQ-----------PE
UREF_ACAM1       -------DVQILQYWNAWLSAARETEELRLQSLQMGRSLLRLSKALQD-----PEHTGPE
UREF_MICAN       ------EDFTKLNYWDNWLSATRETAELRQQSWQMGRSLLNLLRELA-------------
UREF_SYNY3       TDILPSPTLKHLSYWNQWLTATRESRELREQSLQMGGSLRKLLLDLE-----------PT
UREF_SYNP2       ------GDFNQLQYWNTWLNGTRETRELRQQSIQMGNSLLKLLGDLD-------ENKRPQ
UREF_THEEB       ------GDFEAVHQWNAWLSAARESAELRAQNWQMGTALINLVAALD-------------
UREF_RHIEC       -------EAPGLAEIAALAEALAGSRERHQETMLLGEAFLLAAR-AWPDE----------
UREF_RHIL3       -------EAARLAEVAALAEALAGSRERHQETMLLGEAFLAAAR-AWPDE----------
UREF_AGRFC       -------DTTALSETANLGRALAGSAERYRETVLLGDAFIAAAS-AWPHA----------
UREF_RHIME       -------DAARLIAASELAEALAGSREWHMETMLLGEAFLAAAG-HWPHA----------
UREF_SINMW       -------DAQRLIAVSELAEALAGSRERHMETMLLGEAFLAAAG-HWPHP----------
UREF1_BRUAB      -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFFAAAR-SWPCE----------
UREF1_BRUA2      -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFFAAAR-SWPCE----------
UREF2_BRUME      -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFLAAAR-SWPCE----------
UREF_BRUO2       -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFLAAAR-SWPCE----------
UREF1_BRUC2      -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFLAAAR-SWPCE----------
UREF1_BRUSU      -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFLAAAR-SWPCE----------
UREF1_BRUSI      -------KGEDLHEIAELAEALAGSRERHMETMLQGGAFLAAAR-SWPCE----------
UREF1_OCHA4      -------AKGDLVEVAELAEALAGSRERHMETMLQGEAFLAAAR-SWPSS----------
UREF_RHILO       -------NAGDLDEVAALAEALAGSRERHAETMLQGAAFLKAAA-AWPNP----------
UREF_CHESB       -------DEQRLQQLTDLCLALTPALERHQELAATGEAFVLAAR-AWAAQ----------
UREF_AZOC5       ------GDVPALAQVNARAVALSPTAELRLETCQQGRSFLDAVRAAWPHGGLDA------
UREF_XANP2       ------GDKTALAEVNALAVALAPSAELRLETCQQGRSFLDAVRAAWPAPGLDA------
UREF_METEP       ------GDDAGLAEINDLALALAPSRELHLETSQQGRSFLDATLRAWPCPALST------
UREF_METPB       ------RDDADLVAINDLALALAPSRELHLETSQQGRSFLDATLQAWPCPALAE------
UREF_METRJ       ------SDGAALVAVNDLALALAPSRELHLETSQQGRSFLDATRGAWPCDALAA------
UREF_METS4       ------GDPRAAEALNDLALALAPSRELHLETSQQGRSFLDATVAAWPAPGLEA------
UREF_BRASB       ------GDIDRLREVAELAAAFVPSRERQLETTAQGRAFIEIARSAWNSPGLDD------
UREF_BRASO       ------DDIKRLSEVAELAAAFVPSRERQLETAAQGRAFIEIARSAWSCAGLDE------
UREF_BRADU       ------GEETSLRDIAELASAFVPSRERQLETTSQGRAFIDIARAAWDAEGLDA------
UREF_RHOPS       ------ADETALRHVAELATAFVPSAERHLETTAQGKAFIEIVRNAWPSDGLAC------
UREF_RHOP2       ------GDDAALRDVAELAAAMVPSAERHLETTAQGKAFIEIVRHAWASDGLAR------
UREF_RHOPA       ------HDDASLLAVAELAAAFVTSAERQLETLSQGRAFIEIARKAWNSDGLGR------
UREF_RHOPB       ------NDDDALRSLAELACAYVSSRERHLETTAQGRAFVEIARAAWANGRLER------
UREF_RHOP5       ------GDDARLRAVADLACAMVPSRERHLETTTQGRAFVEIASHAWSSARLPP------
UREF_RHOS4       -------RGHDPGALSDLARALAPAAERLRETEEQGAAFAATVAALTGRD----------
UREF_RHOS1       -------RGHDPEALSDLARALAPAAERLRETEEQGAAFAATVAALTGRD----------
UREF_RHOS5       -------KGHDLEALSDLARALAPSAERLRETEEQGAAFAATTAALTGRA----------
UREF_DINSH       -------AGDPLEPLCEAAEALAGSAERWSETRDQGAAFVSTTNALCDTA----------
UREF_JANSC       -------AGADLDRLHDLARALAGSRERWEETRDQGAALAATLAAMGEGD----------
UREF_PARDP       -------RGADHAELDDLARAMCPCARRLAETVEQGTAFAANVAALTGRP----------
UREF_ROSDO       -------LPEDVSRIDAIARAFASSAERVTETVDQGAAFAKAVDAIWATD----------
UREF_RUEST       -------TAESLAEIDDTARAFCPSAERLQETDLQGAAFCRTTAAIWDTA----------
