CLUSTAL format seed alignment for MF_01389

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UREG_YERPE       -------------------------------------------MTDKST-ARKKITRIGI
UREG_YERPS       -------------------------------------------MTDKST-ARKKITRIGI
UREG_YERE8       -------------------------------------------MNSHSTDKRKKITRIGI
UREG_PHOLL       ---------------------------------------------------MKKITRIGI
UREG2_METEP      ---------------------------------------------------MKKITRIGI
UREG2_METPB      ---------------------------------------------------MKKITRIGI
UREG2_BRUAB      ---------------------------------------------------MKKIPRIGV
UREG2_BRUA2      ---------------------------------------------------MKKIPRIGV
UREG2_BRUC2      ---------------------------------------------------MKKIPRIGV
UREG2_BRUME      ---------------------------------------------------MKKIPRIGV
UREG2_BRUO2      ---------------------------------------------------MKKIPRIGV
UREG2_BRUSU      ---------------------------------------------------MKKIPRIGV
UREG2_STRGG      -------------------------------MRHGHPPTDIHHGINQGEPMDDNVLRVGI
UREG_HALWD       -------------------------------------------------MGYRDVAKVGL
UREG_NATPD       -------------------------------------------------MGHRDVATVGL
UREG_HALMA       -----------------------------------------------MSLTHRDVATVGI
UREG_CENSY       ---------------------------------------------------MGRVPRVGI
UREG1_BRASB      --------------------------------------MLHALRQAKAQATATVAARVGI
UREG2_METRJ      ----------------------------------------------MTDVTPANAARIGI
UREG2_BRASB      ----------------------------------------MSRLALTRADEPMTAARVGI
UREG_MYCGI       ---------------------------------------------------MIEAIRIGI
UREG_MYCTU       ----------MATHSHPHSHT------------------VPARPRRVRKPG--EPLRIGV
UREG_MYCBO       ----------MATHSHPHSHT------------------VPARPRRVRKPG--EPLRIGV
UREG_FRAAA       -----------------------------------------------MPLG--RAPRIGV
UREG_FRACC       ---------MHLGHEEFQRTD--------------GRASTGPADAGPAGAG--RAPRIGV
UREG_FRASN       ---------MHLEHDRPLGGGG---APAASGGAGPRWQSPPGTPAGPAPTD--RALRVGV
UREG1_SACEN      --------MLPEHHDHGHEHGGNGHGHGHRHQVNFDPTAAEPDPYGVAPRGG-RAFRLGI
UREG_STRAW       ---------MHLDHAHTHDGPS----------------AVSADAHRPDGTR--RALRIGL
UREG_STRCO       ---------MHLDH--HHESAA----------------AVSADARRPDGSR--RALRIGL
UREG1_STRGG      MTRTPTGVPMHLGH--THDAPA----------------AVSADATRPDGTR--RALRIGL
UREG2_SACEN      -MEASVHIGNSVPHAHLHSAAP----------------ARPADPVRPDGSR--RALRIGL
UREG3_STRGG      ---------MPDNASAQQPGQP----------------AQGPNEHYHQPLNQPRALRIGV
UREG_ARCB4       -----------------------------------------------------MSLKIGI
UREG_HELPY       ------------------------------------------------------MVKIGV
UREG_HELPJ       ------------------------------------------------------MVKIGV
UREG_HELHP       ------------------------------------------------------MVKIGI
UREG_HAEIN       -------------------------------------MSNTVATMINKRNIMRNYIKIGV
UREG_UREPA       ---------------------------------------------------MKRPLIIGV
UREG_CORGL       ----------------------------------------------------MGPIRIGV
UREG_BORBR       ---------------------------------------MHDISSLTTRTKTLPPLRVGV
UREG_BORPA       ---------------------------------------MHDISSLTTRTKTLPPLRVGV
UREG_BORPE       ---------------------------------------MHDISSLTTRTKALPPLRVGV
UREG_LEPCP       ---------------------------------------MSQLHAVPGRTKKLPPLRVGV
UREG_METPP       ---------------------------------------MSALHSIPHRSKKLPPLRVGV
UREG_POLSJ       ----------------------------------------MSLHHIANRTKKLPPLRVGI
UREG_RHOFT       --------------------------------------MNTPLHHIKNRTKILPPLRVGI
UREG_DELAS       ---------------------------------------------MNTRTKKLPPLRVGI
UREG_POLAQ       -----------------------------------------------MRTKKNPPLRVGI
UREG_BURPS       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURP6       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURMA       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURM9       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURP0       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURM7       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURMS       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURP1       ------------------------------------MNAPRF-AAPARRTKKLPPLRVGI
UREG_BURTA       ------------------------------------MHAPHT-ATALRRTKKLPPLRVGI
UREG_BURA4       ------------------------------------MNAPA--LSPARRTKKLPPLRVGI
UREG_BURCM       ------------------------------------MNAPA--LSPARRTKKLPPLRVGI
UREG_BURL3       ------------------------------------MNAPA--PSSARRTKKLPPLRVGI
UREG_BURVG       ------------------------------------MNAPA--SSPARRTKKLPPLRVGI
UREG_BURCA       ------------------------------------MNAPA--PSSIRRTKKLPPLRVGI
UREG_BURCH       ------------------------------------MNAPA--PSSIRRTKKLPPLRVGI
UREG_BURCC       ------------------------------------MNAPA--PSSVRRTKKLPPLRVGI
UREG_PARP8       ------------------------------------MNAPH----TMHRTKKLPPLRVGV
UREG_PARXL       ------------------------------------MNAPHHPAHSTVRTKKLPPLRVGV
UREG_CUPNH       --------------------------------------------MTQARTKKNPPLRVGV
UREG_CUPPJ       --------------------------------------------MTQARTKKNPPLRVGV
UREG_CUPMC       ----------------------------------------------MTRTKKNPPLRVGV
UREG_RALSO       -----------------------------------------------MRTKKLPALRVGV
UREG_JANMA       ----------------------------------------------MSNPSSPNPLRVGI
UREG1_METEP      ------------------------------------------------MASVNGPLRVGI
UREG1_METPB      ------------------------------------------------MASLNGPLRVGI
UREG1_METRJ      ------------------------------------------------MTSTNGPLRVGI
UREG_METS4       -----------------------------------------------MTTPHHGPLRVGI
UREG_MAGMM       ---------------------------------------------------MSNPLRVGV
UREG1_BRUME      ------------------------------------------------MTQKNGPLRVGI
UREG1_BRUSU      ------------------------------------------------MTQKNGPLRVGI
UREG1_BRUC2      ------------------------------------------------MTQKNGPLRVGI
UREG1_BRUAB      ------------------------------------------------MTQKNGPLRVGI
