CLUSTAL format seed alignment for MF_01392

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CCS1_SYNE7      -------MTSDPLASPSFADRWRRGQQLFWTWLADLRLAILLLLAIAIASATGTVIEQGQ
CCS1_SYNP6      -------MTSDPLASPSFADRWRRGQQLFWTWLADLRLAILLLLAIAIASATGTVIEQGQ
CCS1_THEEB      -------MINAPVFRRVLA------------LLGDLRLAILLLLVIAIASMAGTVIEQGQ
CCS1_ACAM1      -------MTSNLGQPQAFF------KKTLVPVLADLRLAIVLLLAIALFSISGTVIEQGQ
CCS1_NOSS1      ----MTTDNSAPTASPWWSLPGKFLRREFLPVLTDLRLAIALLLIIALFSISGTVIEQGQ
CCS1_TRIV2      ----MTTDNSAPTASPWWSLPGKFLRREFLPVLTDLRLAIALLLIIALFSISGTVIEQGQ
CCS1_NOSP7      ----MTLEDSASKELKWWAIPGQFLRQELLPVLTNLRLAIALLLLIAIFSSTGTVIEQGQ
CCS1_TRIEI      ----MDVEDSDKNS---LINPLRIFKREILPLLADLRLAIALLLIIAICSISGTVIEQGE
CCS1_CROS5      ----MTISDSPQTPENLSLPKQG--FRQLIKIVADLRLAIVLLLAIALFSISGTVIEQGE
CCS1_MICAN      ----MTISETSSNLKN--TPPQW--GRKFIQTIADLRLAIILLLLIAIFSISGTVIEQGQ
CCS1_SYNY3      ----MTIANPS--PSN--FFQQL--GRQCLKTLADLRLAIALLLLIAVFSISGTVIEQGE
CCS1_SYNP2      ----MTVSDSSPNSPWHSFPRKV--WRTGLKWIADLRVAIALLLLISVFSILGTVIEQGS
CCS1_SYNJB      ------MVIYSLPLARWVSSLRRYFRHELLPLLADLRLAIGLLLAIAVLSATGTVIEQEE
CCS1_SYNJA      ------MVIPSLPLSRWLSPLRRYFRHELLPLLADLRLAIGLFLAIALLSAVGTVIEQEE
CCS1_GLOVI      MGSDGLQWVSRSLEHRPMTSLWRDIRHEVAAWLGSLKLAIGLFLAIAAASIAGTVIPQGE
CCS1_GUITH      ----------------------MNYIIKFLNKLNNLTVAIIILLAIALASALGTVIEQNK
CCS1_RHDSA      -----------------MLIKINQYFRKSISVLGNLKLAIILLLMLALFSAFGTVIEQNQ
CCS1_HETA4      -------------------------MEKIFKILANLKFAIALLLLISITITFGSIIEQDQ
CCS1_HETA2      -------------------------MEKIFKILANLKFAIALLLLISITITFGSIIEQDQ
CCS1_TRICV      ------------------------MKQSVLRFLADLRFAISILLIIASCSVIGTVIEQDQ
CCS1_THAPS      ------------------------MKQNIFKSIADLRFAIFILLVIAAFSVIGTVIEQDQ
CCS1_PHATC      ------------------------MKQQIFRLLADLRFSIFLLLLISFCSIVGTVIEQDQ
CCS1_EMIHU      -----------------MVFSTKLYTTKLLKKLADLRLAIWLLASIGILIALGTFIEQDQ
CCS1_PORPU      -------------MQINLKFKKKDVRWYLLRLFSNLQFSIILLLVIASFSVIGTIIEQNK
CCS1_PYRYE      -----------MKRQLNLRFNRKDIRWYLLRLFSNLQFSIILLLLIAIFSTIGTVIEQNK
CCS1_GRATL      -------------------MNIKNILWFTLKKLSNLSLSISLLLLIASISIIGTIIEQNQ
CCS1_PROMA      ----------------------MKYLRKIINWLSSLKVAIVLLILIALGSALGTALPQGE
CCS1_PROM4      ----------------------MKVLWRVLNWLSSLKVAILLLFFIALASAIGTFIPQGD
CCS1_PROM1      ----------------------MKKISQVLNWLSSLKIAILLLLLIAISCAAGTLIPQQE
CCS1_PROMT      ----------------------MKKISQVLNWLSSLKIAILLLLVIAVSCAAGTLIPQQE
CCS1_PROM3      ----------------------MVTLKRLLAWISDLRIAIGLLFVIALSSALGTAIPQGE
CCS1_PROMM      ----------------------MATFKRLLAWISDLRIAIGLLLVIALASALGTAIPQGE
CCS1_SYNSC      ------------------MASGMGPLKRLAAWFSDLRLAIVLLLLIALASAVGTGIPQGD
CCS1_SYNPX      -------------------------MKRLLVWLSDLRVAIVLLLLIALASAVGTAIPQGD
CCS1_SYNS9      -------------------------MKRLIAWLSDLRVAIVLLFLIALASAVGTAIPQGD
CCS1_SYNS3      ----------------------MPALRRLFALLSDLRLAILLLLLIAGASALGTILPQNE
CCS1_SYNPW      ----------------------MRTLNRVFAILSDLRLAIALLLLIAAASAVGTILPQQE
CCS1_PAUCH      -------------------------MKHVLKWISDLRVAIFLLLIIALSSSLGTALPQKE
CCS1_SYNR3      ---------------------MKSLVLKAAAWLSDLRVAIVLLLLIAACSGLGTAIPQGE
CCS1_PROM2      ----------------------MIIFKNLILKISSLRFAISLIIFIAITSGIGTFIPQGS
CCS1_PROM9      ----------------------MIIFKNLILKISSLRFAISLIIFIAITSGIGTFIPQGN
CCS1_PROMS      ----------------------MIIFKNLILKISSLRFAISLIIFIAIASGIGTFIPQDN
CCS1_PROM0      ----------------------MTIVKDLIFRISSLKFAISLIIFIAISSGVGTFIPQGS
CCS1_PROM5      ----------------------MIIFKNLILKISSLKFAITLIIFIAITSGVGTFIPQGN
CCS1_PROMP      ----------------------MVIFKKFILKISSLRFAILLIIFIAISSGVGTFIPQGN
CCS1_CYACA      --------------MVSITLKTNRIFRSCLNLATNLKFSITLFIIICIVSAIGTIIPQDK
                                                  .* .:* ::  :      *: : * .