UREF_RUEPO       -------SLQELKNINDTALAFSASSERMMETRLQGEAFCGITASVWPVD----------
UREF_GRABC       ------EDHARLDELAVLGAAWRSSAETALETSAQGRAFCDVTQAAWPDSRFAA------
UREF_MAGMM       ------QDWAALHEVTVWAQALRPTAELALESRGQGRAFLVAVQQGWPHPWVQR------
UREF_YERPE       -------DRDGIIRADWAVNNRKLNEESRLMATRMGKKLAEMSIHVVEHPLISW------
UREF_YERPS       -------DRDGIIRADWAVNNRKLNEESRLMATRMGKKLAEMSIHVVEHPLISW------
UREF2_BRUA2      -------DRGALQVIDKAVFERKLNEETRLMTVRMGRKLCELSASIIDDRLNRD------
UREF2_BRUC2      -------DRGALQVIDKAVFERKLNEETRLMTVRMGRKLCELSASIIDDRLNRD------
UREF2_BRUSU      -------DRGALQVIDKAVFERKLNEETRLMTVRMGRKLCELSASIIDDRLNRD------
UREF2_BRUAB      -------DRGALQVIDKAVFERKLNEETRLMTVRMGRKLCELSASIIDDRLNRD------
UREF2_BRUSI      -------DRGALQVIDKAVFERKLNEETRLMTVRMGRKLCELSASIIDDRLNRD------
UREF1_BRUME      -------DRGALQVIDKAVFERKLNEETRLMTVRMGRKLCELSASIIDDRLNRD------
UREF_HAEIN       ------GNFDRLCELDWQLSATKVARESREGSFKLGVRLLKIFIRYETHTLLTA------
UREF_TRIEI       ------GDIEAVRVADRMLFVQTAIAKNRETQRQSGRALLMVASSTWQDERLKT------
UREF1_PSESM      --------VSALTNLDAQIEALTLAKELRQGSRRVGQALLGVHVALGTPGAAAY------
UREF_MYCTU       ------------DDADRETDARTPAPAARHASRSQGRGLIRLARRVWPDSGWEELG----
                                                    *  :                     

UREF_HELPY       --FFNAYAQKTKDPTHATSYGVFAASLGIELKKALRHYLYAQTSNMVINCVKSVPLSQND
UREF_HELPJ       --FFNAYAQTTKDPTHATSYGVFAASLNMELKKALRHYLYAQTSNMVINCVKSVPLSQND
UREF_UREPA       --YAERIKNKKSYGNPAVAFALLAMHLKIDLKTALYTHLYSTVAALTQNCVRAIPLGQVK
UREF_UREP2       --YAERIKNKKSYGNPAVAFALLAMHLKIDLKTALYTHLYSTVAALTQNCVRAIPLGQVK
UREF_LACP7       --YVDRIAKGVSYGHPAIAFALISHSLSIPKNTTVMSYLFSSNANLVQNAVRGIPLGQTQ
UREF_GEOKA       ----DEIVQTTRSIHPAIVFAAVGRKIGAAKQTTVLTYLFASVQTMVQNAVRGIPLGQTD
UREF_STAAB       --YHQQMQDKKAKLNPAICFTMLGHYLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAR       --YHQQMQDKKAKLNPAICFTMLGHYLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAC       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAA8       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAS       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAE       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAT       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAW       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAA3       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAA2       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAN       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAA1       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAAM       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAA9       --YHQQMQDKKAKLNPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_STAES       --YYNQMKNNKIKLHPAVCFTMLGHFLGVDVESIIDYYLYQNISSLTQNAVRAIPLGQTA
UREF_STAEQ       --YYNQMKNNKIKLHPAVCFTMLGHFLGVDVESIIDYYLYQNISSLTQNAVRAIPLGQTA
UREF_STAS1       --YHAQMKDKKASLHPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTA
UREF_PAEAT       --YRGLVRAGSASGHQPLAFGVIARSLGVPLEEALSAYLFATVTSLTQNAVRAIPLGQNA
UREF_ARTS2       --YRALVGAGRAAGHQPLAFAVVARSLGVPLTESLAAYLFAAVTSLTQNAVRAIPLGQNA
UREF_COREF       --YRREVDQRTLSGHPAIVWALVARALDVAEDEAVAQHLYATSMSLIHNAVRAVPFGQNA
UREF_CORGL       --YLELIQHRELSGHPALALALATHSAGIDVDRAIHAHLTATVSSLIQNAVRGIPLGQMA
UREF_CORGB       --YLELIKNRELSGHPALALALATHSMGIDVDRAIHAHLTATVSSLIQNAVRGIPLGQMA
UREF_PSEHT       ALPQD--------PGYVTVFAWLAQQRQIPVRQSLLGFVWGWLENQLAVACKAMPLGHTA
UREF_PSYCK       ELPEE--------PGYVTVFAWTAHQRQVPVRQALLGFAWGWLENQLAAACKALPLGHTA