UREG1_BRUA2      ------------------------------------------------MTQKNGPLRVGI
UREG1_BRUO2      ------------------------------------------------MTQKNGPLRVGI
UREG_CERS4       -------------------------------------------------MS-HGPLRVGI
UREG_RHOS1       -------------------------------------------------MS-HGPLRVGI
UREG_CERS5       -------------------------------------------------MS-HGPLRVGI
UREG_PARDP       -------------------------------------------------MS-NGPLRVGI
UREG_DINSH       -------------------------------------------------MSEHGPLRIGI
UREG_JANSC       ------------------------------------------------MGSVNGPLRVGI
UREG_RHOPA       ------------------------------------------------MSDHHGPLRVGI
UREG_RHOP5       ------------------------------------------------MARYNGPLRVGI
UREG_PSE14       --------------------------------------------------MNSQPLRVGI
UREG_PSEU2       --------------------------------------------------MNSQPLRVGI
UREG_PSEF5       --------------------------------------------------MNAQPLRVGI
UREG_PSEAE       --------------------------------------------------MTSQPLRVGI
UREG_PSEU5       --------------------------------------------------MNTQPLRVGI
UREG_METFK       -------------------------------------------------MQIKEPLRVGI
UREG_ALKEH       -------------------------------------------------MKDKPALRVGI
UREG_ACIBC       -------------------------------------------------MTERSPLRVGI
UREG_ACIBT       -------------------------------------------------MTERSPLRVGI
UREG_ACIBY       -------------------------------------------------MTERSPLRVGI
UREG_CITK8       ------------------------------------------------MNDYKHPLRVGV
UREG_KLEP7       ------------------------------------------------MNSYKHPLRVGV
UREG_ENT38       ------------------------------------------------MADYKHPLRVGV
UREG_PSEPG       ------------------------------------------------MQSYQQPLRVGV
UREG_PSEPK       ------------------------------------------------MQSYQQPLRVGV
UREG_PSEP1       ------------------------------------------------MQSYQQPLRVGV
UREG_PSEPW       ------------------------------------------------MQSYQQPLRVGV
UREG_PSEE4       ------------------------------------------------MQNYQQPLRVGV
UREG_ECO57       ------------------------------------------------MNIIKQPLRVGV
UREG_ALCBS       -----------------------------------------------MTTDYKSPLRVGI
UREG_SHEHH       ----------------------------------------------MTELEYKQPLRIGV
UREG_ALIF1       ------------------------------------------------MQDYKQPLRIGV
UREG_BLOFL       ----------------------------------------------MSNDKAKHPMKVGI
UREG_BLOPB       ----------------------------------------------MLLNQYRKPLRIGV
UREG_DEIRA       ----------------------------------------------------MTPLKIGV
UREG_SYNY3       --------------------------------------------------MAQTPLRIGI
UREG_THEEB       ---------------------------------------------------METVLRVGV
UREG_PROMS       ---------------------------------------------------MSSKLRVGV
UREG_PROM0       ---------------------------------------------------MSSKLRVGV
UREG_PROM2       ---------------------------------------------------MSSKLRVGV
UREG_PROM9       ---------------------------------------------------MSSKLRVGV
UREG_PROMP       ---------------------------------------------------MSSKLRVGV
UREG_PROM1       ---------------------------------------------------MESKLRVGI
UREG_PROMT       ---------------------------------------------------MESKLRVGI
UREG_SYNS3       ---------------------------------------------------MSSKLRLGV
UREG_ANADF       --------------------MHDHSLHSGHDHGLGPGSFHDRGAPHARGDLRRRAFTVGV
UREG_CYTH3       --------------------MTLLKMYRHLDHFDSPGHFHHRELIHEKRNFKKRAFTVGI
UREG_OPITP       -----------------------------------------------MRTTTRRAPRVGI
UREG_METS5       ------------------------------------------------------MIKVGI
UREG_SULTO       ------------------------------------------------------MIRIGV
                                                                          :*:

UREG_YERPE       GGPVGSGKTAIIEVITPILIKRG-IKPLIITNDIVTTEDAKQVKRTLK---GILDEEKIL
UREG_YERPS       GGPVGSGKTAIIEVITPILIKRG-IKPLIITNDIVTTEDAKQVKRTLK---GILDEEKIL
UREG_YERE8       GGPVGSGKTAIIEVITPILIKRG-IKPLIITNDIVTTEDAKQVKRTLK---GILDEEKIL
UREG_PHOLL       GGPVGSGKTAVIEVITPILIQRG-IKPLIITNDIVTTEDAKQVKRTLK---GILDEEKIL
UREG2_METEP      GGPVGSGKTAVIETITPRLIALG-IKPLIITNDVVTTEDAKQVRRTLH---GVLIEEKIV
UREG2_METPB      GGPVGSGKTAVIETITPRLIERG-IKPLIITNDVVTTEDAKQVRRTLN---GVLIEEKIV
UREG2_BRUAB      GGPVGSGKTAIIEAVVPILIKLG-YRILVITNDIVTTEDAKHVQRTLK---GVLIEDRIV
UREG2_BRUA2      GGPVGSGKTAIIEAVVPILIKLG-YRILVITNDIVTTEDAKHVQRTLK---GVLIEDRIV
UREG2_BRUC2      GGPVGSGKTAIIEAVVPILIKLG-YRILVITNDIVTTEDAKHVQRTLK---GVLIEDRIV
UREG2_BRUME      GGPVGSGKTAIIEAVVPILIKLG-YRILVITNDIVTTEDAKHVQRTLK---GVLIEDRIV
UREG2_BRUO2      GGPVGSGKTAIIEAVVPILIKLG-YRILVITNDIVTTEDAKHVQRTLK---GVLIEDRIV
UREG2_BRUSU      GGPVGSGKMAIIEAVVPILIKLG-YRILVITNDIVTTEDAKHVQRTLK---GVLIEDRIV
UREG2_STRGG      GGPVGSGKTALIEALVPVLIERG-HRPAVITNDIYTQEDAQHVRRTLA---GVLEPERVV
UREG_HALWD       GGPVGSGKTALVQQLVPRLDDAG-YDLGVIANDIMTQEDAQRLQSSFA---GQIEKDLIA
UREG_NATPD       GGPVGSGKTAMVKRLVPRLDAAG-YNVGVIANDIMTQEDADRLRESFE---GILPPDLVE
UREG_HALMA       GGPVGSGKTSLLTALVPELRDQG-LDVGVIANDILTQEDADVLRERFA---GVVPEDLVA
UREG_CENSY       GGPVGAGKSMLIERVVPVLAARG-YHVSIVSNDVISKEDADRMRASLATERGLLPEDLVV
UREG1_BRASB      GGPVGSGKTALIEALIPVLQRRG-VDFAVVTNDLVTKEDAERLRRSGL-----IDPDRVS
UREG2_METRJ      GGPVGSGKTALIERLIPVLQARG-VDLAVITNDLVTKEDAERLRRSGL-----IDPSRVE
UREG2_BRASB      GGPVGSGKTALVERLIPALQTRG-IDIAVITNDLVTAEDAERVRRSGL-----IDPERVS
UREG_MYCGI       GGPVGSGKTRLVETLVPRLSAAG-LSVAVITNDLVTDEDAQRVRRSGV-----IDPERVL
UREG_MYCTU       GGPVGSGKTALVAALCRQLRGE--LSLAVLTNDIYTTEDADFLRTHAV-----LPDDRIA
UREG_MYCBO       GGPVGSGKTALVAALCRQLRGE--LSLAVLTNDIYTTEDADFLRTHAV-----LPDDRIA
UREG_FRAAA       GGPVGSGKTALVAALCRSLAPS--LRLGVVTNDIYTTEDADFLRRAGV-----LDPQRIR
UREG_FRACC       GGPVGSGKTALVAALCRALSSS--LRIGVVTNDIYTTEDADFLRRAGV-----LDPERIR
UREG_FRASN       GGPVGSGKTALVAALCRALAGR--IRLGVVTNDIYTTEDADFLRSAGV-----LDPGRIR
UREG1_SACEN      GGPVGSGKTALTAALCRALGSE--VNLAVVTNDIYTTEDADFLRRAGV-----LDTDRIE
UREG_STRAW       GGPVGSGKTATVAALCRALRDA--FSLAVVTNDIYTREDAEFLLREAV-----LPPERIT
UREG_STRCO       GGPVGSGKTATVAALCRALRAE--LSLAVVTNDIYTREDAEFLLREAV-----LPPERIT