CCS1_SYNE7      SLAFYQENYPTD-PALFGFLSWRWILSLGLDHVYRAGWFLGLLILFGASLTACTFRRQWP
CCS1_SYNP6      SLAFYQENYPTD-PALFGFLSWRWILSLGLDHVYRAGWFLGLLILFGASLTACTFRRQWP
CCS1_THEEB      SLSFYQANYPEN-PALFGFLSWRVLLALGLDHVYRTPWYLTLLVLFGASLTACTLTRQVP
CCS1_ACAM1      SLEFYQANYPEE-PALFGFLTWKVLVTIGLDHVYATWWFLSLLILFGTSLTACTFMRQLP
CCS1_NOSS1      SPAFYQSNYPEH-PALFGFLTWKVIQVVGLDHVYRTWWFLSLLVLFGTSLTACTFTRQLP
CCS1_TRIV2      SPAFYQANYPEH-PALFGFLTWKVIQVVGLDHVYRTWWFLSLLVLFGTSLTACTFTRQLP
CCS1_NOSP7      SPAFYQANYPEH-PALFGFLTWKVIQVVGLDHVYRTWWFLALLILFGTSLTACSFTRQLP
CCS1_TRIEI      SIAFYQENYPEK-PALFGFLTWKVILLLELDHVYRTWWFLSILILFGASLTACTFTRQLP
CCS1_CROS5      TISFYQQNYPED-PALFGFLTWKVILILGLNHVYTTWWFLSLLVLFGTSLTTCTFTRQFP
CCS1_MICAN      SLSFYQANYPEK-PALFGFLTWKVLLLLGLNHVYSTWWYLSLLILFGSSLTACTFRRQLP
CCS1_SYNY3      SLSFYQQNYPED-PALFGFLSWQVILQLGLNQVYRTWWFLGLLILFGSSLTACTFNRQFP
CCS1_SYNP2      TIQFYQENYPED-PALLGFLSWKVLLGLGLDHVYTTWWYLVLLLAFGVSLIACTFRRQLP
CCS1_SYNJB      TAAFYQAHYPEH-PALFGFLTWRVILSLGLDHVYRTPWFLAILILFGSSLAACSLTRQWP
CCS1_SYNJA      TVAFYQAHYPEH-PALFGFLTWRLILKLGLDHVYRTSWFLALLILFGSSLAACSLTRQWP
CCS1_GLOVI      STDFYRQNYPDSGAVVWGFVTWRFIISLGLDEVYRSWWFVALLLLLATSLTICTFRRQIP
CCS1_GUITH      NTDFYLKNYPLT-KPLFNFVTSDLILKFGLDHVYTSWWFIFLIILLLLSLTLCTITRQLP
CCS1_RHDSA      NVAFYENSYPNS-APLFGFLSANAILFLGLNNIYQTWWFTTLILLLAVSLFSCTLARQIP
CCS1_HETA4      TLDYYKQNYPLT-NPIGGFLTWKVINMFQLNHIYKNFWFISLLLSLGISLIACTFFQQFP
CCS1_HETA2      TLDYYKQNYPLT-NPIGGFLTWKVINMFQLNHIYKNFWFISLLLSLGISLIACTFFQQFP
CCS1_TRICV      SIEIYKLNYPLT-NRIFGFLSWDIILKFGLDHVYKTWWFLGFIALFGLSLFTCTILQQFP
CCS1_THAPS      SIETYKLNYPLT-NRVFGFLSWDIILKFGLDHVYKTWWFITLILLFGISLLTCTLLQQFP
CCS1_PHATC      SIEIYKTNYPLT-NPVFGVLTWDRILLFGLDHVYRTWWFFALIFLFGLSLILCTFLQQLP
CCS1_EMIHU      PLAFYQENYPTT-APILGFVDWKFITSLNLNTLYSNIWFFGIVGFFASSLLACTYTTQIP
CCS1_PORPU      DLDFYQAHYSVSGEHF-IILNWKNIELFGLNHVYTTWWFLTLLFIFSLSLLVCSLSRQIP
CCS1_PYRYE      ESSFYQTQYTLSNEYY-NILNWKNIELFGFNHVYTTWWFLSLLFIFSLSLFTCSISRQIP
CCS1_GRATL      SIVYYQMNYPINNQPFGRIMNWKIILNLGLDHIYLNPCFVLVLVLFFCSLLACTFSNQLP
CCS1_PROMA      KAESYLKNYEVT--RFLGVINGDLLLQLQLDHVYSSFWFLFLLTWLSFSLIICSWKRQWP
CCS1_PROM4      QSDNYINNYAKH--PWLGLINGHLILRMQLDHVYSSYWFLFLLSWLGIALMICSWRRQWP
CCS1_PROM1      SNQFYYDNFNKN--PFLGIINANILLLFEFDHVYTSFWFLFLLIWLGLALSVCSFRRQLP
CCS1_PROMT      SNQFYYDNFNKN--PFLGIINAKILLLFEFDHVYTSFWFLFLLIWLGLALSVCSFRRQLP
CCS1_PROM3      LRDSYLEGYSDK--PWLGFVNGSMILRLQLDHVYTSSWFLALLAWLGLALILCSWRRQWP
CCS1_PROMM      LRESYLEGYSDK--PWLGFVNGSMILRLQLDHVYTSSWFLALLAWLGLALILCSWRRQWP
CCS1_SYNSC      PPSSYIDAYSDT--PWLGLLHGEQVLQLQLDHVYSSGWFLALLAWLGLALILCSWRRQWP
CCS1_SYNPX      PPTSYVDAYAET--PWLGLLHGEQVLQLQLDHVYSSGWFLGLLAWLGLALILCSWRRQWP
CCS1_SYNS9      APRSYVEAYATR--PWLGLLNGEQVLQLQLDHVYSSVWFLSLLAWLGLALILCSWRRQWP
CCS1_SYNS3      APDLYLERFNAD--PWLGMINGEQMLQLQLDSIYSSVWFLSLLAWLGLALILCSWRRQWP
CCS1_SYNPW      APELYLERFNAD--PWLGLINGDQMLAFQLDHLYSSVWFLALLAWLGLALMLCSWRRQWP
CCS1_PAUCH      SAESYYEAYNSS--PWLKVFSGESIIQLQLDHVYSSDWFLSLLLWLGIALVFCSWRRQLP
CCS1_SYNR3      PAAFYHERYDAA--PWLGVVNGNQLLSWELDHLYTSNWFLLLLAWLGLALLLCSLRRQWP
CCS1_PROM2      DNKFYVDNYNSA--PIFGFLDGEKVLKLQLDHVYTSFWFLFTLILLCISLAACSFRRQIP
CCS1_PROM9      SNKFYIDNFDSA--PIFGFLDGEKVLKLQLDHIYTSIWFLFTLILLCISLSACSFRRQIP
CCS1_PROMS      NNKFYIDNFDRA--PIFGLLDGEKVLKLQLDHIYTSFWFLFTLILLCISLAACSFRRQIP
CCS1_PROM0      NSKFYIENFDEA--PIFGFLNGEKVLILQLDHIYTSLWFLFALILLCISLAACSFRRQIP
CCS1_PROM5      DPQEYIDFYNET--PIFGLINGYQVIKLQLNHVYTSNWFLFSLILLCISLAACSFRRQIP
CCS1_PROMP      DQQEYIDFYNET--PILGFINGSQVIRLQLDHIYTSNWFLFSLILLCISLAACSFRRQIP
CCS1_CYACA      PKEFYMNTYSLK---VLGMPLWKIIQLLSLEKIFYSNFYLILLLCLSFSLFFCSLKSQFP
                    *   :         .     :    :: ::    :   :  :  :*  *:   * *

CCS1_SYNE7      ALRAAQRWQFYQEPRQFTKLALSASLP----QGKLDSLEPLLLQRRYRLFR---ADDVLY
CCS1_SYNP6      ALRAAQRWQFYQEPRQFTKLALSASLP----QGKLDSLEPLLLQRRYRLFR---ADDVLY
CCS1_THEEB      ALTTAQRWHYYQEPRQFTKLALSTTIP----QGSLTALATALRAKGYRVWQ---TDTQLY