UREF_MARHV       LIPAE--------PGYITLFAWAAQVRRVPVRQTLLGFAWAWLENQLAVACKALPLGHTA
UREF_CHRSD       AMPET--------PGYVVVFALAARVRGVSREDAMLGFAWAWLENQLTVACKALPLGQTS
UREF_HAHCH       WLERP--------ASLLTLWTLACAHWDIDAESAALGFLWSWLENQIAVAGKTLPLAQTA
UREF_SACD2       AEVEK--------PAFATLFALAGVHWQVPIEQLLQGFAWTWLENQVAAATKLVPFGQTQ
UREF_ALKEH       WVDDPI-------AGWPTLYALAVARWAIPLETAAEAYLWAWCENQVSAAIKLVPLGQTA
UREF_MARMS       LD---E-------MSFVTLFAIAANHWGLQVDLACLGFAWSWLENQIAAATKLVPLGQTQ
UREF_PSYIN       LLNEPE-------LSFVSVFAISAYLCELDLTAAQSGFCWTYIDNQVAAATKLVPLGQTQ
UREF_SHEHH       TTM--------VKTSQLAAFALGINQWQIPLDKALGGYLWSWLENAVVVGIKLVPLGQSA
UREF_ALIF1       LPM--------VKQTQVAAFALAANHWNLTPTKLAAAYAWGWLENAVIVGIKLVPLGQSA
UREF_ALCBS       LQQPEWRDA--LAQTQLAGFALASARWGIELQQALNGYLWSWLENMVIVAVKLIPLGQSD
UREF_BLOFL       WAVA-------FKCSGLASMAWLGYEWNIPIKNLALGYAYNALESSIMVGLKLLPFGQRT
UREF_BLOPB       WLSA-------LEHSGLASIAWLGYTWSISLENLALGYAYNMLESATMAGLKLVPFGQIT
UREF_CITK8       WRPL-------FANSQLCGMAWLGVRWRIPLTDLALSLGYSWLESAVMAGVKLVPFGQQA
UREF_ENT38       WLPL-------FSQSQLCGMAWLGVRWEISAHELALSLGYSWIESAVMAGVKLVPFGQQA
UREF_ECO57       WRKL-------CQQSQLTGMAWLGVRWQISVSDLALSLGYSWIESAVMAGVRLVPYGQLA
UREF_KLEP7       WRSL-------CQQSQLAGMAWLGVRWRIALPEMALSLGYSWIESAVMAGVKLVPFGQQA
UREF_PSEP1       WRAS-------LELTQLGGMAWLAAHWAIPLRQLALGHGFAWLEGAVMAGVKLVPFGQQA
UREF_PSEPK       WRAS-------LELTQLGGMAWLAAHWAIPLRQLALGHGFAWLEGAVMAGVKLVPFGQQA
UREF_PSEPG       WRAS-------LELSQLGGMAWLAAHWAIPLRQLALGHGFAWLEGAVMAGVKLVPFGQQA
UREF_PSEPW       WRPS-------LELSQLGGMAWLAVHWSIPLRQLALGHAFAWLEGAVMAGVKLVPFGQQA
UREF_PSEE4       WRNG-------LELSQLGGMAWLGAHWAIPLRDLALGHGFAWLEGAVMAGVKLVPFGQQA
UREF2_OCHA4      FASEQ-------RATYPAAFSIAACHWNIEPVDALRGLMWSVVESQIMAAIRLVPLGHTA
UREF_PSEAE       WLARQDPP------NLAAAWAMAARAWRLDAEEALSAWFWSWLENQLAVLMKTLPLGQLA
UREF_PSEAB       WLARQDPP------NLAAAWAMAARAWRLDAEEALSAWFWSWLENQLAVLMKTLPLGQLA
UREF_PSEA7       WLARQDPP------NLAAAWAMAARAWRLDAEEALSAWFWNWLENQLAVLMKTLPLGQLA
UREF_PSEMY       LLASHHEP------GLALAWALAARAWQITPDDALAAWLWGWLENQLAVLMKVLPLGQQA
UREF2_PSESM      FLEQTTEP------HLALGWALAARTWRISPQDALAAWLWSWLENQLAVLMKTLPLGQQA
UREF_NITOC       QLLGFVEP------PLPLVWAVAARTWNLDTRSAVAAWLWGWLENQLAALMKALPLGQQA
UREF_JANMA       LLQAQTEV------PLPTALAYAAVTLKVPAEAALLGMLFSWAENQVLVCVKSVPLGQVA
UREF_NITMU       ILENQQAI------PLPTAFACAAEALGIPHEESLLGMLFSMAENQVLACVKSVPLGQLS
UREF_POLSJ       ACAQMQP-------TYPVAFALAASQTAAGVRDCLLAYAFGWAENAMQAALKSVPLGQSA
UREF_RHOFT       LLANLQP-------TYPLAFALAASATQAPLRDCLLAYAFGWAENMVQAAIKSVPLGQSA
UREF_ACIAC       RLAALPP-------TYPVAFALAAARTQARAEDVLLACAFGWAENMVQAAIKAVPLGQSA
UREF_METPP       RLLALPPAP-----SYPVAFALAAAGTPASLREVALAYAFGWAENMVQAAIKAVPLGQSA
UREF_BORBR       AVAALRPA------TLPAVHACACAMWALPREAGLGAYVFSWLENQVAAAIKGVPLGQMA
UREF_BORPA       AVAALRPA------TLPAVHACACAMWALPREAGLGAYVFSWLENQVAAAIKGVPLGQMA
UREF_CUPNH       TLAALSPV------CLPTAFTAACVALQVEARDGLAAYCFNWAENQVAAAIKAVPLGQVA
UREF_CUPPJ       HLAVISPV------CLPTAFAATCVALEIDEREGLAAYCFNWAENQVAAAIKAVPLGQVA
UREF_CUPMC       LLRDMRPV------CLPTAFSSACVALGIAAREGLAAYLFNWAENQVAAAIKAVPLGQVA
UREF_RALSO       ALAARAAI------TFPTAFAAAAVALGIEARDGLTAYSFAWVENQVAAAVKAIPLGQAA
UREF_DELAS       RIAQLGALVEGAGLAYPTAFACACAAVDADEDHALLAYGFAWLENQVAAAIKAVPLGQVA
UREF_POLAQ       -LSAIKPL------SLLTAHSYASFYLNIQAKNGLAAYAFSWIENQVAASLKAIPLGQVA