UREG1_STRGG      GGPVGSGKTATVAALCRELRDR--LSIAVVTNDIYTREDADFLLKNAV-----LPPERIQ
UREG2_SACEN      GGPVGSGKTATVAALCRALRDR--LSIAVVTNDIYTREDADFLLRHAI-----LPAERIL
UREG3_STRGG      AGPVGTGKSSILATLCRELAGE--LSMAVVTNDIYTDEDARFLRSAGV-----LPTERIR
UREG_ARCB4       AGPVGSGKTSLIESLTNLLKDK--YSLGIVTNDIYTTEDANYLKKTLD-----LDNERII
UREG_HELPY       CGPVGSGKTALIEALTRHMSKD--YDMAVITNDIYTKEDAEFMCKNSV-----MPRERII
UREG_HELPJ       CGPVGSGKTALIEALTRHMSKD--YDMAVITNDIYTKEDAEFMCKNSV-----MPRDRII
UREG_HELHP       CGPVGSGKTALIESLTRKMNEQ--YSLAVITNDIYTQEDAEFMSKNSV-----LPSERII
UREG_HAEIN       AGPVGAGKTALIEKLTREIASK--YSVAVITNDIYTQEDAEFLTKNSL-----LPPERIM
UREG_UREPA       GGPVGAGKTMLIERLTRYLSTKG-YSMAAITNDIYTKEDARILLNTSV-----LPADRIA
UREG_CORGL       GGPVGAGKTQLVERITRALIDE--VSMAAITNDIYTIEDAKILAANGV-----LPEERIV
UREG_BORBR       GGPVGSGKTTLLEMVCKAMYPQ--FDLIAITNDIYTKEDQRLLTLSGA-----LPPERIL
UREG_BORPA       GGPVGSGKTTLLEMVCKAMYPQ--FDLIAITNDIYTKEDQRLLTLSGA-----LPPERIL
UREG_BORPE       GGPVGSGKTTLLEMVCKAMYPQ--FDLIAITNDIYTKEDQRLLTLSGA-----LPPERIL
UREG_LEPCP       GGPVGSGKTTLVEMLCKTMRER--WDLVVVTNDIYTKEDQRLLTVAGA-----LEPERII
UREG_METPP       GGPVGSGKTTLVEMLCKSMRER--WDLVVVTNDIYTKEDQRLLTVSGA-----LEPERIM
UREG_POLSJ       GGPVGSGKTTLLEMLCKAMKNK--YDLVAITNDIYTKEDQRLLTVSGA-----LAAERIM
UREG_RHOFT       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTESGA-----LPADRIM
UREG_DELAS       GGPVGSGKTTLLEMLCKAMRAH--YDLVVITNDIYTKEDQRLLTVAEA-----LPPERIM
UREG_POLAQ       GGPVGSGKTTLLEMLCKAMRAK--YDLVVITNDIYTKEDQRLLTVAGA-----LEPERIM
UREG_BURPS       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURP6       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURMA       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURM9       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURP0       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURM7       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURMS       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURP1       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEARIM
UREG_BURTA       GGPVGSGKTTLLEMLCKGMRER--YDLVAITNDIYTKEDQRLLTIAGA-----LPEERIM
UREG_BURA4       GGPVGSGKTTLLEMLCKAMRER--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_BURCM       GGPVGSGKTTLLEMLCKAMRER--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_BURL3       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_BURVG       GGPVGSGKTTLLEMLCKAMRDT--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_BURCA       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_BURCH       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_BURCC       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTVAGA-----LPEERIM
UREG_PARP8       GGPVGSGKTTLLEMLCKAMRDK--YDLVAITNDIYTKEDQRLLTVAGA-----LPAERIM
UREG_PARXL       GGPVGSGKTTLLEMLCKAMREQ--YDLVAITNDIYTKEDQRLLTVAGA-----LPAERIM
UREG_CUPNH       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTVSGA-----LPAERIM
UREG_CUPPJ       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTISGA-----LPAERIM
UREG_CUPMC       GGPVGSGKTTLLEMLCKAMRDR--YDLVAITNDIYTKEDQRLLTISGA-----LPAERIM
UREG_RALSO       GGPVGSGKTTLLEMLCKAMRER--YDLVAITNDIYTKEDQRLLTLSGA-----LPAERIM
UREG_JANMA       GGPVGSGKTALCEMLCKRMRDN--YDMAVITNDIYTKEDMEILLRADA-----LPAERLM
UREG1_METEP      GGPVGSGKTALMEQLCRRFRDS--YEICAITNDIYTKEDARILTVAGA-----LPEERIL
UREG1_METPB      GGPVGSGKTALMEQLCRRFRDR--YEICAITNDIYTKEDARILTVAGA-----LPEERIL
UREG1_METRJ      GGPVGSGKTALMEQLCKRFRDR--YEICAITNDIYTKEDARILTVAGA-----LPEERIL
UREG_METS4       GGPVGSGKTALMEGLCKALRGR--FDLCAITNDIYTKEDARLLTVAGA-----LPEERIM
UREG_MAGMM       GGPVGSGKTALLEWLCREMQQH--YSVAAITNDIYTKEDQRILTASGA-----LPAERIM
UREG1_BRUME      GGPVGSGKTTLTEKLCKAMRDK--YSVAVITNDIYTQEDALILARRQA-----LSEDRII
UREG1_BRUSU      GGPVGSGKTTLTEKLCKAMRDK--YSVAVITNDIYTQEDALILARRQA-----LSEDRII
UREG1_BRUC2      GGPVGSGKTTLTEKLCKAMRDK--YSVAVITNDIYTQEDALILARRQA-----LSEDRII
UREG1_BRUAB      GGPVGSGKTTLTEKLCKAMRDK--YSVAVITNDIYTQEDALILARRQA-----LSEDRII
UREG1_BRUA2      GGPVGSGKTTLTEKLCKAMRDK--YSVAVITNDIYTQEDALILARRQA-----LSEDRII
UREG1_BRUO2      GGPVGSGKTTLTEKLCKAMRDK--YSVAIITNDIYTQEDALILARRQA-----LSEDRII
UREG_CERS4       GGPVGAGKTTLTEKLCAALAHR--CSMAVITNDIYTREDAEALMRAQV-----LPAERIR
UREG_RHOS1       GGPVGAGKTTLTEKLCAALAHR--CSMAVITNDIYTREDAEALMRAQV-----LPAERIR
UREG_CERS5       GGPVGAGKTTLTEKLCAALAHR--CSMAVITNDIYTREDAEALMRAQV-----LPAERIR
UREG_PARDP       GGPVGAGKTTLTEQIARALAPR--LSMAVITNDIYTREDAEALMRAQV-----LPSERIR
UREG_DINSH       GGPVGAGKTTLTERLCAALRDD--YSVAVITNDIYTSEDAEYLMRAQA-----LPLERIR
UREG_JANSC       GGPVGAGKTTLTAELARAMGQA--YSVAVITNDIYTSEDAEFLLRAQV-----LPAERIR
UREG_RHOPA       GGPVGSGKTALMDLLCKSMRER--YDIAAITNDIYTKWDAEFLVRSGS-----LTPDRIA
UREG_RHOP5       GGPVGSGKTALMDLLCKELRER--YQIAAITNDIYTKWDAEFLVRSGS-----LTPDRIV
UREG_PSE14       GGPVGSGKTALTLALCLALRDR--YNLAVVTNDIYTREDADFLVRNEA-----LAPERII
UREG_PSEU2       GGPVGSGKTALTLALCLALRDR--YNLAVVTNDIYTREDADFLVRNEA-----LAPERII
UREG_PSEF5       GGPVGSGKTALTLALCLALRER--YNLAVVTNDIYTREDADFLVRNEA-----LAPERII
UREG_PSEAE       GGPVGSGKTALTLALCRELRER--YNLAVVTNDIYTQEDAEFLVRNEA-----LAPERII
UREG_PSEU5       GGPVGSGKTALTLALCQALRDR--YNLAVVTNDIYTQEDAQFLVRNEA-----LAPERII
UREG_METFK       GGPVGSGKTALTLALCQRLRNV--YNIAVVTNDIYTREDAEFLTRNEA-----LAPERII
UREG_ALKEH       GGPVGSGKTALVEALCKALRDH--YEIAVVTNDIYTREDAEFLTRNGA-----LPADRII
UREG_ACIBC       GGPVGSGKTALTLNLCRALRDK--YNMAVVTNDIYTKEDSNFLTRNEA-----MSPDRIV
UREG_ACIBT       GGPVGSGKTALTLNLCRALRDK--YNMAVVTNDIYTKEDSNFLTRNEA-----MSPDRIV
UREG_ACIBY       GGPVGSGKTALTLNLCRALRDK--YNMAVVTNDIYTKEDSNFLTRNEA-----MSPDRIV
UREG_CITK8       GGPVGSGKTALLEALCKAMRDT--YQLAVVTNDIYTKEDQRILTEAGA-----LAPERIV
UREG_KLEP7       GGPVGSGKTALLEALCKAMRDT--WQLAVVTNDIYTKEDQRILTEAGA-----LAPERIV
UREG_ENT38       GGPVGSGKTALLEALCKAMRDQ--YQLAVVTNDIYTKEDQRILTEAGA-----LEPDRIV
UREG_PSEPG       GGPVGSGKTALLEALCKAMRDH--YQIAVVTNDIYTKEDQRILTEAGA-----LEPERIV
UREG_PSEPK       GGPVGSGKTALLEALCKAMRDH--YQIAVVTNDIYTKEDQRILTEAGA-----LEPERIV
UREG_PSEP1       GGPVGSGKTALLEALCKAMRDH--YQIAVVTNDIYTKEDQRILTEAGA-----LEPERIV
UREG_PSEPW       GGPVGSGKTALLECLCKAMRDH--YQIAVVTNDIYTKEDQRILTEAGA-----LEPERIV
UREG_PSEE4       GGPVGSGKTALLEALCKAMRDH--YQIAVVTNDIYTKEDQRILTEAGA-----LEPERIV
UREG_ECO57       GGPVGSGKTALLEALCKSMRDT--WQLAVVTNDIYTREDQRILTEAGA-----LEAERIV
UREG_ALCBS       GGPVGSGKTALLEKLCKAMRDD--YHIAVVTNDIYTKEDQRILTEAQA-----LEPERIV