CCS1_ACAM1      ALKAARSWQFYKKPRQFGKLALSTTLD----PDQKPSLLKALEKNRYKVFE---EDQSIY
CCS1_NOSS1      ALKTAQRWKYYEEPRQFQKLALSAELD----AGSVNSLSQILQNRRYKIFQ--EKDDILY
CCS1_TRIV2      ALKTAQRWKYYEEPRQFQKLALSAELD----AGSVNSLSQILQNRRYKIFQ--EKDDILY
CCS1_NOSP7      ALKAAQRWKYYEEPRQFQKLALSAELD----NGSLNSLSQLLQKRRYKIFPDREKENILY
CCS1_TRIEI      ALKSANRWKFYNKKQQFKNLALSAEIE----TASLDSLEEILQKRGYKTSK---EGDKLY
CCS1_CROS5      ALKAARKWNFYQKARQFEKLALSTELA----INDLKFVNNLLEQKGYKTFQ---ENQAIY
CCS1_MICAN      ALKAARNWQFYQQSRQFQKLALSAELE----TGSLESLTPLLEKKGYKVFL---ENNSLY
CCS1_SYNY3      ALKAARSWQFYHQPRQFKKLALSFSLP----DGDINKIESLLRDRGYKIFQ---EGDSVY
CCS1_SYNP2      ALKTARNWNYYSQARQFNKLALSTELD----HGSLQSLKPQLEKKRYKIFQ---DGEKLY
CCS1_SYNJB      MLKRARRWSYLTRPQSFQRLPFRTYLP----QQSLQGLPQQLRRQGYLVFQ---EGHYLY
CCS1_SYNJA      MLKVARRWSYLTRPHSFQRLPFWTYLP----QRSLQGLPQRLRQRGYAVFQ---DGSRLY
CCS1_GLOVI      MLKAAQNWKFYTEPRQLSKYALRTAIP----ARGTGPLAEQLRAGRYKVYQ---RDDLIY
CCS1_GUITH      ALKLARLWQFYTNFNTKAKFQIRFKTN----SSSLTKLTYYLEEKNYKIKH---FNHFVY
CCS1_RHDSA      SLKMARLWQFYTKDQSLKKIGLSFNLQ----KTSLSKLAFTLKTDDYNVIQ---KGRFLY
CCS1_HETA4      GIKFSRRCYFSNNPRK---TDFQTQLK----TNLSRNIIYTIISEGYFVFQ---QKKNFY
CCS1_HETA2      GIKFSRRCYFSNNPRK---TDFQTQLK----TNLSRNIIYTIISEGYFVFQ---QKKNFY
CCS1_TRICV      SLKIARRCQFFRTTQQFGLLKLSRNLG----NLSLSQLLFRIKKNQYSIFQ---QKNIVY
CCS1_THAPS      SLKIARRCQFFRTTQQFCRLNISTNLK----HLSFSQLLFKIKENNYSIFQ---QKNIIY
CCS1_PHATC      SLKIARRCQFFRTTNQFYRLKISTVLN----DFSFNKILGRITGSQYSIFQ---QKNIVY
CCS1_EMIHU      ALKKFRLWEFITNFKSLRKFQLKRQLP----RNLASTSVYQLYGKNYHVFR---QGKKNY
CCS1_PORPU      SLQNARRWCFYKNPNQFKKFTGSQEIQ----KTTLHLVASCLQKFNYHIFQ---QGNSIY
CCS1_PYRYE      SLQNARRWHFYKNPNQFKKFTGSQEIK----TTQLNLLASCLQNYNYHIFQ---QGKSIY
CCS1_GRATL      SLRNARKWKFLQYKNHINCNNHFVELD----KISICNIIYSLYSNNYYIFH---KENNIY
CCS1_PROMA      SLKKAIDWIDYKEPKQIQKLAISQSFRIQKNDNGINPLANYLENNGWQVKI---KSSRLA
CCS1_PROM4      TLKAAMKWIDYDQSTQIKKLAISEEVIVQDSGLAIKKLHNQLISSGWDVKA---DSNRIA
CCS1_PROM1      ILKSALNWIDYKSPRQIAKLSVAQTIVTNNCSESLEKIKLNLKKQGWNVKE---TDGRIA
CCS1_PROMT      ILKSALNWIDYKSPSQIAKLSVAQTIVTNNCAKSLEKIKLNLKKQGWNVKE---TDGRIA
CCS1_PROM3      ALQAALQWIDYQEPRQLSKLAIAETISSPPKNESIDKLAAHLHQQGWQVQQ---QPGRLA
CCS1_PROMM      ALQAALQWIDYQEPRQLSKLAIAETISSPPKNESIDKLAAHLHQQGWQVQQ---QPGRLA
CCS1_SYNSC      ALMAARRWIDYRTTRQLSKLAIAESQPCPDTSQGLTQLETVLRASGWQVQR---KPQRLA
CCS1_SYNPX      ALQAARRWIDYRTPRQLSKLAIAETITCPDAEAGLTQLSAVLQRQGWELKP---GLNRLA
CCS1_SYNS9      ALQAARRWIDYSNPRQLSKLAIAESLPCTDSNSALQAFSTVLSQQGWRLER---KDNRLA
CCS1_SYNS3      ALLATTRWIDYRQPRQLSKLALAESILCSNGESALDTLSEELQKQGWQVQR---NEDRLA
CCS1_SYNPW      ALQAAMRWIDYTRPRQLSKLALAETLSCASSDGALSSLAIELKSRGWQVKQ---HQDRLA
CCS1_PAUCH      ALQFTLRWIDYCNPRQLSKLALAETIISTDASASIKRLEQLLKNQGWQVQA---KSGRLA
CCS1_SYNR3      ALRASLRWLDYTKPRQLSKLAVATSLDTGDSAAALDQLERQLQQQGWAVRR---QQNRLA
CCS1_PROM2      SLKASLKWIEYKSEKKFSKLQLNTSHPINQDGDHISKVDLLLKKRGWKTYK---FKSHIS
CCS1_PROM9      SLKASLKWIEYNNEKKFSKLQLTSSHPINQDGDHISKVDLLLKKRGWKTYK---FKSHIS
CCS1_PROMS      SLKASLKWIEYKSEKKFSKLQLTRSHPINQDGEHISKVDLLLKKKGWKTYK---FNSHIS
CCS1_PROM0      SLKASLKWIEYKSEKKFRKLQLNSSYQINEVEDLISKADLFLKKRGWKTYK---FKSHIS
CCS1_PROM5      SLKAALKWTDYKNEKRFYKLQLTTNYKVSQDVNHILKADSLLRKKGWSISK---FENRLS
CCS1_PROMP      SLKAALKWTDYKDEKKFYKLELITNYEIIQDADHILKADSLLRKKGWNISK---FENRLS
CCS1_CYACA      YLRTSRIIKLNNNNPPTSPLHESKKIKYNNIASKNDSSCVQLVSQGYKIYT---------
                 :                                       :    :             

CCS1_SYNE7      ARRGLAGRVGPILVHAGMLVVLGGAIWGSLGGFYAQEMIPSGETFQVRNIVDAGPWSGSR
CCS1_SYNP6      ARRGLAGRVGPILVHAGMLVVLGGAIWGSLGGFYAQEMIPSGETFQVRNIVDAGPWSGSR
CCS1_THEEB      ARKGLVGRLGPIVVHASMLLILLGGILGALTGFMAQELIPSGETVHLQHIVEAGPLA--R
CCS1_ACAM1      ARKGITGRIGPIIVHASMILILLGSIWGSLTGFMAQEMIPSGTTAKVSNIVKSGPWSGAQ
CCS1_NOSS1      ARKGIVGRIGPIIVHIGIVTILLGSIWGAMTGFIAQEMVPSGETFQVKNIIDAGPLAAGQ