UREF_BURA4       TLATISPI------ALPTAFTYAAAAHDASADAVLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURCM       TLATISPI------ALPTAFAYAAAAHDASADAVLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURVG       TLAALKPI------ALPTAFAYAAAAHDAGADATLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURL3       TLAAMTPI------ALPTAFAYAAAAHDASADAVLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURCA       TLASLSPI------ALPTAFAYAAAAHDAGADATLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURCH       TLASLSPI------ALPTAFAYAAAAHDAGADATLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURCC       TLASLSPI------ALPTAFAYAAAAHDAGADATLAAYAFGWVENQTSAALKAVPLGQLA
UREF_BURM1       TLASLQPI------ALPTAFAYAAAAHDAGADAVLAAYAFGWVENQTAAALKAVPLGQLA
UREF_BURPS       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_BURP0       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_BURP1       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_BURP6       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_BURMA       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_BURM7       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_BURMS       TLASIPSV------ALPSAFAFAAAAHGATPDAALAAYAFGWVENQTAAAIKAVPLGQLA
UREF_PARXL       TLASMTPL------AQPTAFAFAAYAHDAAVDATLAAYAFSWVENQAAAALKAVPLGQLA
UREF_AZOSB       RLVALDTP------AFPVAWTAAAAAWRIPADQALSAYLWAWLENQVMAAVKAVPLGQSA
UREF_DECAR       LVETQAEV------AFPTVWSGIAAAWQIEPEAAVTAYLWSWAENQVMAALKAVPLGQAS
UREF_METFK       MLEALPNA------SFPALYAGISQAWEIEEQDALQAYAWSWLENQASAAMKAVPLGQVA
UREF_NOSS1       ILPLANAVG--NPCNYAIAFGIASAHWQINIQAALLAYLHSWATNLITAGVKLIPLGQTA
UREF_TRIV2       ILSLANSVG--NPCNYAIAFAIASAHWQVNIQAALLAYLHSWATNLITAGVKLIPLGQTA
UREF_ACAM1       LIEVWEQLQ--TGCNFAIAFGLTANLWQIPLESATLGYLHSWATNLISAGIKLIPLGQTT
UREF_MICAN       --PARDNLP--EQANYATAFAIGASHWQIGEELAVLGYLHSWASNLINAGLRLIPLGQTL
UREF_SYNY3       VQSWFEPIPPTEPCNYAIAFGLGAAFWGIDLHQSGLGYLHSWANNLISAGLRLIPLGQTA
UREF_SYNP2       LGACREQIG--KSCHYAIAFGIAIALWDIESHQAVLGYLHSWLSNLVSAGVKLIPLGQTQ
UREF_THEEB       RLPPALQTGQPYPWNVSVAFCIAANLADIPLETALLGYLHSWATTLINAAVKLIPLGQTA
UREF_RHIEC       -----VFERLPGKTAYPIAVGAVAGAHGIGPEKVLAVFLHAYASQAVSSGIRLGVAGQKD
UREF_RHIL3       -----VFRRLPDKVAYPIAVGAVTGAHGIRPEKALAAFLHAYVSQAVSSGIRLGVAGQRD
UREF_AGRFC       -----VLELLPKEAPYPVAIGAVAAGHGVPLRETLAAFLHAGVSQIVSAGIRLGVAGQKD
UREF_RHIME       -----SLEFPGARAAYPVAVGAVAGAHRTGLEAALAAFLNATISNAVSVAIRCGVTGQRD
UREF_SINMW       -----SLAVLGTKAAYPVSVGAVAGAHRTGLKPALAAFLNATVSNAVSVAIRCGITGQRD
UREF1_BRUAB      -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF1_BRUA2      -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF2_BRUME      -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF_BRUO2       -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF1_BRUC2      -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF1_BRUSU      -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF1_BRUSI      -----IFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSG
UREF1_OCHA4      -----VFDRLPADCPYPVAVGAVAGANKVSLGLTLAAFLQAFCINLLQASIRLSVMGQNG
UREF_RHILO       -----VLARLPAECAYCVTVGAIAGGNGIALQDALSAFLQAFFSNLVQAAIRLGVVGQSE
UREF_CHESB       -----TCGRLPSPCPYPVAFGALAGACGISPEAMLLAYLTAYVQAQISVAIRLVPVGQTQ
UREF_AZOC5       -----AAAHLPPDVAYPVAVGYAAALHGVPRAAVLEAYLFAVTQTLVSAALRIAPIGQTA
UREF_XANP2       -----AAAALVGEVAYPVAVGLAAGVHGLPLAPTLEAFLLATVQNLVSAAVRLAPIGQTA
UREF_METEP       -----VADRLNAEVAYPVAVGAAAGAHGVARAATVAAYGLAFVQNLVSAALRVAPVGQSA
UREF_METPB       -----VAARLEGRLAYPIAVGAAAGAHGVAREATVAAYGLAFVQNLVSAALRVAPVGQSA