UREG_SHEHH       GGPVGSGKTALLEVLCKALRNK--YQIAVVTNDIYTQEDAKILTRAEA-----LDADRII
UREG_ALIF1       GGPVGSGKTALLEVLCKTLRDT--YQIAVVTNDIYTQEDAKILTQAEA-----LAADRII
UREG_BLOFL       GGPVGSGKTALIEVLCKKMKTD--YQLAVVTNDIYTKEDQQILINAHA-----LESDRII
UREG_BLOPB       GGPVGSGKTALLEVLCKRMKDS--YQLAVVTNDIYTKEDQRILIDANA-----LSADRIV
UREG_DEIRA       GGPVGSGKTALLEVLCRELRDR--YDLAVITNDIYTFEDQRILTRAAA-----LAPERIR
UREG_SYNY3       AGPVGSGKTALLEALCKALRQK--YQLAVVTNDIYTQEDAQFLVRAEA-----LTPDRIL
UREG_THEEB       AGPVGSGKTALVDALCKALRDR--YRLAVVTNDIYTQEDAQFLVRSQA-----LPPERIL
UREG_PROMS       AGPVGSGKTALVETLCLSMNKN--YEIAVVTNDIYTKEDANFLINKKV-----LEEGRII
UREG_PROM0       AGPVGSGKTALVETLCLSLKKN--YEIAIVTNDIFTKEDANFLINKKV-----LEEGRII
UREG_PROM2       AGPVGSGKTALLETLCLSLKKN--YEIAVVTNDIYTKEDANFLINKKV-----LEEGRII
UREG_PROM9       AGPVGSGKTALLETLCLSLKNN--YEIAVVTNDIYTKEDANFLINKKV-----LEEGRII
UREG_PROMP       AGPVGSGKTALVETLCIALKKR--YKIAVVTNDIYTKEDANFLIKKKI-----LEEGRIV
UREG_PROM1       AGPVGSGKTAIIQRLCENLKDR--LEIAVVTNDIYTQEDAKFLTNSKA-----LAPERIK
UREG_PROMT       AGPVGSGKTAIIQRLCENLKDR--LEIAVVTNDIYTQEDAKFLTNSKA-----LAPERIK
UREG_SYNS3       AGPVGSGKTALVQALCRRLRDR--LQLAVVTNDIYTQEDAQFLTRSGA-----LEPERIR
UREG_ANADF       GGPVGSGKTALVLALCRALRDS--RSLGVVTNDIFTREDAEFLVRNDA-----LPAERIR
UREG_CYTH3       GGPVGTGKTAWLMQICKALRDK--MNIAVVTNDIFTSEDAEFLIRNEA-----LSKDRII
UREG_OPITP       GGPVGSGKTMLCLKLCQRLRER--LSMAVVTNDIYCSEDAQFLIRQSA-----LPAARIA
UREG_METS5       LGPVGSGKTSLIEFLAKEYSER-GIKVGILTNDVVSAYDAMRIYHNLVERLRILPRENVL
UREG_SULTO       LGPVGSGKTTLIEFLTEYLVKKEGLSVGIITNDVISSHDALRIYQNLVLKEKLLPKENVI
                  ****:**      :              ::**:    *   :          :    : 

UREG_YERPE       GVETGACPHTAVREDPSMNIAAVEEMEERFPESDLIMIESGGDNLTLTFSPALADFYIYV
UREG_YERPS       GVETGACPHTAVREDPSMNIAAVEEMEERFPESDLIMIESGGDNLTLTFSPALADFYIYV
UREG_YERE8       GVETGACPHTAVREDPSMNIAAVEEMEERFPDSDLIMIESGGDNLTLTFSPALADFYIYV
UREG_PHOLL       GVETGACPHTAVREDPSMNIAAVEEMEARFPDSDVVLIESGGDNLTLTFSPALADFYIYV
UREG2_METEP      GVETGACPHTAVREDPSMNIAAVEELEDKYPDSDVILIESGGDNLTLTFSPALADFYIYV
UREG2_METPB      GVETGACPHTAVREDPSMNIAAVEELEDKYPDSDVILIESGGDNLTLTFSPALADFYIYV
UREG2_BRUAB      GVETGGCPHTAVREDPSMNLAAVEEMEAKFPDTDLVLLESGGDNLTLTFSPALIDFFIYV
UREG2_BRUA2      GVETGGCPHTAVREDPSMNLAAVEEMEAKFPDTDLVLLESGGDNLTLTFSPALIDFFIYV
UREG2_BRUC2      GVETGGCPHTAVREDPSMNLAAVEEMEAKFPDTDLVLLESGGDNLTLTFSPALIDFFIYV
UREG2_BRUME      GVETGGCPHTAVREDPSMNLAAVEEMEAKFPDTDLVLLESGGDNLTLTFSPALIDFFIYV
UREG2_BRUO2      GVETGGCPHTAVREDPSMNLAAVEEMEAKFPDTDLVLLESGGDNLTLTFSPALIDFFIYV
UREG2_BRUSU      GVETGGCPHTAVREDPSMNLAAVEEMEAKFPDTDLVLLESGGDNLTLTFSPALIDFFIYV
UREG2_STRGG      GVETGACPHTAVRDDPTMNLAAGAEMLERFPDTDTLLYESGGDNLTLTFSPALVDLFLFV
UREG_HALWD       GVETGACPHTGIREDPSMNLDKIDEFSESHPELDVVLIESGGDNLAATFNPELADYFIFV
UREG_NATPD       GVETGACPHTGIREDPSMNIAAIDEFTESYPDLDVVLLESGGDNLAATFNPELADYFIFV
UREG_HALMA       GVETGACPHTGIREDPSMNLQQIDSFLADHPELDLVLVESGGDNLAATFNPELADYSLYV
UREG_CENSY       GVATGGCPHTAVREDPSMNISIIEEIEAGHPELDLVIIESGGDNITTTFSPALADYFIYM
UREG1_BRASB      AVEAGACPHTVIREDPTLNIAAGDELEARFPGVELILFESGGDNLASTFSLDLVDWWIFV
UREG2_METRJ      AVEAGACPHTVIREDPTLNIAAGDALEARFPGLQLLVFESGGDNLASTFSLDLVDWWIFV
UREG2_BRASB      AVEAGACPHTVIREDPTLNIEAADELERRFPGVELILLESGGDNLASTFSRDLTDFWMFV
UREG_MYCGI       AVETGACPHTAIREDPSANLAAAERLNRRFGDLDVILIESGGDNLAATFTSDLVDYWIFV
UREG_MYCTU       AVQTGGCPHTAIRDDITANLDAIDELMAAHDALDLILVESGGDNLTATFSSGLVDAQIFV
UREG_MYCBO       AVQTGGCPHTAIRDDITANLDAIDELMAAHDALDLILVESGGDNLTATFSSGLVDAQIFV
UREG_FRAAA       AVETGCCPHTAIRDDITANLDTVEDLEADTGPLDLVLVESGGDNLTATFSYGLIDRQIFV
UREG_FRACC       AVETGCCPHTAIRDDITANLDMVEDLEADTGPLDLVLVESGGDNLTATFSYGLIDRQIFV
UREG_FRASN       AVETGCCPHTAIRDDITANLDAVEDLESDLGRLDLILVESGGDNLTATFSYGLVDRQIFV
UREG1_SACEN      AVQTGACPHTAIRDDITANLDAVEKLEERHPGLELVIVESGGDNLTAVFSRGLADSQVFV
UREG_STRAW       AVETGACPHTAIRDDISANLEAVEDLEDEVGPLDLVLVESGGDNLTATFSKGLVDAQIFV
UREG_STRCO       AVETGACPHTAIRDDISANLEAVEDLEDEVGPLDLVLVESGGDNLTATFSRGLVDAQVFV
UREG1_STRGG      AVETGACPHTAIRDDISANLEAVEDLEDAVGPLDLILVESGGDNLTATFSKGLVDAQIFV
UREG2_SACEN      AVETGACPHTAIRDDISANLEAVEQLEATVGPLDLILVESGGDNLTATFSKGLVDAQIFV
UREG3_STRGG      AVETGACPHTAIRDDVSANLDAVEDLEEAYGPLDLVLIESGGDNLTATFSPALADAQLFS
UREG_ARCB4       GVETGGCPHTAIRDDISMNQKAVVELEEKFNP-DIVFVESGGDNLSATFSYELIDYYIYV
UREG_HELPY       GVETGGCPHTAIREDASMNLEAVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFV
UREG_HELPJ       GVETGGCPHTAIREDASMNLEAVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFV
UREG_HELHP       GVETGGCPHTAIREDASMNLEAVEEMQERFPDIEILFIESGGDNLSATFSPELADFTIFV
UREG_HAEIN       GVETGGCPHTAIREDASMNLEAVDEMVTRFPDVEIVFIESGGDNLSATFSPDLADVTIFV
UREG_UREPA       GVETGGCPHTAIREDASMNFAAIEEMCDKHPDLQLLFLESGGDNLSATFSPDLVDFSIYI
UREG_CORGL       GIETGGCPHTAIREDTSMNDAAIKDLVERFPDLELIFVESGGDNLSATFSPELVDFSIYI
UREG_BORBR       GVETGGCPHTAIREDASINLIAIDQMLEQFPDADIVFVESGGDNLAATFSPELSDLTLYI
UREG_BORPA       GVETGGCPHTAIREDASINLIAIDQMLEQFPDADIVFVESGGDNLAATFSPELSDLTLYI
UREG_BORPE       GVETGGCPHTAIREDASINLIAIDQMLEQFPDADIVFVESGGDNLAATFSPELSDLTLYI
UREG_LEPCP       GVETGGCPHTAIREDASINLEAVDRMLEKFPNADIVFIESGGDNLAATFSPELSDLTIYV
UREG_METPP       GVETGGCPHTAIREDASINLEAVDRMLAKFPNADIVFIESGGDNLAATFSPELSDLTIYV
UREG_POLSJ       GVETGGCPHTAIREDASINLEAIDRMLVDFPDADVVFVESGGDNLAATFSPELSDLTIYV
UREG_RHOFT       GVETGGCPHTAIREDASINLEAIDRMLVDFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_DELAS       GVETGGCPHTAIREDASINLEAVDRMLRQFPEADIVFIESGGDNLAATFSPELSDLTIYV
UREG_POLAQ       GVETGGCPHTAIREDASINLEAVDRMQKQFPDVDIIFIESGGDNLAATFSPELSDLTIYV
UREG_BURPS       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURP6       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURMA       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURM9       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURP0       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURM7       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURMS       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURP1       GVETGGCPHTAIREDASINLEAVERMLVRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURTA       GVETGGCPHTAIREDASINLEAVERMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURA4       GVETGGCPHTAIREDASINLEAVDRMLSRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURCM       GVETGGCPHTAIREDASINLEAVDRMLSRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURL3       GVETGGCPHTAIREDASINLEAVDRMLSRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURVG       GVETGGCPHTAIREDASINLEAVDRMLSRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURCA       GVETGGCPHTAIREDASINLEAVDRMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURCH       GVETGGCPHTAIREDASINLEAVDRMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_BURCC       GVETGGCPHTAIREDASINLEAVDRMLARFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_PARP8       GVETGGCPHTAIREDASINLEAVDRMLTRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_PARXL       GVETGGCPHTAIREDASINLEAVDRMLTRFPDADIVFIESGGDNLAATFSPELSDLTIYV