CCS1_TRIV2      ARKGIVGRIGPIIVHIGIVTILLGSIWGAMTGFIAQEMVPSGETFQVKNIIDAGPLAAGQ
CCS1_NOSP7      ARKGIVGRIGPIIVHIGIVAILLGGIWGAMTGFMAQEMVASGDTFQVTNIVDAGPLAA-Q
CCS1_TRIEI      GRKGIIGKVGPIIVHASMLIILAGSIIGSMTGFLGQEIVPSGETFQVKNIIDAGIFAKSQ
CCS1_CROS5      ARKGIIGKIGPIVVHAAMLIILGGAIWGALTGFLAQAMVPTGSEFKVNNIIEAGPLSQPQ
CCS1_MICAN      ARKGLIGKIGPIIVHAAMLIILAGAIWGALTGFFAQEMVASGDSFQVKNIIEAGPLSKNS
CCS1_SYNY3      ARKGLMGKVGPIIVHGAMLIILGGAIWGALTGFFAQHMIPSGETFQVSNIIEKGPLADSQ
CCS1_SYNP2      ARKGIVGRIGPIIVHIGMIVTLVGSIWGAFGGFMAQEMIPSGVNFKVNNVFKAGIFS--E
CCS1_SYNJB      ARKGLIGRIGPILVHVSMLLILLGAIWGSISGFKAQELIPSGGVASIQHLTGAGDLARAH
CCS1_SYNJA      ARKGLIGRFGPILVHVSLLLILLGAIWGSLAGFKAQALIPSGSVAAIEQVTGAGDL--AH
CCS1_GLOVI      ATKGTIGRVGPIVVHVSLLLIMAGAMIGAFGGYQTQRMTLAGDSFDIQQVEQ--SRLSLA
CCS1_GUITH      AYKGIFGRVSPIIVHFSLVIVLIGSMLSTTQGRTQEAFIVVN------------QEKP--
CCS1_RHDSA      AYKGLPGKIGPIIVHASLIIILFGALLGNLSGFVSQELVPLGGVFHIQNIINSGTLSY--
CCS1_HETA4      GTKGIIGRIAPVFVHLSIILILLGSIFASLGGFNSQELIGKGEIFHIQNVTSSGPLTK--
CCS1_HETA2      GTKGIIGRIAPVFVHLSIILILLGSIFASLGGFNSQELIGKGEIFHIQNVTSSGPLTK--
CCS1_TRICV      CYKGLIGRIAPIIVHFSMILILIGAIFGALNGFKAQELIPKTEAFHVQNILSNGQLTR--
CCS1_THAPS      CYKGLIGRIAPIIVHFSMIIILIGAIIGSLSGFKAQEIVPKTETFHIQNVLNNGQFTF--
CCS1_PHATC      CYKGLIGRIAPILVHLSMILILVGTIVGSLFGFKAQEIVPKTENFHIQNILANGQLTV--
CCS1_EMIHU      AYSGLLGRVGPILVHFSILFVLFGSACGALGGYTVQEIVPRGEIFHLQNLVKSGNLSK--
CCS1_PORPU      CYKGLLGRLAPIFVHASIILLLIGSVLGLVSGFSAQEMVPSGELFRLQNIIASGQFSY--
CCS1_PYRYE      GYKGLLGRLAPIFVHGSIILLLTGSVLGLVSGFSAQEMVPSGELFRLQNIISSGKFSY--
CCS1_GRATL      AYKGLSGRIAPIVVHFSIILTFIGSLISLLGGFTAQEIIPTGEIFHIKNIIQSGFNSE--
CCS1_PROMA      ARKGLIGRVGPPLVHFGLILLIIGATYGVLKGQRLEKFLAPERSLNLLSPNGI-------
CCS1_PROM4      ARKGVIGRFGPPLVHFGLIFLMIGATLGALEGQRVEKFLEPGKSIDLISPDGI-------
CCS1_PROM1      ARQGVIGRLGPILIHLGMILLMIGATYGSLNGKTIEKFLAPGRSIDLLNNNEE-------
CCS1_PROMT      ARQGVIGRLGPILIHLGMILLMIGATYGSLNGKTIEKFLAPGRSIDLLNNNEE-------
CCS1_PROM3      ARRGIIGRVGPMLVHLGLVLLMLGAVWGSLGGNRLEQFLAPGRSLDLLNRDGN-------
CCS1_PROMM      ARRGIIGRAGPMLVHLGLVLLMLGAVWGSLGGNRLEQFLAPGRSLDLLNRDGN-------
CCS1_SYNSC      ARRGAIGRVGPLLVHTGLVLLMLGAAWGALAGNRLERFLAPGRSLDLLDRDGT-------
CCS1_SYNPX      ARKGVIGRVGPLLVHTGMVLLMLGAVWGALAGNRLERFLAPDRTLDLLSPRGD-------
CCS1_SYNS9      ARKGTAGRVGPLLVHTGLILLMLGAVWGVLAGNRLERFLAPGRTLDLLSRDGD-------
CCS1_SYNS3      ARRGVIGKVGPLLVHTGLVLLLIGAAWGALSGNRLERFLAPGRALDLLDPSGN-------
CCS1_SYNPW      ARRGVVGRVGPLLVHTGLVLLLIGAAWGALAGQRLERFLAPGRSLDLLDPAGA-------
CCS1_PAUCH      ARRGIAGRVGPLMVHTGLVILMLGAVWGVLGGHRLERFLAPGREMELLNSHGK-------
CCS1_SYNR3      ARRGVIGRVGPLLVHTGLIVFMVGAVVGAFGGQRLERFLAPGRSLELLNPQGD-------
CCS1_PROM2      ARRGLIGKIGPLVVHIGLIILLIGSAYGSFTSQSKEQYLLPGESLDLVNESTN-------
CCS1_PROM9      ARRGLIGKIGPLVVHIGLIVLLLGSAYGSFTSQSNEQYLLPGESLDLVNESTN-------
CCS1_PROMS      ARKGLIGKIGPLVVHIGLIVLLIGSAYGSFTSQSKEQYLLPGETLNLVNESTN-------
CCS1_PROM0      ARKGLIGKIGPLVVHIGLIVLLIGSAYGSFTSQSKEQYLLPGESLDLINESTN-------
CCS1_PROM5      ARKGLVGKLGPIIVHIGLIILLIGSAYGNFSSQSKEQYLRLGESLDLINENKN-------
CCS1_PROMP      ARKGLEGKLGPIIVHIGLIILLIGSAYGNFSSQSKEQYLRLGESLDLINESTN-------
CCS1_CYACA      -FDKNLDKAGPLLIHLSLILILLGSAIHAFNDFIAQEMIPIYEVSHIQNVISSGRISK--
                      .: .* .:* .::  : *       .   :                        

CCS1_SYNE7      IPQDWAVKVNRFWIDYAPDGRIDQFYSDLSVVDREGQEQDR---------QTIHVNQPLR
CCS1_SYNP6      IPQDWAVKVNRFWIDYAPDGRIDQFYSDLSVVDREGQEQDR---------QTIHVNQPLR
CCS1_THEEB      IPQDWSVKVNRFWIDYTDAGEIDQFYSDLSIQDAKGQEVKR---------GTIHVNRPLR
CCS1_ACAM1      IPRDWAVQVNRFWIDYTPEGQIDQFYSDLSIVDEDKNELDR---------QTIHVNQPLK
CCS1_NOSS1      FPQDWSVRVNRFWIDYTPKGGIDQFYSDMSVLDNQGQEVDH---------KKIFVNQPLR
CCS1_TRIV2      FPQDWSVRVNRFWIDYTPKGGIDQFYSDMSVLDNQGKEVDH---------KKIFVNQPLR
CCS1_NOSP7      VSKDWSVRVNRFWIDYTPSGGIDQFYSDMSVLNKQGEEVDH---------KKIFVNEPLR
CCS1_TRIEI      IPKNWSVRVNRFWIDYTPSGGIDQFYSDLSILDKSGEEVDR---------KTIFVNQPMR