UREF_METRJ       -----LAEELPGPVAYPVAVGLAAGAHGMAPEPVLAAYGLAFLQNLVSAALRAAPVGQAA
UREF_METS4       -----LATRLPGPVAYPVAVGLAAGAHRIARRSLVTGYLSAFLQNQVSAALRLAPVGQSA
UREF_BRASB       -----AVSQCEA-MVYPVAVGVVGAAHGIQSSLLLHAYLHAVTSNWISAGSRLIPLGQTD
UREF_BRASO       -----AVAQCDV-VVYPVAVGMVGALHGVPLEPLLHGFLHALVSNWISAGSRLVPLGQTD
UREF_BRADU       -----MVAACRTPLVYPVAVGVVAAMHGVPLAPTLHAFLHAVVSNWISAASRLIPLGQTD
UREF_RHOPS       -----AVDACAGALAYPVAVGLVSATHGVPLAATLHAFLHAVVSNWISAGARLVPLGQTD
UREF_RHOP2       -----AVGACNGALAYPVAVGLVSATHRVPLAATLHAFLHAVVSNWISAGARLVPLGQTD
UREF_RHOPA       -----AVAACGEAIAYPVAVGVVSASHGVSLPATLHGFLHAVTSNWISAGARLIPLGQTD
UREF_RHOPB       -----AVADCAGLTAYPVAVGIVSAAHGVPLAATLHGFLHAVVSNWISAGARLIPLGQTD
UREF_RHOP5       -----AIAACGGAMAYPVAVGIVSAAHEVPLAAVLHAFLHALVSNWISAAARLVPLGQTD
UREF_RHOS4       ----------LPPRPLPVALGQAAAPLGLPVAEVLALMLHAFAANLVSAAVRFVPLGQTE
UREF_RHOS1       ----------LPPRPLPVALGQAAAPLGLPVAEVLALMLHAFAANLVSAAVRFVPLGQTE
UREF_RHOS5       ----------LPPRPLPVAIGQAAAALGRPVTEVLELTLHAFAANLVSAAVRFVPLGQTE
UREF_DINSH       ----------LRPMPYPVAVGARARALGLPVGEVVALYLQAFLGNLISGAVRLIPLGQTE
UREF_JANSC       ----------GVARAYPVALGAAAARLDLAADVVAALYLQSVVGNLVSAAVRFVPLGQAE
UREF_PARDP       ----------QSAAALPVAVGRACGCLPLPAGEIIGLYLQAQAAALISAAVRFLPLGPVE
UREF_ROSDO       ----------LGQLCYPVAVGRAACAQGLPLDLTLEIYTHAFAANLVSAAVRLVPLGQTE
UREF_RUEST       ----------LPSLTYPVAVGHAARLNDVALDLTLNMYLHAFLSNLVAAGQRLLSLGQTE
UREF_RUEPO       ----------LAGLCYPVAVGRAANLVGLPLTLSGQFYLHAFMANLVTAATRLVPLGQTE
UREF_GRABC       -----FCARHDESIVHPVAFGVASCWQGIPLRAALFGYLSAFAANLVSAGVRLIPLGQTD
UREF_MAGMM       -----WGDGLAEHAPYGVVTGLACAAHGVPEAMGLSALLHGMVAGWISAAVRLIPLGQQA
UREF_YERPE       --WLEQIKNGNTAGTYPVTQAVVMAAQGIGQREVVVMHQYGVAMTILSAAMRLMRVTHFD
UREF_YERPS       --WLEQIKNGNTAGTYPVTQAVVMAAQGIGQREVVVMHQYGVAMTILSAAMRLMRVTHFD
UREF2_BRUA2      --WLECIKTAETPGTHPVSLGLAFAALDVDGRDAFGAQQYGVATTILGAALRLMRVSFMD
UREF2_BRUC2      --WLECIKTAETPGTHPVSLGLAFAALDVDGRDAFGAQQYGVATTILGAALRLMRVSFMD
UREF2_BRUSU      --WLECIKTAETPGTHPVSLGLAFAALDVDGRDAFGAQQYGVATTILGAALRLMRVSFMD
UREF2_BRUAB      --WLECIKTAETPGTHPVSLGLAFAALDVDGRDAFGAQQYGVATTILGAALRLMRVSFMD
UREF2_BRUSI      --WLECIKTAETPGTHPVSLGLAFVALDVDGRDAFGAQQYGVATTILGAALRLMRVSFMD
UREF1_BRUME      --WLECIKTAETPGTHPVSLGLAFAALDVDGRDAFGAQQYGVATTILGAALRLMRVSFMD
UREF_HAEIN       --YQQAIAEKRVQGYFPIVFAMVAQAMGLSKADTLYAFYYNAAVGVITNGVKLIPLSQMD
UREF_TRIEI       --LNIDAVSGNIHCLHPVIFGAVTSVVGLDERNAVLAFLHGLVTNILGAAIRLGILGHIQ
UREF1_PSESM      ---QQQVRAGNTPGHLPVLQGLLWNRLGMHREHCQLAAAHGLCTGLVSAAVRLGVMGHID
UREF_MYCTU       -----------PRPHLAVVAGRVGALSGLAPEHNALHLVYITMTGSAIAAQRLLALDPAE
                                                                    :        

UREF_HELPY       GQKILLSLQS-PFNQLIEKTLELD----ESHLCTASVQNDIKAMQHESLYSRLYMS
UREF_HELPJ       GQKILLSLQS-PFNQLIEKTLELD----ESHLCAASVQNDIKAMQHESLYSRLYMS
UREF_UREPA       GQKIIYQLKHVYFDDIVNKVFTLDF---KTDFCKNIPGLEIAQMEHEDTPVRLFMS
UREF_UREP2       GQKIIYQLKHVYFDDIVNKVFTLDF---KTDFCKNIPGLEIAQMEHEDTPVRLFMS
UREF_LACP7       GQQLIKESQD-FIADAWNLIETLT----EDDFGITASGIEISQMRHEVLHIRIFMS
UREF_GEOKA       GQKLLVMAQP-YLIHAASIIETLD----EEELGAAAVGLEIAQMQHERLPVRLFMS