UREG_CUPNH       GVETGGCPHTAIREDASINLEAVDRMLARFPDADVVFIESGGDNLAATFSPELSDLTIYV
UREG_CUPPJ       GVETGGCPHTAIREDASINLEAVERMLAKFPDADVVFIESGGDNLAATFSPELSDLTIYV
UREG_CUPMC       GVETGGCPHTAIREDASINLEAVDRMLAKFPDADVVFIESGGDNLAATFSPELSDLTIYV
UREG_RALSO       GVETGGCPHTAIREDASINLEAVDRMLARFPDADVVFIESGGDNLAATFSPELSDLTIYV
UREG_JANMA       GVETGGCPHTAIREDASINLEAIARMSADFPDLDLILVESGGDNLAATFSPELSDLTIYV
UREG1_METEP      GVETGGCPHTAIREDASINLAAVAEMRRRFPKLDLVLIESGGDNLAATFSPELADLTLYV
UREG1_METPB      GVETGGCPHTAIREDASINLAAVAEMRRRFPKLDLVLIESGGDNLAATFSPELADITLYV
UREG1_METRJ      GVETGGCPHTAIREDASINLAAVAEMSRRFPKLDLVLIESGGDNLAATFSPELADITLYV
UREG_METS4       GVETGGCPHTAIREDASINLAAVAEMRRRFPSLDLILIESGGDNLAATFSPELADLTLYV
UREG_MAGMM       GVETGGCPHTAIREDASMNLAAVEDMQLRFADLELIFIESGGDNLAATFSPELADLTLYV
UREG1_BRUME      GVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIESGGDNLAATFSPDLADLTLYV
UREG1_BRUSU      GVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIESGGDNLAATFSPDLADLTLYV
UREG1_BRUC2      GVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIESGGDNLAATFSPDLADLTLYV
UREG1_BRUAB      GVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIESGGDNLAATFSPDLADLTLYV
UREG1_BRUA2      GVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIESGGDNLAATFSPDLADLTLYV
UREG1_BRUO2      GVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIESGGDNLAATFSPDLADLTLYV
UREG_CERS4       GVETGGCPHTAIREDASINLAAVADLRRTFPDLDLILIESGGDNLAATFSPELADLTIYV
UREG_RHOS1       GVETGGCPHTAIREDASINLAAVADLRRTFPDLDLILIESGGDNLAATFSPELADLTIYV
UREG_CERS5       GVETGGCPHTAIREDASINLAAVADLRRAFPDLDLILIESGGDNLAATFSPELADLTLYV
UREG_PARDP       GVETGGCPHTAIREDASINLAAIAELNAAFPDLDLVLIESGGDNLAATFSPELADLTIYV
UREG_DINSH       GVETGGCPHTAIREDASINLAAVADLRASFADLDVILIESGGDNLAATFSPELADLTIYV
UREG_JANSC       GVETGGCPHTAIREDASINLAAIAEFRTRLPDLDVIFIESGGDNLAATFSPELADLTIYV
UREG_RHOPA       GVETGGCPHTAIREDASMNLAAVAEMRSKFPGLDLVLIESGGDNLAATFSPELADITIYV
UREG_RHOP5       GVETGGCPHTAIREDASMNLAAVADMRAKFPDLDLVLIESGGDNLAATFSPELADLTIYV
UREG_PSE14       GVETGGCPHTAIREDASINLEAVDQLNRRFEGLDLIIVESGGDNLSATFSPELSDLTIYV
UREG_PSEU2       GVETGGCPHTAIREDASINLEAVDQLNRRFEGLDLIIVESGGDNLSATFSPELSDLTIYV
UREG_PSEF5       GVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESGGDNLSATFSPELSDLTIYV
UREG_PSEAE       GVETGGCPHTAIREDASINLEAVDQLNRRFPGLELILVESGGDNLSATFSPELSDLTLYV
UREG_PSEU5       GVETGGCPHTAIREDASINLEAVEQLNRRFPGLDLIIVESGGDNLSATFSPELSDLTIYV
UREG_METFK       GVETGGCPHTAIREDASMNLEAVAQLSERFNPLDIVFVESGGDNLAATFSPELSDLTIYV
UREG_ALKEH       GVETGGCPHTAIREDASMNLAAVGDLNQRFPELEVVFIESGGDNLSATFSPELSDLTLYV
UREG_ACIBC       GVETGGCPHTAIREDASINLAAIDDLCEKFDGLELIIIESGGDNLAATFSPELSDLTLYV
UREG_ACIBT       GVETGGCPHTAIREDASINLAAIDDLCEKFDGLELIIIESGGDNLAATFSPELSDLTLYV
UREG_ACIBY       GVETGGCPHTAIREDASINLAAIDDLCEKFDGLELIIIESGGDNLAATFSPELSDLTLYV
UREG_CITK8       GVETGGCPHTAIREDASMNLAAVEALSETFGNLDLIFVESGGDNLSATFSPELADLTIYV
UREG_KLEP7       GVETGGCPHTAIREDASMNLAAVEALSEKFGNLDLIFVESGGDNLSATFSPELADLTIYV
UREG_ENT38       GVETGGCPHTAIREDASMNLAAVETLSEKFGNLDLIFVESGGDNLSATFSPELADLTIYV
UREG_PSEPG       GVETGGCPHTAIREDASMNLAAVEALARKFGNLEVIFVESGGDNLSATFSPELADLTIYV
UREG_PSEPK       GVETGGCPHTAIREDASMNLAAVEALARKFGNLEVIFVESGGDNLSATFSPELADLTIYV
UREG_PSEP1       GVETGGCPHTAIREDASMNLAAVEALARKFGNLEVIFVESGGDNLSATFSPELADLTIYV
UREG_PSEPW       GVETGGCPHTAIREDASMNLAAVEALARKFGNLEVIFVESGGDNLSATFSPELADLTIYV
UREG_PSEE4       GVETGGCPHTAIREDASMNLAAVEALAKKFGNLEVIFVESGGDNLSATFSPELADLTIYV
UREG_ECO57       GVETGGCPHTAIREDASMNLAAVEALSEKFGNLELIFVESGGDNLSATFSPELADLTIYV
UREG_ALCBS       GVETGGCPHTAIREDASMNLAAVENLARKFGNLDVVFVESGGDNLSATFSPELADLTIYV
UREG_SHEHH       GVETGGCPHTAIREDASMNLAAVEELAKRHKNLDVVFVESGGDNLSATFSPELADLTIYV
UREG_ALIF1       GVETGGCPHTAIREDASMNLAAVEELAQRHKNLDVVFVESGGDNLSATFSPELADLTIYV
UREG_BLOFL       GVETGGCPHTAIREDVSMNLLAIEELIDKFNNLDIIFIESGGDNLSATFSPELSDWNLYV
UREG_BLOPB       GVETGGCPHTAIREDASMNLLAVEELISKFNNLDIIFIESGGDNLSATFSPELSDLNLYV
UREG_DEIRA       GVQTGGCPHTAIREDSSLNQETVEALQGEFPGLELLFIESGGDNLASSFSPELVDAWLFV
UREG_SYNY3       GVETGGCPHTAIREDASLNLAAIADLEARFMPLDMVFLESGGDNLAATFSPELVDLTLYV
UREG_THEEB       GVETGGCPHTAIREDASLNLAAIQQLETAFRPLDLIFVESGGDNLAATFSPELVDLTIYV
UREG_PROMS       GVETGGCPHTAIREDCSLNKNAVLDLENKYNPLDFVFVESGGDNLASSFSPELVDLSIYV
UREG_PROM0       GVETGGCPHTAIREDCSLNKNAVLDLENKYNPLDFVFVESGGDNLASSFSPELVDLSIYV
UREG_PROM2       GVETGGCPHTAIREDCSLNKNAVLDLENKYNPLDFVFVESGGDNLASSFSPELVDLSIYV
UREG_PROM9       GVETGGCPHTAIREDCSLNKNAVLDLENRYKPLDFVFVESGGDNLASSFSPELVDLSIYV
UREG_PROMP       GVETGGCPHTAIREDCSLNKNAVMDLENKYDPLDFIFVESGGDNLAASFSPELVDLSIYV
UREG_PROM1       GVETGGCPHTAIREDCSINRIAVEELEHEFTTLDLVFVESGGDNLAASFSPELVDVCIYI
UREG_PROMT       GVETGGCPHTAIREDCSINRIAVEELEHKFTTLDLVFVESGGDNLAASFSPELVDVCIYI
UREG_SYNS3       GVETGGCPHTAIREDCSINRAAVSELEHQFPGLDLVMVESGGDNLAASFSPELVDLCIYV
UREG_ANADF       AVETGGCPHAAIREDVTANLLALEELTEAHRP-EILFCESGGDNLAAHFSRELADYTIYV
UREG_CYTH3       GVETGGCPHAAIREDVSQNMYALEELMKRFPDVELLFVESGGDNLAAHFSKELVDYSVYV
UREG_OPITP       GVETGGCPHTAIRDDTTMNEQACRALEATFPELDLLLVESGGDNLTATFSPELVDAFIYV
UREG_METS5       GLVTGGCPHTAIREDPSLNLRALETLEERANP-DLVFIESGGDNVMSTFSSSLADFTIFV
UREG_SULTO       GIVTGGCPHTAIREDPSVNLRALETLMKRTSL-DVIFIESGGDNVMSTFSPILADYTIFV
                 .: :* ***: :*:* : *      :       : :. ******:   *.  * *  :: 

UREG_YERPE       IDVAEGEKIPRKNGPGLVQADILVINKIDLAPYVGASLDVMESDTKVVRG----NRPYIL
UREG_YERPS       IDVAEGEKIPRKNGPGLVQADILVINKIDLAPYVGASLDVMESDTKVVRG----NRPYIL
UREG_YERE8       IDVAEGEKIPRKNGPGLVQADILVINKIDLAPYVGASLDVMESDTKVVRG----ERPYIL
UREG_PHOLL       IDVAEGEKIPRKNGPGLVQADILVINKIDLAPYVGASLAVMEHDTQVVRG----QRPYIL
UREG2_METEP      IDVAAGDKIPRKNGAGVCQSDILVINKKDLAPYVGASLEVMARDSKLMRG----KKPFLF