CCS1_CROS5      IPKDWGIRVNRFWIDYTPDGTIDQFYSDLSVINNDGEELKH---------KTIYVNEPLR
CCS1_MICAN      LPKDWGIKVNRFWIDYSPKGDIEQFYSDLSVIDNQGQEIDR---------KTIQVNQPLH
CCS1_SYNY3      IPKDWGIKVNRFWINYTENGAIDQFYSDLSVVNNQGEELDR---------QTISVNHPLR
CCS1_SYNP2      SDRPWSVNVNRFWIDYTPTGDIDQFYSDLSVVDGEGQELER---------KTISVNHPLR
CCS1_SYNJB      LPT-WQIRANRFWIDYAADGRVKQFYSDLSILD-QGQEVKR---------QTISVNHPLS
CCS1_SYNJA      LPT-WQIRVNRFWIDYAPDGRVKQFYSDLSILD-GGQEVKR---------QTISVNHPLS
CCS1_GLOVI      RPPDWTVRVNKFWIDYRPDGSVDQFHSDLSVVSPAGKELER---------KTISVNDPLI
CCS1_GUITH      VLDTYEAYVNDFKIAYNSQGLIDQFYSDL-ILETRQASKIQ---------KTIYVNEPLN
CCS1_RHDSA      VPQNFEGYVKDFKIAYNDEGSIDQFYSDLSILNSTGEEVRS---------KTIYVNEPLR
CCS1_HETA4      LSQ-QAIRVNDFWINYYPNNKIKQFYSNLSIINGDGQEVRS---------KTISVNKPLI
CCS1_HETA2      LSQ-QAIRVNDFWINYYPNNKIKQFYSNLSIINGDGQEVRS---------KTISVNKPLI
CCS1_TRICV      IPK-VVSRVNDFWITYTKQATVAQFYSDVSILNTEGNEIVR---------KTIFVNSPIK
CCS1_THAPS      IPK-VSVRINDFWITYTKQTTITQFYSDLSILNIDGNEIDR---------QTIFVNSPAK
CCS1_PHATC      IPK-TSARINDFWITYTKTKTVSQFYSDISILNKQGNEIER---------KTISVNHPLI
CCS1_EMIHU      IPQYLSWRVNDFWITYTEEAKVNQFYSDLSILDVKGQEVKR---------KIIFVNEPLV
CCS1_PORPU      IPQDFSARVNNFIIEYNQDNSISQFFSDISILDTEGTELKH---------STIHVNSPLQ
CCS1_PYRYE      IPQEFSARVNDFNIEYNPNKSISQFFSDISILNSEGKELKR---------STIYVNKPLE
CCS1_GRATL      IPNNITGKIKDFDIKYGPDNSVEQFVSKIIIYNNQGKNINQ---------KQVSVNSPLI
CCS1_PROMA      --SKVSVKLTDFKIDRDPTGKPEQFRSKLELHNNNINKSIY---------EEISVNHPLR
CCS1_PROM4      --NKLKIKLKDFQILRLPNGQPEQFLSKVELSDGSNQQPIS---------REISVNHPLR
CCS1_PROM1      --KGLTIELQKFQIERDPQGRAEQYKSIVNVIEPNGSN-ES---------KEISVNYPLR
CCS1_PROMT      --KGLTIELQKFQIERDPQGRAEQYKSIVNVIEPNGNN-QS---------KEISVNYPLR
CCS1_PROM3      --SHLKLTLTNFGIERDPAGRPEQFRSQLELLEPGQDTAKL---------HEVSVNHPLR
CCS1_PROMM      --SHLKLTLTNFGIERDPAGRPEQFRSQLELLEPGQDTAKL---------HEVSVNHPLR
CCS1_SYNSC      --SQLTITLDRFAIDRDPAGRTEQFRSALKLQGPNQSLDA-----------EISVNHPLR
CCS1_SYNPX      --SQLSITLQDFQIERDPAGRPEQFRSLLALS--DSETPE-----------EISVNHPLR
CCS1_SYNS9      --SQVSILLEAFQVDRDPAGRAEQFRSQLHLEENGNSLDR-----------EISVNHPLR
CCS1_SYNS3      --NRLSLTLERFAIERDPAGRTEQFRSTLRLDPPGGPSEQ----------RMISVNHPLR
CCS1_SYNPW      --NRLSLTLENFSITRDPAGRAEQFQSTLTLSPPGQEDER----------RTISVNHPLR
CCS1_PAUCH      --SQLNIALESFQIERDPVGRPEQYRSQLRLRELGNSRENNSGSIDKSLNREISVNHPLR
CCS1_SYNR3      --TRLELQLDSFAIQRDPAGRPEQFSSQLLLRDGTGAPAQP---------AAVSVNHPLR
CCS1_PROM2      --SKANVKLVDFSIERESDGIPKQFISKLNFYSEDLNLNEI---------KTAKVNHPIR
CCS1_PROM9      --SKANIKLVNFSIERESDGIPKQFISKLNFSSEDLNINEI---------KTAKVNHPIR
CCS1_PROMS      --SRANVKLVDFSIERESDGVPKQFISKLNFSSENLNLNEI---------KTTKVNHPIR
CCS1_PROM0      --SKANIKLVDFSIERESDGIPKQFISKLDFTSEDSKFNEV---------KTAKVNHPIR
CCS1_PROM5      --SKFTIKLNNFLIERESDGKPKQFISYLNFFSEEQHLNEI---------KTTQVNHPIR
CCS1_PROMP      --SRVKIKLKNFFIERESDGKPKQFISNLEFFSKQQNLNEI---------KTTQVNQPIR
CCS1_CYACA      IPQTISLKASAFTVEHENEKVVKQFITNLAMLNSKGEVLKQ---------GLVSVNHPLV
                           * :         *: : : .                       ** *  

CCS1_SYNE7      YGGLTFYQADWAIAAAQVRLNNSPVLQLPMAQLPAA--G--RIWGTFVPTK---PDLSSG
CCS1_SYNP6      YGGLTFYQADWAIAAAQVRLNNSPVLQLPMAQLPAA--G--RIWGTFVPTK---PDLSSG
CCS1_THEEB      YGGVSLYQADWGIAAIRFRLNRSPVLQLPMAPLDTG--GKGRLWGTWLPTR---PDLSAG
CCS1_ACAM1      HKGVTLYQADWSIAGVRVQLNNSPVLQLPMAPLEAA--G-GRIWGTWVPTK---PDLSAG
CCS1_NOSS1      YHGVTFYQTDWGISGVRVRLNKSPIFQLPMALLNTN--GQGRIWGTWIPTK---PDLSEG
CCS1_TRIV2      YHGVTFYQTDWGISGVRVRLNKSPIFQLPMALLNTN--GQGRIWGTWIPTK---PDLSEG
CCS1_NOSP7      YRGITFYQTDWGIAGVRVQFNNSPIFQLPMALLNTK--GQGRIWGTWVPTK---PDLSEG
CCS1_TRIEI      YHGVTMYQADWAIAAVKVRVNKSPVFRLPMAQLNTE--GGGKIWGTWVPIK---PDLSEG
CCS1_CROS5      YHGVTFYQTDWGIAGVQAQVNNSPIFQLPMALLNTN--GNGRIWGTWIPTK---PDLSEG
CCS1_MICAN      HKGVTFYQTSWGIAGVKVQVNNSPILQLPMASLDTK--GNGQIWGTWIPTK---TDLSEG
CCS1_SYNY3      HRGVTFYQTNWGIAGVKVQLNNSPVLQLPMAPLQTA--NGGQLWGAYIPTK---TDFSEG