UREF_STAAB       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAR       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAC       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAA8       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAS       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAE       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAT       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAW       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAA3       GQKIVTHMIP-YIEGTRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAA2       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAN       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAA1       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAAM       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAA9       GQKIVTHMIP-YIEETRKQIFELK----EADFGMTAPGLELNQMAHENVNVRIFIS
UREF_STAES       GQQVVTEMIA-HIEKTRNHILELD----EIDFGMTAPGLELNQMEHENVHVRIFIS
UREF_STAEQ       GQQVVTEMIA-HIEKTRHHILELD----EIDFGMTAPGLELNQMEHENVHVRIFIS
UREF_STAS1       GQRIVHKMIP-IMKETRDHIMTIP----ASQLGITAPGLEINQMEHENVNVRIFIS
UREF_PAEAT       GQRVLRQAHD-AVAAAIHVVAQLC----WDDFGAVSPGLEISQMRHERQRARMFMS
UREF_ARTS2       GQRLLRKASD-DVAAAVERIGRLA----PDDFGAVSPGLEISQMRHERQRARMFMS
UREF_COREF       GQHLIRQAQE-WVTAAVGNSADIE----FDDIGSITPGLEIAQMQHENQRARMFMS
UREF_CORGL       GQRVMFAMRE-HIGAAVKRSANLD----EIDFCSGDPGLDISQMVHETQRARLFMS
UREF_CORGB       GQRVMFAMRE-HIGAAVKRSAMLD----AIDFCSGDPGLDISQMVHETQRARLFMS
UREF_PSEHT       AQRLIEQLRP-KMVIAIDTALALA----DDQLGPIMPGLALGSAQHETQYSRLFRS
UREF_PSYCK       AQRLNETLRP-QLVAAVDKALTLT----DEQLGPILPGLALGSAQHETQYSRLFRS
UREF_MARHV       AQRIIEQLRP-ALVNATDQALARQ----DHELGPILPGLALGSALHETQYSRLFRS
UREF_CHRSD       AQRLVERLRP-ALVAAVSEALALD----DDDLGPALPGLALASALHETQYSRLFRS
UREF_HAHCH       AQRILQRLMP-VLTETVAAATQIK----EEDFGASLPGWAMACANHETQYSRLFRS
UREF_SACD2       AQKVILALQP-NIAPACEKAFILK----DDELGAGLPALAIASAKHERQYSRLFRS
UREF_ALKEH       GQRLLLEMAE-PVGEAARQGLALE----DEEMGGGLPGVALASSLHETQYSRLFRS
UREF_MARMS       AQELLGELQT-DIRHAIAMSLNIE----EERVGAGLPAIAIASALHETQYSRLFRS
UREF_PSYIN       AQNLLFDLSA-EVDHLLTIANQLK----DHEIGGSLPRLAMASAWHETQYTRLFRS
UREF_SHEHH       GQQLLMSLAE-NIPAAVEKALLIT----DQEVGSFTPAQVMASCRHEHQYTRLFRS
UREF_ALIF1       GQQLLLEMAD-VIPQAVEKSQHWP----EHLIGSFTPAQVLASSRHESQYTRLFRS
UREF_ALCBS       GQRELYRFSD-QLAAITQHALAMD----DDDIGSSSPAMAIASCLHETQYCRLFRS
UREF_BLOFL       AQKLLRYLVE-FLPNAWDKADLVK----DHEVGGNFLLQSIASACHEDQYSRLFSS
UREF_BLOPB       AQRLLRSLME-RLPNDWKKSDMIA----DHELGNGFLLQSIASSCHETQYSRLFRS
UREF_CITK8       AQQLILSLCD-HYAQGMAQALARP----DADLGSSTPLAAIASARHETQYCRLFRS
UREF_ENT38       AQRLIIELSD-HFAAGLEHAWRRG----DDELGAATPLSAIASARHETQYSRLFRS
UREF_ECO57       AQQLIMRLCA-RYAANMDSALATP----DHAIGSATPLASIASARHETQYSRLFRS
UREF_KLEP7       AQQLILRLCD-HYAAEMPRALATP----DGDIGSATPLAAIASARHETQYSRLFRS
UREF_PSEP1       AQTLLRDLGA-DLPAALDQALALG----DDQLGGGLPLLAIASSRHETQYTRLFRS
UREF_PSEPK       AQTLLRDLGA-DLPAALDQALALG----DDQLGGGLPLLAIASSRHETQYTRLFRS
UREF_PSEPG       AQTLLRDLGN-ELPAALDQALGLG----DDQLGGGLPLLAIASSRHETQYTRLFRS
UREF_PSEPW       AQTLLRDLGE-ILPGVIDQALALG----DDQLGGGLPLLAIASSRHETQYTRLFRS
UREF_PSEE4       AQTLLRDLGE-ELPAVLDHALVLD----DEQLGGGLPLLAIASSRHETQYTRLFRS
UREF2_OCHA4      GQRILIAGAA-KIERAVEKARTLN----DDEIGNTAPALAMASAWHETQYSRLFRS
UREF_PSEAE       AQKLASSLLP-ELDRACAEALRR-----PAVEGSAAFGLALASMTHETQYSRLFRS
UREF_PSEAB       AQKLASSLLP-ELDRACAEALRR-----PAVEGSAAFGLALASMTHETQYSRLFRS
UREF_PSEA7       AQKLASSLLP-DLDRACAEALRR-----PAVEGSAAFGLALASMTHETQYSRLFRS
UREF_PSEMY       AQRLTSRLLP-TLEAAQQQAASLS----PEHWGSAAFGLALASMAHERQYSRLFRS
UREF2_PSESM      AQRLTSELLP-LLQQAQVNASAQD----THPAGSAAFGLALASMAHERQYSRLFRS
UREF_NITOC       AQRLLSQLLP-ELDEALETALACS----DEQLANGTLGLSIASMIHETQYTRLFRS
UREF_JANMA       GQRLLLSLQA-ELEVAAQVAQQLP----DEELSNWSPGLSLLSMQHEVQYSRLYRS