UREG2_METPB      IDVAAGDKIPRKNGAGVCQSDILVINKRDLAPYVGASLEVMARDSKIMRG----KKPFLF
UREG2_BRUAB      IDVAAGDKIPRKNGPGISQSDILVINKTDLAPYVGASLQVMDDDSRMMRG----KKPFVF
UREG2_BRUA2      IDVAAGDKIPRKNGPGISQSDILVINKTDLAPYVGASLQVMDDDSRMMRG----KKPFVF
UREG2_BRUC2      IDVAAGDKIPRKNGPGISQSDILVINKTDLAPYVGASLQVMDDDSRMMRG----KKPFVF
UREG2_BRUME      IDVAAGDKIPRKNGPGISQSDILVINKTDLAPYVGASLQVMDDDSRMMRG----KKPFVF
UREG2_BRUO2      IDVAAGDKIPRKNGPGISQSDILVINKTDLAPYVGASLQVMDDDSRMMRG----KKPFVF
UREG2_BRUSU      IDVAAGDKIPCKNGPGISQSDILVINKTDLAPYVGASLQVMDDDSRMMRG----KKPFVF
UREG2_STRGG      LDTAEGEKMPRKRGPGITESDLLVINKIDIAQYVRTDIGIMEADAHRVRD----DRPVVL
UREG_HALWD       ISVAEGDDIPRKRGPGITQADLLVINKTDLAPHVDVSLEVLQEDAMEVRG----DNPTAF
UREG_NATPD       ISVAEGDDIPRKRGPGVTQADLLVVNKTDLAPHVDADLEVMRRDAETVRG----DAPTCF
UREG_HALMA       ISVAEGEDIPRKRGPGVVDCDLLVVNKTDLAPHVGADLDVMEHDANEVR-----DGPVVF
UREG_CENSY       IDVAGGDKYPRKGGLGIESCDLLLINKTDLAGMVGADLGVMRADAERIRG----ERPFGF
UREG1_BRASB      IDVAGGDDIPRKRGPGLLRCDLLVVNKIDLAPHVGVDLDRMLADARQVRG----GKPVIA
UREG2_METRJ      IDVAGGDDIPRKRGPGVLRCDLLVINKIDLAPHVGVDLEGMLAEAARVRG----GKPVIA
UREG2_BRASB      IDVAGGDDIPRKRGPGVIRADLLVINKVDLAPHVGVDLGRMQREATEVRG----GRPVLL
UREG_MYCGI       IDTAAGDDIPRKKGIGLLQADLLVVNKIDLAALVGADLDMMRRDCAIARP----VKPTVF
UREG_MYCTU       IDVAGGDKVPRKGGPGVTYSDLLVVNKTDLAALVGADLAVMARDADAVRDG----RPTVL
UREG_MYCBO       IDVAGGDKVPRKGGPGVTYSDLLVVNKTDLAALVGADLAVMARDADAVRDG----RPTVL
UREG_FRAAA       VDVAGGDKVPRKGGPGVTLSDLLVINKTDLAPLVGADLGVMARDAAAARGP----RPVLF
UREG_FRACC       VDVAGGDKVPRKGGPGVTGSDLLVINKTDLAPLVGADLDVMARDATAARGA----RPVVF
UREG_FRASN       IDVAGGDKVPRKGGPGVAGSDLLVVNKTDLAPLVGADLAVMARDAAAMRGGRA-DRPVLF
UREG1_SACEN      VDVAGGDKVPRKGGPGVTTADLLVINKVDLAEQVGADMAVMVADAHRMRGE----LPVIT
UREG_STRAW       IDVAGGDDIPRKGGPGVTTADLLVVNKTDLAPYVGSDLGRMAADAKAQRAE----LPVVF
UREG_STRCO       IDVAGGDDIPRKGGPGVATADLLIVNKTDLAPYVGSDLARMAADAKAARGE----LPVVL
UREG1_STRGG      IDVAGGDDIPRKGGPGVTTADLLVVNKTDLAPYVGSDLERMALDAKKQRGD----LPVAF
UREG2_SACEN      IDVAGGDDIPRKGGPGITTADLLVINKTDLAPHVGSDLQAMAADAKRQRGE----RPVAF
UREG3_STRGG      IDVAGGGDVARKGGPGITGADLLVINKTDLAPHVEVDVTAMVADAERARDG----LPVLA
UREG_ARCB4       IDVAQGADIPRKKGAGLLFSDLLIVNKTDLAPYVEIDLVDMQIDVKENRKN----KPYVF
UREG_HELPY       IDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVMERDSKKMRG----EKPFIF
UREG_HELPJ       IDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVMERDSKKMRG----EKPFIF
UREG_HELHP       IDVAQGDKIPRKGGPGIMRSDLLIINKIDLAPYVGANLSIMERDAKKMRE----DKPFLF
UREG_HAEIN       IDVAQGEKIPRKGGPGITRSDLLVINKTDLAPFVGADLSVMERDARRMRN----GQPFIF
UREG_UREPA       IDVAQGEKIPRKGGQGMIKSDLFIINKVDLAPYVGANVEVMKADTLKSRG----NKDFFV
UREG_CORGL       IDVAQGEKIPRKAGQGMIKSDLFIINKTDLAPYVGANLDVMVEDAKAFRK----NKPFCL
UREG_BORBR       IDVASGEKIPRKGGPGITKSDLFIINKTDLAPYVGADLAVMEADTRRMRG----DKPFVM
UREG_BORPA       IDVASGEKIPRKGGPGITKSDLFIINKTDLAPYVGADLAVMEADTRRMRG----DKPFVM
UREG_BORPE       IDVASGEKIPRKGGPGITKSDLFIINKTDLAPYVGADLAVMEADTRRMRG----DKPFVM
UREG_LEPCP       IDVAAGEKIPRKGGPGITKSDLFVINKTDLAPHVGADLSVMEADTRRMRP----NRPFVM
UREG_METPP       IDVAAGEKIPRKGGPGITKSDLFVINKTDLAPHVGADLAVMEADTQRMRPAHASSRPYVM
UREG_POLSJ       IDVAAGEKIPRKGGPGITKSDLFVINKTDLAPYVGADLGVMEADTIRMRTTPKGLKPFVM
UREG_RHOFT       IDVAAGEKIPRKGGPGITKSDLFVINKTDLAPYVGASLDVMAADTTRMRTTVKGLKPFVM
UREG_DELAS       IDVAGGEKIPRKGGPGITKSDLLVVNKTDLAPYVGANLSIMEADTQRMRA----HKPYVM
UREG_POLAQ       IDVAGGEKIPRKGGPGITRSDLLVINKTDLAPYVGASLPIMESDAKKMRG----ERPFIM
UREG_BURPS       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURP6       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURMA       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURM9       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURP0       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURM7       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURMS       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURP1       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLEVMASDTRKMRG----ERPYVM
UREG_BURTA       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTKKMRG----ERPYVM
UREG_BURA4       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTKKMRG----ERPYVM
UREG_BURCM       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTKKMRG----ERPYVM
UREG_BURL3       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTKKMRG----ERPYVM
UREG_BURVG       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTKKMRG----ERPYVM
UREG_BURCA       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTRKMRG----ERPYVM
UREG_BURCH       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTRKMRG----ERPYVM
UREG_BURCC       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPLVGANLDVMASDTRKMRG----ERPYVM
UREG_PARP8       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPMVGANLDVMASDAARMRG----ARPFAM
UREG_PARXL       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPMVGANLEVMAADAKKMRG----ERPFVM
UREG_CUPNH       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPYVGASLEVMESDARKMRG----ARPFVM
UREG_CUPPJ       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPYVGASLEVMESDARKMRG----GRPFVM
UREG_CUPMC       IDVAGGEKIPRKGGPGITKSDLLVINKTDLAPYVGASLEIMESDARKMRG----ERPFVM
UREG_RALSO       IDVAGGEKIPRKGGPGITKSDLLIINKTDLAPYVGASLDVMASDARKMRG----DRPFVM
UREG_JANMA       IDVAGGEKIPRKGGPGITRSDLLIINKTDLAPYVGANLDIMAQDAKRMRG----ERPFVF
UREG1_METEP      IDVAGGEKIPRKGGPGITRSDLLIVNKTDLAPLVGADLSVMEADTQRMRG----TRPYVF
UREG1_METPB      IDVAGGEKIPRKGGPGITRSDLLIVNKTDLAPLVGADLSVMESDTQRMRG----TRPYVF
UREG1_METRJ      IDVAGGEKIPRKGGPGITRSDLLIVNKTDLAPLVGADLSVMESDTQRMRG----TRPYVF
UREG_METS4       IDVAGGEKIPRKGGPGITRSDLLVINKTDLAPLVGADLAVMEADTQRMRG----GRPYVF
UREG_MAGMM       IDVAAGEKIPRKGGPGITRSDLLVINKTDLAPLVGADLAVMEQDTLRMRG----SRPFVF
UREG1_BRUME      ISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDLEVMEADAMRMRA----KRPFGF
UREG1_BRUSU      ISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDLEVMEADAMRMRA----KRPFGF
UREG1_BRUC2      ISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDLEVMEADAMRMRA----KRPFGF
UREG1_BRUAB      ISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDLEVMEADAMRMRA----KRPFGF
UREG1_BRUA2      ISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDLEVMEADAMRMRA----KRPFGF
UREG1_BRUO2      ISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDLEVMEADAMRMRA----KRPFGF
UREG_CERS4       IDTAAGQDIPRKRGPGLARSDLLVVNKIDLAPHVGVDLARLEADTQAARG----QRPYVM
UREG_RHOS1       IDTAAGQDIPRKRGPGLARSDLLVVNKTDLAPHVGVDLARLEADTQAARG----QRPYVM
UREG_CERS5       IDTAAGQDIPRKRGPGLARSDLLVVNKTDLAPHVGVDLRLLEEDTKTARG----RRPYVM
UREG_PARDP       IDTAAGQDIPRKRGPGLARSDLLVVNKTDLAPHVGVDAALLEADARASRA----GRPVVM
UREG_DINSH       IDTAAGQDIPRKKGPGLARSDLLVINKTDLAPHVDVDLALLESDARTARG----ARPFVM
UREG_JANSC       IDTAAGQDIPRKKGPGLTRSDLLIVNKVDLAPHVGVDVAQLEADTRAARG----RRAYVM
UREG_RHOPA       IDVAAGDKIPSKGGPGITRSDLLVINKIDLAPYVGASLEKMDTDAKRMRG----ARPFVM
UREG_RHOP5       IDVAAGDKIPSKGGPGITRSDLLVINKIDLAPYVGASLAKMEVDAKRMRG----ERPFVM
UREG_PSE14       IDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLEMMDSDTRRMRG----EKPFVF
UREG_PSEU2       IDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLEMMDSDTRRMRG----EKPFVF
UREG_PSEF5       IDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLEMMNSDTQRMRG----GKPFVF
UREG_PSEAE       IDVSAGDKIPRKGGPGICKSDLLVINKIDLAPLVGASLDVMDRDARRMRG----DKPFVF
UREG_PSEU5       IDVSAGDKLPRKGGPGICKSDLLVINKIDLAPMVGASLEVMDRDARKMRG----ERPFVF
UREG_METFK       IDVAAGEKIPRKGGPGITKSDLLVINKIDLAPMVGASLEVMEKDARRMRG----ERPFIF
UREG_ALKEH       IDVCAGDKIPRKGGPGITRSDLLVINKIDLAAGVGASLEVMDRDSRRMRG----DRPFIF
UREG_ACIBC       IDVAGGEKIPRKGGPGITKSDLLIINKTDLAPMVGANLDVMDQDAKRMRG----EKPFLF
UREG_ACIBT       IDVAGGEKIPRKGGPGITKSDLLIINKTDLAPMVGANLDVMDQDAKRMRG----EKPFLF
UREG_ACIBY       IDVAGGEKIPRKGGPGITKSDLLIINKTDLAPMVGANLDVMDQDAKRMRG----EKPFLF
UREG_CITK8       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMARDTMRMRG----DRPWAF
UREG_KLEP7       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMASDTQRMRG----DRPWTF
UREG_ENT38       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTNRMRG----ERPWTF
UREG_PSEPG       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTQRMRP----QRPWTF
UREG_PSEPK       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTQRMRP----QRPWTF
UREG_PSEP1       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTQRMRP----QRPWTF
UREG_PSEPW       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTQRMRP----ERPWTF
UREG_PSEE4       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTERMRP----ERPWTF
UREG_ECO57       IDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTLRMRG----ERPWGF
UREG_ALCBS       IDVASGEKIPRKGGPGITKSDLLVINKIDLAPMVGADLGIMASDTNRMRG----QKPWAF
UREG_SHEHH       IDVAEGEKIPRKGGPGITRSDLLIINKIDLAPYVGASLVVMDQDTKRMRP----EKPYIF
UREG_ALIF1       IDVAEGEKIPRKGGPGITKSDLLIINKIDLAPYVGASLEVMESDTARMRP----TRPYVF
UREG_BLOFL       IDVAAGDKIPRKGGPGITKSDFLIINKIDLAQYVGASLDVMKFDTHTMRN----NRPWTF
UREG_BLOPB       IDVAAGDKIPRKGGPGITRSDFLIINKIDLAEYVGASLEIMNRDTNLMRK----GLPWSF
UREG_DEIRA       LDVAGGEKVPRKGGPGIRHSDLLVINKTDLAPLVGADLRVMDADARAQRRAGDEVRPYVF
UREG_SYNY3       IDVAAGDKIPRKGGPGITKSDLLVINKIDLAPMVGADLGIMDRDAKKMRG----EKPFVF
UREG_THEEB       IDVAAGDKIPRKGGPGITKSDLLVINKIDLAPYVGADLEVMKRDTLKMRG----DRPYVM
UREG_PROMS       IDVSAGDKIPRKGGPGITRSDLLLINKIDLADKVGADLNIMKSDTEFMRK----GKPWFF
UREG_PROM0       IDVSAGDKIPRKGGPGITRSDLLLINKIDLADKVGADLNIMKSDTEFMRK----GKPWFF
UREG_PROM2       IDVSAGDKIPRKGGPGITRSDLLLINKIDLADMVGADLNIMKSDTEFMRK----GKPWFF
UREG_PROM9       IDVSAGDKIPRKGGPGITRSDLLLINKIDLADMVGANLNIMKSDTEFMRK----GKPWFF
UREG_PROMP       IDVSAGDKIPRKGGPGITRSDLLLINKIDLADMVGANLNIMQNDTNMMRD----GKPWFF
UREG_PROM1       IDVAAGDKIPRKGGPGITRSDLLVINKIDLAEMVGASLKIMERDTLLMRK----NLPWCF
UREG_PROMT       IDVAAGDKIPRKGGPGITRSDLLVINKIDLAEMVGASLKIMERDTLLMRK----NLPWCF
UREG_SYNS3       IDVAAGDKIPRKGGPGITRSDLLVINKIDLASFVGADLGVMEQDTLRMRR----NRPWCF
UREG_ANADF       IDVAGGDKVPRKGGPGITQADLLVVNKTDLATAVGADLDVMARDAARMRG----DGPVVF
UREG_CYTH3       IDVSGGDKIPRKGGPGITQADLLVINKIDLAHLVNADLSVMERDSKKMRG----DGPFLF
UREG_OPITP       IDVAEGDKIPRKGGPAIRFSDLLIINKVDLAPLVGADLEVMARDATAQRG----GRPFLL
UREG_METS5       LDTSAGDKYPGKGGIGITESDLLVVNKIDLAPYVQADLNKMREDSLRVRR----GKPSVF
UREG_SULTO       LDTAAGDKYPGKGGLGIQESDLLVVNKIDLAPFVGADLEKMRRDAEKIRK----DKPTVF
                 :... * . . * * .:  .*::::** *:*  *  .   :  :    *           

UREG_YERPE       TNCKTG-QGIEELVDMIMRDFLFTHVQPEGEQA--------------
UREG_YERPS       TNCKTG-QGIEELVDMIMRDFLFTHVQPEGEQA--------------
UREG_YERE8       TNCKTG-QGIEELVDMIMRDFLFTHVQPQGEHA--------------
UREG_PHOLL       TNCKTG-EGVETLVNMIMRDFLFTHSLQATQ----------------
UREG2_METEP      TNCKTG-EGVDDLLQLILDMALFDVRTRPPLAASA------------
UREG2_METPB      TNCKTG-EGIDDLLRLILDMALFDVTTNRPLAASA------------
UREG2_BRUAB      TNCKTN-EGIDDLVHLIRENVLFDTEVSKESA---------------
UREG2_BRUA2      TNCKTN-EGIDDLVHLIRENVLFDTEVSKESA---------------
UREG2_BRUC2      TNCKTN-EGIDDLVHLIRENVLFDTEVSKESA---------------
UREG2_BRUME      TNCKTN-EGIDDLVHLIRENVLFDTEVSKESA---------------
UREG2_BRUO2      TNCKTN-EGIDDLVHLIRENVLFDTEVSKESA---------------
UREG2_BRUSU      TNCKTN-EGIDDLVHLIRENVLFDTEVSKESA---------------
UREG2_STRGG      TDCLTG-VGIDDI-------ALYLESRRKVLI---------------
UREG_HALWD       TNCKTG-EGIDDIMDIIERSVLFA-----------------------
UREG_NATPD       TDCKAE-EGIDGVVDHIEEGVLFA-----------------------
UREG_HALMA       TNCKDE-TNIDTVLSHVRDGVLFA-----------------------
UREG_CENSY       VNCMTD-EGITEVAERIIHDALLGAPPGHPVG---------------
UREG1_BRASB      TNLKAG-TGVEAVADAISAAVLFRI----------------------
UREG2_METRJ      TNARAG-LGIDRVADAIGRAVLFTP----------------------
UREG2_BRASB      TNCRRG-EGIEAIVDLLEREVLFRK----------------------
UREG_MYCGI       TDLKSG-HGLIELTERLIDGAMLGVGVP-------------------
UREG_MYCTU       QSLTED-PAASDVVAWVRSQLAADGV---------------------
UREG_MYCBO       QSLTED-PAASDVVAWVRSQLAADGV---------------------
UREG_FRAAA       TSLTAD-PTAGDVTAWVRAQLADLSPHG-PRGATPAAAG--------
UREG_FRACC       TSLTAD-PTAADVTAWVRAQLAELSPRGGSYDASDASNASQPLNRM-
UREG_FRASN       TSLRSD-AGASDVADWVLAQLPSPARPQ-------------------
UREG1_SACEN      QSLTRT-PNAPDVSAWVRQQLAAGVVVGA------------------
UREG_STRAW       QSLRTE-PGVAPVADWVRARLAAWAA---------------------
UREG_STRCO       QSLRGE-DGVREVADWVRERIAAWTA---------------------
UREG1_STRGG      TSLTSA-EGVGPVADWVRAQLAAWAA---------------------
UREG2_SACEN      TSLTAD-NGVGPVADWVGARLTAWTAA--------------------
UREG3_STRGG      LSKHDP-ESIARLADWVRAVLVRHRSGTHVPTDPGPMAPHSHSHDGS
UREG_ARCB4       ISKKEP-QTLNQVVSWIEALI--------------------------
UREG_HELPY       TNIRAK-EGLDDVIAWIKRNALLED----------------------