CCS1_SYNP2      YDGITFYQTSWSIGGVQVQLNNSPIFQLPAAQIPTE--NGAKLWGSWVPIK---PDMSAG
CCS1_SYNJB      YRGVTLYQADWSIDSIRIRINNSPTFQIPVVPVRTE--AGNKLWGAFVPTQ---PDMSQG
CCS1_SYNJA      YRGVTLYQADWSIDSIRIRLNNSPPFQIPVVPVPTQ--AGSKLWGAFVPTR---PDLSEG
CCS1_GLOVI      YDGVTMYQASWAVGAFKLRLNDSPVLTIPMQPIEAP--NGQEAWGQAIPFD---KDGRVA
CCS1_GUITH      YSNITIYQTDWNIDNLVICIDNQNYYSIPLQFIELPNGSESKYWINRLDL------FGQS
CCS1_RHDSA      YEGIVFYQTDWSITNLAINVDQQTNIQLPLKSINVK--GEGKFWIASLPIANVEKATNDN
CCS1_HETA4      YKDLTFYQTDWNLLGLRISHN-NKNFQIPVIQTTQN---LNKVWLTWLPLE---SNTSKN
CCS1_HETA2      YKDLTFYQTDWNLLGLRISHN-NKNFQIPVIQTTQN---LNKVWLTWLPLE---SNTSKN
CCS1_TRICV      YNNIDFYQTDWNVIGLRVQNDTSSILQYPLINLTNA---GNKVWVTWIPSD---SEFKKG
CCS1_THAPS      YNGIDYYQTDWNIIGLRLRMQDSSIFQYPFINLPNT---QEKLWLTWISTN---QQLNDG
CCS1_PHATC      HNGVYYYQTDWNLVGLRFKTMANEIIEYPLINFSEN---Q-KIWLTWISTN---KSLTEG
CCS1_EMIHU      YNGVSVYQTDWDILGLKLKLNDQQTIQVPLNKISKS---GRNFWLGSVFLD---GNSKQK
CCS1_PORPU      FKGLTIYQTDWDIIAIRIKINNTDTLQIPLKKVVLP--NN-KIWVGLIAQD------QDN
CCS1_PYRYE      FHGLTIYQTDWDIIAIRVRINNGNILQIPLKSVLLP--NNNKIWIGVLFQE------KES
CCS1_GRATL      LKGITFYQTDWKIDTLRFKIGNSKIIQQPIIKYKIN--NQ-ILWSCRLPLN------KEK
CCS1_PROMA      FQGITLYQADWSLAAITIQINNSPKIQFPLNKIDEL---GDQVWGIVLPQMP-----DSD
CCS1_PROM4      FQGLTIYQADWALSGINMQFGNSPKLQLPLKAIPEL---GEQVWGISLPDL------DNA
CCS1_PROM1      YKGLTLYQADWSLAAITIQIDNSPKLQIPIEPISEL---GEQVWGTVIPTN------KDG
CCS1_PROMT      YKGLTLYQADWSLAAITIKIDNSPKLQIPIKPISEL---GEQVWGTIIPTN------KDG
CCS1_PROM3      FHGLTVYQADWSLAAITLQLGRSPLLQLPLRTFPEL---GEQVWGLVLPTN------PDG
CCS1_PROMM      FHGLTVYQADWSLAAITLQLGRSPQLQLPLRTFPEL---GEQVWGLVLPTN------PDG
CCS1_SYNSC      HRGITVYQADWSLATISLQIGRSPVLELPLQTYPEL---GDQIWGLVLPTR------PDG
CCS1_SYNPX      HRGITIYQADWALAAIGVQIGRSPELQLPLQTYPEL---GDQVWGLVLPTR------PDG
CCS1_SYNS9      HRGITIYQADWSLAAITLQIGRSPQLQLALRSFPEL---GEQVWGLVLPTR------PDG
CCS1_SYNS3      YRGMTVYQADWSLAAITVQIGKSPELQLPLRSFPEL---GEQIWGLVLPTR------PDG
CCS1_SYNPW      YQGMTVYQADWSLAAVTVQIGKSPMLQLPLSTFPEL---GDQVWGLVLPTR------PDG
CCS1_PAUCH      YGGMTVYQADWALAAITVQLGRSPLLQLPLEQFPQL---GEQVWGVVLPTQ------QDG
CCS1_SYNR3      HRGITVYQADWGLAAVTMQLGQSPLLQLPLQTFPEL---GEQVWGLVLPTR------PDG
CCS1_PROM2      LKGLTIYQADWAISTVVLEID-NILYQLQLKEIPEI---GNQVWGVLVELG------SET
CCS1_PROM9      FKGLTIYQADWAISNVVLEID-NILYQLQLKEIPEI---GNQVWGVLVELG------SET
CCS1_PROMS      FKGLTIYQADWAISNIVLEID-NILYQLQLKEIPEI---GNQVWGVLVELG------SET
CCS1_PROM0      FKGLTIYQADWAISNIVLEID-NILYQLQLKEIPEI---GNQVWGILIELG------SET
CCS1_PROM5      FRGLTIYQADWSVSNIVLEID-SVLYQLKLKPIPEI---GDQIWGLLIELG------REN
CCS1_PROMP      FKGLTIYQADWSVSNIVMEID-SVLYQLQLKPIPEI---GDQIWGLLIELG------REN
CCS1_CYACA      YKQVYIFQMDWKLFGIRVNYGKNKIYEFPVQKIEAN---NEQQWSCTIPAK--------N
                   :  :* .* :                              *   :            

CCS1_SYNE7      V---SLIAKDLQGTAVIYGSNGEPLGTLRKGMAIEVEGI---------RLSLVDLVGSTG
CCS1_SYNP6      V---SLIAKDLQGTAVIYGSNGEPLGTLRKGMAIEVEGI---------RLSLVDLVGSTG
CCS1_THEEB      V---SLIARDLQGTVLLYGPKGEFLTSLRTGMSTEVNGV---------TLTLVELVGSTG
CCS1_ACAM1      V---TLLTTDLQGTVVVYDESGKLVSTVRTGMSTDVNDI---------SLKLVELVGSTG
CCS1_NOSS1      V---SLLAKDLQGMVLIYDAQGKLVDTVRAGMSTQVNGV---------TLKVLDVVGSTG
CCS1_TRIV2      V---SLLAKDLQGMVLIYDAQGKLVDTVRAGMSTQVNGV---------TLKVLDVVGSTG
CCS1_NOSP7      V---SLLAKDLQGMVLIYDPNGKLVDTVRAGMSTQVNGV---------KLKILDVIGSTG
CCS1_TRIEI      V---SLLAKDLQGNVLVYDTSGKLVASVREGMFIEVSGV---------TLFIDKIIGSTG
CCS1_CROS5      V---SLLAKDLQGTMMVYDQKGDLYSAVRPGMILDINGV---------RLKIYQLIGSTG
CCS1_MICAN      V---SLLTRDLQGTVIVYDAQGDLTSAVREGMTIPINGV---------NLKIVELVGSTG
CCS1_SYNY3      A---ALLVKDLQGTMIIYDQEGNLTDAVRAGSTVEINGV---------NITIKELVGSTG
CCS1_SYNP2      V---SILMQDLQGSAIVYNEQGELVGAVRVGDRLDVGDI---------SLKLVDLVGSTG
CCS1_SYNJB      L---TLLLPDLQGTALLYDTEGQWMGSLRQGMSLALDEVAPQRFPNPLTLYLDEVIGATG