UREF_NITMU       GQRLLLSLHP-VIEACSIRASQLT----DDELSSWAPGLSLLSMQHEVQYSRIYRS
UREF_POLSJ       GQRMLARLAS-DIPTAVEAAISLP----DDERQAFSPMLAILSSQHETQYSRLFRS
UREF_RHOFT       GQRILQALAA-QIPCAVDHALTLP----DDARQAFSPMLAILSARHEVQYSRLFRS
UREF_ACIAC       GQRILARLAA-AIPGAVAHAMQLG----EAERQAFSPMLAVLSARHETQYSRLFRS
UREF_METPP       GQRMLGALVE-AIPATVDAALVLR----DGERMAFTPMLAVLSARHETQYSRLFRS
UREF_BORBR       GQRMLERLRA-GLPAVLADARARAGAT-PPRLDTFAPQYAMVSARHETQFSRLFRS
UREF_BORPA       GQRMLERLRA-GLPAVLADARARAGAT-PPRLDTFAPQYALVSARHETQFSRLFRS
UREF_CUPNH       GQHMLRRLHC-AVLDTVDEATRRADAT-PPQLSTFSPMLGLLSARHETQYSRLFRS
UREF_CUPPJ       GQHMLRRLHE-AVLMTVDEAVQRAAET-PPRLSTFSPMLGLLSSRHETQYSRLFRS
UREF_CUPMC       GQQMLLGLHQ-AVLGTVDEAVCRADAV-PPLLSTFSPMLGVLSARHETQYSRLFRS
UREF_RALSO       GQRILFGLHA-AVGQAAEDAARRAACH-PPELSTFSPGLGVLSARHETQYSRLFRS
UREF_DELAS       GQSLLLALHP-LLEQAVCEARRRASEA-PPRLDTMLPQWSVLQARHEHQYSRLFRS
UREF_POLAQ       GQQALTKIRL-LVPEMVHEAEQRANSG-LSMVDNFSPMLAILSSRHETQYSRLFRS
UREF_BURA4       GQRIIVALRG-AIDAAVRRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURCM       GQRIIVALRG-AIDAAVRRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURVG       GQRIIVALRG-AIDAAVKRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURL3       GQRIIVALRG-AIDAAVRRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURCA       GQRIIVALRG-AIDAAVRRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURCH       GQRIIVALRG-AIDAAVRRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURCC       GQRIIVALRG-AIDAAVRRALATP----PDAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURM1       GQRIIVALRD-AIDAAVRRALATP----ADAVNTFAPQLGILSARHETQYSRLFRS
UREF_BURPS       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_BURP0       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_BURP1       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_BURP6       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_BURMA       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_BURM7       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_BURMS       GQKIIVALRE-PIRDAVRRALATP----PEAINTFAPQLGILSARHESQYSRLFRS
UREF_PARXL       GQRIIVALRE-PIDAAVTRALATS----PDNINTFAPQLGILSARHESQYSRLFRS
UREF_AZOSB       GQRLLADLGA-AVPALVEAAQCLP----EAEWSNFTPGLAIASSRHETQYTRLFRS
UREF_DECAR       GQRLLAELGS-RIPEAAANANTLP----KSRWSNFTPAFAIACARHETQYSRLFRS
UREF_METFK       GQKILLGVAG-KIPVLVEAAIQMQ----DHEISNFCPALTIAGCRHETQYSRLFRS
UREF_NOSS1       GQELLLQLQP-LISHATVEIMSLK----DDELSCCSWGLSLASMQHETQYTRLFRS
UREF_TRIV2       GQELLLQLQP-LISHATVEIMSLK----DDELSCCSWGLSLASMQHETQYTRLFRS
UREF_ACAM1       GQQLLFQLQP-HIEAATQSILLLE----DKDLCSCGWGLALASMAHETQYSRLFRS
UREF_MICAN       GQSLLIGLQP-SLLTATADIISLA----DENLSSWSWGLSFASMNHETQYSRLFRS
UREF_SYNY3       GQKLLLHLTP-TILHQWQQILLLG----DDDLYSCSWGLALASMGHESQYTRLFRS
UREF_SYNP2       GQRIIYQLQP-LIIETVETVVTQK----EMDLYACTWGLSLASMNHETQYTRLFRS
UREF_THEEB       GQLLLRQLQP-QIQQTVQQSLNVT----DDNLESCTLGLALASMQHETLYCRLFRS
UREF_RHIEC       GVAVLAGLEE-QIAGTARRAAAST----LDDLGSATVQADIASLRHETQTTRLFRS
UREF_RHIL3       GVAILAGLED-HITEVARRAAAST----LDDLGSATVQADIASLRHETQATRLFRS
UREF_AGRFC       GVAILAASEA-VIEEIAARAALST----LDDLGSATVIADTAAMRHETQGTRLFRS
UREF_RHIME       GVGMLARMEK-TIGAVATRATRAS----LDDLGAATIIADIASLRHEILHSRLFRT
UREF_SINMW       GVGVLARVED-TIGAVVARAAAAS----LEDLGGATFIAEIASLKHENLHSRLFRS