UREG_HELPJ       TNIRAK-EGLDDVIAWIKRNALLED----------------------
UREG_HELHP       TNIRAK-EGIDAVVEWIKKYALLEDI---------------------
UREG_HAEIN       TNLMKK-ENLDGVIGWIEKYALLKNVEEPASLVR-------------
UREG_UREPA       TNLKTD-EGLKSVADWIEKRLQLALLEE-------------------
UREG_CORGL       TNLRTD-DGLDKVLEWIRHEVMMQDLQEA------------------
UREG_BORBR       CNLKTG-DGLDQVIAFLKTEGLFRG----------------------
UREG_BORPA       CNLKTG-DGLDQVIAFLKTEGLFRG----------------------
UREG_BORPE       CNLKTG-DGLDQVIAFLKTEGLFRG----------------------
UREG_LEPCP       SNLKTR-QGLDEVIRFIETKGLLVG----------------------
UREG_METPP       TNLKTR-AGLAEVVSFIERRGLLHAA---------------------
UREG_POLSJ       TNLKTN-TGLAEVIAFIETKGMLQAG---------------------
UREG_RHOFT       TNLKTL-SGVQEVMAFIESKGMLRSGDAATLRDGR------------
UREG_DELAS       GSVKSG-KGLREVIDFITERGLLPPMPAQG-----------------
UREG_POLAQ       GSVKLG-DGLNEIIKFIEQKGLLVS----------------------
UREG_BURPS       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURP6       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURMA       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURM9       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURP0       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURM7       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURMS       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURP1       CNLKAL-DGVADVIAFIENKGLLTV----------------------
UREG_BURTA       CNLKAL-DGVADVIAFIEKKGLLTV----------------------
UREG_BURA4       TNLKAL-EGVADVVAFIEKKGLLMV----------------------
UREG_BURCM       TNLKAL-DGVADVVAFIEKKGLLTV----------------------
UREG_BURL3       TNLKAL-EGVADVIAFIEKKGLLTV----------------------
UREG_BURVG       TNLKAL-DGVADVIAFIEKKGLLTV----------------------
UREG_BURCA       TNLKAL-DGVADVIAFIEKKGLLTV----------------------
UREG_BURCH       TNLKAL-DGVADVIAFIEKKGLLTV----------------------
UREG_BURCC       TNLKAL-DGVADVIAFIEKKGLLTV----------------------
UREG_PARP8       CNLKAL-EGLDEVISFIERKGLLVG----------------------
UREG_PARXL       CNLKAL-DGLDVVVKFIEKKGLLKV----------------------
UREG_CUPNH       GSVKSG-QGLDEVIRFIERQGMLGV----------------------
UREG_CUPPJ       GSVKSG-QGLDEVIRFIEQQGMLGV----------------------
UREG_CUPMC       GSVKSG-QGLDQVIAFIERQGMLDV----------------------
UREG_RALSO       CNLKEQ-AGLDAVVRFIEQQGMLAAPAAG------------------
UREG_JANMA       TNLRSG-DGVETVIEYIRKQGLLDEKRKN------------------
UREG1_METEP      ASLREG-HGADTVARFIVEAGGLG-----------------------
UREG1_METPB      ASLREG-HGADRVATFIVEAGGLR-----------------------
UREG1_METRJ      ASLREG-TGADAVARFVEEAGGLGR----------------------
UREG_METS4       TSLRRG-DGVEAVARFVIEAGGL------------------------
UREG_MAGMM       TNLKQG-DGVAAIIQFLVEKGGLGV----------------------
UREG1_BRUME      TDLHRG-KGVQEIIDFIVENGGLEPRSN-------------------
UREG1_BRUSU      TDLHRG-KGVQEIIDFIVENGGLEPRSN-------------------
UREG1_BRUC2      TDLHRG-KGVQEIIDFIVENGGLEPRSN-------------------
UREG1_BRUAB      TDLHRG-KGVQEIIDFIVENGGLEPRSN-------------------
UREG1_BRUA2      TDLHRG-KGVQEIIDFIVENGGLEPRSN-------------------
UREG1_BRUO2      TDLHRG-KGVQEIIDFIVENGGLEPRSN-------------------
UREG_CERS4       ARMRAG-VGVEAIVAFLEREGGLQLLPQD------------------
UREG_RHOS1       ARMRAG-VGVEAIVAFLEREGGLQLLPQD------------------
UREG_CERS5       AQLRRG-AGVAEIVAFLEREGGLQLLPQE------------------
UREG_PARDP       AALRHG-KGVAEVVDFLIEQGGLQPCPAHSHGQ--------------
UREG_DINSH       AALKSG-QGVAQIVAFLEREGGL------------------------
UREG_JANSC       GSLREG-RGVPEIVQFIKEVGGL------------------------
UREG_RHOPA       TNLKKS-EGLDRIIGFIEEKGGLTPRRSA------------------
UREG_RHOP5       TNLKQS-AGLDRIIAFLEAKGGLQAEPVDA-----------------
UREG_PSE14       SNQKTG-QGLEQIIAFIERQGLLTAAA--------------------
UREG_PSEU2       SNQKTG-QGLEQIIAFIERQGLLTAAA--------------------
UREG_PSEF5       SNQKTG-QGLADIIAFIERQGLLTAA---------------------
UREG_PSEAE       SNQKTG-QGLDEIIAFIERQGLLTAA---------------------
UREG_PSEU5       SNQKVG-QGLEEIISFIEKQGMLSAA---------------------
UREG_METFK       TNLKRG-QGLEDIVGFIEKQGLML-----------------------
UREG_ALKEH       TNLHAG-EGLESVIDFIIREGMLDRKPGLAPA---------------
UREG_ACIBC       SNMKTQ-DGLEEIIQFIEKQGLFKA----------------------
UREG_ACIBT       SNMKTQ-DGLEEIIQFIEKQGLFKA----------------------
UREG_ACIBY       SNMKTQ-DGLEEIIQFIEKQGLFKA----------------------
UREG_CITK8       TNLKTG-DGLATIIAFLEDKGMLRV----------------------
UREG_KLEP7       TNLKQG-DGLSTIIAFLEDKGMLGK----------------------
UREG_ENT38       TNLKVG-DGLNKIIGFLEDKGMLKV----------------------
UREG_PSEPG       SNLKKG-EGLQAVIDFIVERGMLGVRG--------------------
UREG_PSEPK       SNLKKG-EGLQAVIDFIVERGMLGVRG--------------------
UREG_PSEP1       SNLKKG-EGLQAVIDFIVERGMLGARA--------------------
UREG_PSEPW       SNLKKG-DGLQAVIDFIVERGMLGVRG--------------------
UREG_PSEE4       SNLKKG-EGLQAVIDFIVERGMLGVRG--------------------
UREG_ECO57       TNLKSG-EGLQNIIAFIEEQGMLGK----------------------
UREG_ALCBS       SNLRNDVEGLEKIIGFVVEEGMLVSHSEKAVSG--------------
UREG_SHEHH       TNMKTG-KGVPEILTFIETAGMLNI----------------------
UREG_ALIF1       TNLKEG-VGLDKIIEFIVDRGMLDAK---------------------
UREG_BLOFL       TNLKTG-YGIESVINFLREKKLINNKM--------------------
UREG_BLOPB       TNLKTG-HGVQSVVDFILRQRLYLQ----------------------
UREG_DEIRA       TNLKSG-AGVDEIIAWIEHDLLFRDVTPPRVGL--------------
UREG_SYNY3       TNLKTA-TGLSTVVDFVEHYLPTKVLAS-------------------
UREG_THEEB       TNLKTG-LGLDQVIAFLTVHLAA------------------------
UREG_PROMS       TNLSSG-MGVEEIIQFLESHIPNNRN---------------------
UREG_PROM0       TNLSIG-IGVEEITQFLESHIPNNRN---------------------
UREG_PROM2       TNLSIG-KGVKEISQFLESHLPNNQN---------------------
UREG_PROM9       TNLSTG-IGVEEITRFLESQIPNNQN---------------------
UREG_PROMP       TNLSSG-SGVDNVIKYLVAQIPNI-----------------------
UREG_PROM1       TNTKTG-EGIKIIAEFLCNQIPFARKMV-------------------
UREG_PROMT       TNTKTG-EGIKIIEGFLCNQIPSVHKMV-------------------
UREG_SYNS3       TNLRTE-EGLDRVEEFVLQQIPN------------------------
UREG_ANADF       AQVTRG-VGVPEIAGHVLHAYRHAVGAPH------------------
UREG_CYTH3       ARAKDC-FGIDEIINHILTAREKALEAKPVYSLRKE-----------
UREG_OPITP       CDLKRE-HNLDAVIGWLEREVLFARTAAPVG----------------
UREG_METS5       ISLKTG-EGTRELIRILDEELGLERVFGNKGQ---------------
UREG_SULTO       ISLKTG-DGIDDLIKIIRSELELEGLIRS------------------
                             :