CCS1_SYNJA      L---TLLLPDLQGTALLYDTQGQWIGSLRQGMSLALDEVAPQRFPNRLTLHLDEVIGATG
CCS1_GLOVI      L---QMVTRGLQGSLMLLPFNPRTGETVREAATPARVGKPVSVLGQ--RLVIEELVGQTG
CCS1_GUITH      V---FCVVNDLTGIVYLYNQNKDLICISSLGEFITLNGH---------TITFNKLVASTG
CCS1_RHDSA      I---LLVLEDLTGKILLYSSNQQLLAIVNVGENISLNGH---------SVKVTDIISSTG
CCS1_HETA4      LSGETIIINNYKGTIYIYDNNGQLNKKIELSNFIE---NK--------NYKLIEFLSVTG
CCS1_HETA2      LSGETIIINNYKGTIYIYDNNGQLNKKIELSNFIE---NK--------NYKLIEFLSVTG
CCS1_TRICV      L---TILVDNLQGYCSIYDESGIFVGNLELNETFNL--NM--------PITLVDILSSTG
CCS1_THAPS      L---TILIDNLQGYCSVYNKVGKFIGNLELNESLKI--EN--------PITLIDILSSTG
CCS1_PHATC      V---VTIIDNLEGYCSIYNETGQFLGNIELNEIINL--KQ--------PLTLIEIISSTG
CCS1_EMIHU      I---TILLNDLTGNIYVYDNAGLLVATTKLGQLVVFPEDQ--------SLRFQEFLTTTG
CCS1_PORPU      Q--LALVLQDLQKQATLYNKSGEKIMSVTIGEKYFIDNN---------IIAFLSIVPSTG
CCS1_PYRYE      Q--LSVVLSDLQGQATIYNKNGKNILSINIGEKYIINNS---------TITFLNTIASTG
CCS1_GRATL      Y--IFLVIANLNDKISIYDISNNLLTSIKLDETIVVNNT---------TLKIVEIMTKTG
CCS1_PROMA      LKPLLLTLSSEQGPVRFFSEEGNPAGIGRPNGNPILIGTS--------KISIIDVIPSSG
CCS1_PROM4      GKSILLTISSETGPARFYSQEGKSITEITPGGNKEIINGL--------ETQVIEVLQSSG
CCS1_PROM1      KNQILLTVDSELGPVNIYDNDGTLLTKLSIN-KEEKVKGA--------LINIINIIPSSG
CCS1_PROMT      KNQILLTVDSELGPVNIYDNDGTLLTKLIIN-KEEKVKGA--------LIKIINIIPSSG
CCS1_PROM3      SEPVLLSLTSEAGPVQVFDATGERLASLRPAGPTAEVKGI--------PIRVVEVLPASG
CCS1_PROMM      SEPVLLSLTSEAGPVQVFDATGERLASLRPAGPTAEVKGI--------PIRIVDVLPASG
CCS1_SYNSC      TEPVFLSLESEQGPATVFDADGQQLARLRPGGPSAEVKGL--------PMRVDAVLPASG
CCS1_SYNPX      SEPVFLSLESEQGPVSVYDSDGSALTLLRPGGPAEEVKGL--------PLRVASVLPASG
CCS1_SYNS9      SEPVFLSVENEQGPINIFDTDGTLLTLLRPGGPAVDVKGL--------PMRVNSVLPASG
CCS1_SYNS3      SEPVLMSTSSEQGPVQVFDADGSLLGNLRPGGASTEIKGL--------PLRVANIMPASG
CCS1_SYNPW      SEPVFLSTSSEQGPVQVFGSDGALITNLRPGGEGTEVRGL--------PLKVIDILPASG
CCS1_PAUCH      SNPVLLALSSEKGPIEVFASDGSLITTLRPGGVAATINDV--------KVRVESILPASG
CCS1_SYNR3      SDPVLLALQSELGPVEVYGADSQQLGLLTVGGESQEILGL--------PLRIADVMPASG
CCS1_PROM2      KNNFLLTIDNENGPLKISNIENFSGENLYLNDDPLEVNSS--------KVSLKKVIPSSG
CCS1_PROM9      KKNFLLTIDNENGPLKISNVENFSGNNLYINDRPLEVNSS--------KVSLKKIIPSSG
CCS1_PROMS      KKNYLLTIDNENGPLKISNIENFSGNNLYINEDPLEVNSS--------KVSLKKIIPSSG
CCS1_PROM0      KKNFLLTIDNENGPLKISNTENFSGNNLYINENPLEVNSS--------KVSLKKIIPSSG
CCS1_PROM5      KKNYLLTIDNENGPLKVSNIKDFSEMFIYLNDDPIEINSS--------KLSLKKIIPSSG
CCS1_PROMP      KKNYLLTIDNENGPLKVSNIEDFSENFVYLNNNPIEINSS--------KLSLKKIIPSSG
CCS1_CYACA      QSKLILIFKNMSDEFYVYDNNQNFLKIGKINTPQLIRNTY---------FTVISKISGTG
                         .      .                                  .   :  :*

CCS1_SYNE7      LQIKSDPGIPWVYAGFLFVMVGVVCSYVSHAQVWA-----LEQD------GQLYIGGRSN
CCS1_SYNP6      LQIKSDPGIPWVYAGFLFVMVGVVCSYVSHAQVWA-----LEQD------GQLYIGGRSN
CCS1_THEEB      LQIKADPGIPLFYAGFALLMAGVIMSYVSHSQVWG-----LQEN------QRLYLGGRTN
CCS1_ACAM1      LQIKSDPGIPWIYAGFGLLMIGVIMSYVSHSQIWL-----LTAD------DQLYVGGRTN
CCS1_NOSS1      LQIKADPGIPIVYTGFGILMLGVVMSYFSHSQIWA-----LQKG------DRLYVGGKTN
CCS1_TRIV2      LQIKADPGIPIVYTGFGILMLGVVMSYFSHSQIWA-----LQKG------DRLYVGGKTN
CCS1_NOSP7      LQIKADPGIPIVYSGFGLLMLGVVMSYFSHSQIWA-----LQKG------DLLYVGGKTN
CCS1_TRIEI      LQIKADPGIPIVYLGFGLLMLSVLMSYVSHSQIWA-----FQES------ERLYIGGKTN
CCS1_CROS5      LQIKADPGIPFVYTGFGLLMMGVIMSYVSHSQIWV-----LQED------EHCYIGGKTN
CCS1_MICAN      LQIKADPGVPIVYLGFALLMMGVVMSYFSHSQIWA-----LQSG------DRFYIGGKTN
CCS1_SYNY3      LQIKADPGIPFVYLGFGLLMVGVMMSYVSHSQVWL-----LSVDGDGQ--REIYLGGRTN
CCS1_SYNP2      LQIKADPGVPVVYTGFLLVMLGVVMSYVSYSQVWA-----LAAG------DRFYLGGKTN
CCS1_SYNJB      LQIKSDPGIPAVYLGFGLLMVGVVMSYFSYSQIWA-----LQTE------TGLYLGGKTN
CCS1_SYNJA      LQIKSDPGIPLVYLGFGLLMLGVAMSYFSYSQVWA-----LETE------AGLYLGGKTN
CCS1_GLOVI      IQIKADPGIPVVYAGFALLMVGLAMSYLSHSQVWA-----IYRD------GQLHVAGRTN
CCS1_GUITH      LQFKLDSFIPLVYLGFLLLMISTLLSYISYSQVWL-----VKNG------STTYIFGSTN