UREF1_BRUAB      VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF1_BRUA2      VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF2_BRUME      VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF_BRUO2       VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF1_BRUC2      VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF1_BRUSU      VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF1_BRUSI      VTAIMAALEP-VLGETAARAALSS----MEDLGSATFIADIMAMKHETQHSRLFRS
UREF1_OCHA4      VTATMSDLEP-VLAETATRIEKTS----LSDLGSATYISDIMAMKHETQHSRLFRT
UREF_RHILO       ATTLLAGFEP-LALSTADRASRST----LDDLGGCAFVSDVVAMKHETQYSRLFRS
UREF_CHESB       GLTILAALEP-LVAEKAKELSRAT----LDDLGSVAYAADIAAMAHETLSTRIFRS
UREF_AZOC5       GTRVVARLMP-AVQALAGDIPTLT----LDDLGTATFRADLGSMRHETQYTRLFRS
UREF_XANP2       GTRVVARLAP-GVRALALEIPTLT----LDDLGSATFRADLGSFRHETQYTRLFRS
UREF_METEP       GTTILAALTP-RVAALAEALHEAG----LDALGSATLRLDLGSFRHETQYSRIFRS
UREF_METPB       GTAVLASLTP-RVAALAETLHAAD----RDALGSATLRLDLGSFRHETQYSRIFRS
UREF_METRJ       GTRVVAALAP-RLAGLAEAAAASD----LDALGAATFRLDLGSFRHETQYSRIFRS
UREF_METS4       GTRVVAALSP-LVAALAAEAEGAP----LDALGAATLRLDLGSFRHETQYSRIFRS
UREF_BRASB       SQRVLAALEP-VVTATAVRAISAS----LDDIGSATFRADLASLRHETQYTRLFRS
UREF_BRASO       SQRVLAALEP-VVVATADRSLHAS----LDDIGSATFRADLASLRHETQYTRLFRS
UREF_BRADU       SQRVLVRLEA-AVAATATRALSAT----LDDLGSATFRADLASLRHETQYTRLFRS
UREF_RHOPS       SQRVLAALEP-AVIAAGDRAREAS----LDDLGSATFRADLASLRHETQYTRLFRS
UREF_RHOP2       SQRLLAALEP-AVIATGDRALRAS----LDDLGGATFRADLASLRHETQYTRLFRS
UREF_RHOPA       SQRVLAALEP-AVIATGSRALAAS----LDDLGTATFRADLASLRHETQYTRLFRS
UREF_RHOPB       SQRLIAALEP-AVIATGARALIAS----LDDLGGATFRADLASLQHEAQYTRLFRS
UREF_RHOP5       SQRVLAALEP-VVAPTAARALAAS----LDDLGSATFRADLASLRHESQYTRLFRS
UREF_RHOS4       GQATLAALHP-RIGEIAAESAEAP----LDALGSAALRGDLAAMRHETQEVRIFKT
UREF_RHOS1       GQATLAALHP-LIGEIAAESAEAP----LDALGSAALRGDLAAMRHETQEVRIFKT
UREF_RHOS5       GQAILSSLHP-LIEEIARESAEAP----IEAIGSAAVRGDLAAMRHETQQVRIFKT
UREF_DINSH       GQQVSQSLHP-TISTQARCLATRP----LSEIGTGAVRAELAAMAHETQEVRIFRT
UREF_JANSC       GQRIVAGMQG-AVADVAAEVVNCS----IDDIAQAAFGADLAAMEHEGLEVRIFRT
UREF_PARDP       GQAMLAGLQP-ALLAAAARAGTAD----PKDLASATWGADLAAMRHETMVTRIFRS
UREF_ROSDO       GQAVLAALAP-LIRQVARRCHDAG----IDDLTTACMALDIAAMHHETQYSKVFRT
UREF_RUEST       AQQRLNACGP-QLRRTVDAALSGT----IDDLFGASFAADIASMRHETQYSRIFRS
UREF_RUEPO       GQQIIRDLTP-LCQAIADTALCAN----LSHLTSTAFLGDIAAMKHETQYSRMFRT
UREF_GRABC       GQRAQAALLD-DLQRATDHGLNTA----LEDAGSAVPMLDLFSIRHETQYTRLFRS
UREF_MAGMM       GVLVQSALEG-EIQTLVRALLSQPASAFQAELGGCAWMAEWCSLKHETQYTRLFRS
UREF_YERPE       TQHILFELNH-DIEKFCDIAEIGD----INQMSSYVPIVDVLAAVHVKAHVRLFSN
UREF_YERPS       TQHILFELNH-DIEKFCDIAEIGD----INQMSSYVPIVDVLAAVHVKAHVRLFSN
UREF2_BRUA2      TQKILLEATS-TVAPAYEEIADAG----IEDMASFAPMVDILAAVHVKGHVRMFMN
UREF2_BRUC2      TQKILLEATS-TVAPAYEEIADAG----IEDMASFAPMVDILAAVHVKGHVRMFMN
UREF2_BRUSU      TQKILLEATS-TVAPAYEEIADAG----IEDMASFAPMVDILAAVHVKGHVRMFMN
UREF2_BRUAB      TQKILLEATS-TVAPAYEEIADAG----IEDMASFAPMVDILAAVHVKGHVRMFMN
UREF2_BRUSI      TQKILLEATS-TVAPAYEEIADAG----IEDMASFAPMVDILAAVHVKGHVRMFMN
UREF1_BRUME      TQKILLEATS-TVAPAYEEIADAG----IEDMASFAPMVDILAAVHVKGHVRMFMN
UREF_HAEIN       GQDILFDLRG-SLVQAVELSLDPD----EEWLGAATLANDIRAMQHEVLYTRLYMS
UREF_TRIEI       AQQILLQLVP-DIEAVWSTAVSMN----LEQMWSCTPFIDIAQMQHPKLAHKLFAN
UREF1_PSESM      AQRVLTDIQP-LITELLALEPPEP-----EDACGFTPMAEIAVMRHETQDLRLFAN
UREF_MYCTU       VTVVTFQLSELCEQIAQEATAGLA--------DLSDPLLDTLAQRHDERVRPLFVS
                                                              *      :: .