CCS1_RHDSA      LQIKSDPGIPFVYIGFFLLMLSITLSYFSYSQVWA-----IKDN------KTLYVSGRTN
CCS1_HETA4      IQIKSDPGILFIYFGFGFLMVSTILSYLSFSQVWLGIDYLEQNNI------KLTVNAKTN
CCS1_HETA2      IQIKSDPGILFIYFGFGFLMVSTILSYLSFSQVWLGIDYLEQNNI------KLTVNAKTN
CCS1_TRICV      LQIKTDPGILLIYTGFLFLMLSTLISYITYSQIWI-----IQTNR------QIFVGGNTT
CCS1_THAPS      LQIKADPGILLIYLGFLFLMISTLISYITYSQIWI-----VQDKN------KIFIGGNTT
CCS1_PHATC      LQIKTDPGIQIIYSGFFFLMLSTLISYITYSQIWI-----IQKEK------KLFIGGTTN
CCS1_EMIHU      LQLKEDPGLRLIYLSFFLVMVSIYISFLSYSQIWG-----FEKTD------EFILAGKSN
CCS1_PORPU      LQIKSDPGIPIVYTSFFFLITSVSVSYISYSQIWI-----IEKKH------RFYIGGVTN
CCS1_PYRYE      LQIKNDPGIPIVYASFFFLITSISVSYISYSQIWI-----VEKNR------HFYIGGVTN
CCS1_GRATL      IQVKTDPGIIVTYTGFFILMLSIVISYISYSQIWV-----TSIIQ------NIKIAGSTN
CCS1_PROMA      ILLKYDPGVPIVYLGFAISLIGSVFSIISTKQLWIIQ----EEESR-----LMHIGGLSN
CCS1_PROM4      ILIKYDPGVPLVYIGFAITLIGSLISIISTKMLWALW----EEENG-----LLFIGGLSN
CCS1_PROM1      LLLKHDPGVPLVYLSFAIILIGGSLSIISTKKIWVLH----ENEKS-----MIYIGGLSN
CCS1_PROMT      LLLKHDPGVPFVYLSFAIILIGGSLSIISTKKIWVLH----ENEKS-----MIYIGGLSN
CCS1_PROM3      LLLKRDPGVPLVYIGFLITLVGGGLSMIATRQLWAVG----DPENE-----CLHVGGLCN
CCS1_PROMM      LLLKRDPGVPLVYIGFLITLVGGGLSMIATRQLWAVG----DPENE-----CLHVGGLCN
CCS1_SYNSC      LLLKRDPGVPLVYLGFAVLLVGGGLSLVATRQLWAIA----ADGT-------LSVGGLCN
CCS1_SYNPX      LLLKRDPGVPLVYLGFAVLLLGGGLSLVATRQLWAVA----SDGQ-------LHVGGLCN
CCS1_SYNS9      LLLKRDPGVPLVYLGFAVMLIGGGLSLIATRQLWAIA----SEGQ-------LHVGGLCN
CCS1_SYNS3      LLLKRDPGVPLVYAGFAITLLGGGLSLIATRQLWAVL----DPAPFQPSNRKLHIGGLCN
CCS1_SYNPW      LLLKRDPGVPLVYAGFAITLLGGALSMVATRQIWVIS----DAV-----HQRLHIGGLCN
CCS1_PAUCH      LLLKRDPGVPLVYIGFAVALMGGGLSLISTRQIWAIA----ELEQQ-----RFHVGGLCN
CCS1_SYNR3      LLIKRDPGVPLVYAGFAITLLGGGLSLIATRQLWAIS----ESGR-------LHIAGLCN
CCS1_PROM2      LIIKNDPSIPFIYFSFILIIFGTIISLIPTNQLWILV----NKESQ-----KLSIGGLSN
CCS1_PROM9      LIIKNDPSIPFIYFSFILIIFGTIISLIPTNQLWIFV----NKESH-----KLSIGGLSN
CCS1_PROMS      LIIKNDPSIPFIYFSFILIIFGTIISLIPTNQLWILV----NKESQ-----KLSIGGLSN
CCS1_PROM0      LIIKNDPSIPFIYFSFILIIFGTIISLIPTNQLWILV----NQESQ-----SLSIGGLSN
CCS1_PROM5      LIIKNDPSIPFIYLAFTLIILGTIFSLIPTNQIWILF----NENSN-----KLFVGGLSN
CCS1_PROMP      LIIKNDPSIPFIYLSFTLIIVGTILSLIPTNQIWILF----NENTN-----KLFIGGLSN
CCS1_CYACA      LQIKKDSSINIVYTGFLLLIIGLVINHKGSKKRT--------------------------
                : .* *. :   * .* . : .   .                                  

CCS1_SYNE7      RALVAFEQEMLAVLAQLDAQSNHSAETAIA--------------
CCS1_SYNP6      RALVAFEQEMLAVLAQLDAQSNHSAETAIA--------------
CCS1_THEEB      RAQLAFEQELVAIARELAPPSQTTAVDL----------------
CCS1_ACAM1      RALLTFERELVEMIESSASDSALSPSTNPQPQEVA---------
CCS1_NOSS1      RAQVAFEQEVLDILERLNSQSATVINQQS---------------
CCS1_TRIV2      RAQVAFEQEVLEILERLSSQSATASNQQS---------------
CCS1_NOSP7      RAQVAFEQEVLEILDRLSSEPKIEEKETAIEV------------
CCS1_TRIEI      RANVTFEREILDILDRLGSDENISLEKQKQLFSDFSEGIKTSEN
CCS1_CROS5      RSQVTFERELLGIIESLEPEKT----------------------
CCS1_MICAN      RAQVSFEREIIDTIERLKLK------------------------
CCS1_SYNY3      RAQVAFEREILAIAEEAEVSSKTEAKVNA---------------
CCS1_SYNP2      RAQVAFERELLEIINTLETSHSQATPENTLTSIEQ---------
CCS1_SYNJB      RALVTFEREFDRLVEQQKVAFSLS---QIPVEAEIG--------
CCS1_SYNJA      RALVSFEREFARLVEQQLLSSPPSPAKEPPPAARVGGTESLANG
CCS1_GLOVI      RAQIGFERELVRMVAAVQTPRPRTSDALSAAQE-----------
CCS1_GUITH      RAKFAFIKQLTEIANQC---------------------------
CCS1_RHDSA      RAIYSFEQQITKMMNKLNSTYA----------------------
CCS1_HETA4      RTKVLLTTQMYKITKNKR--------------------------
CCS1_HETA2      RTKVLALTVRIQPFL-----------------------------
CCS1_TRICV      RATFDFEIEFLKLIK-----------------------------
CCS1_THAPS      RATFEFELEFLKLIK-----------------------------
CCS1_PHATC      RAVFDFELEFFKIIK-----------------------------
CCS1_EMIHU      RAVLAFQEDFKKDVKEILNTLKFN--------------------
CCS1_PORPU      RAQLTFEEELLKISNRSSKI------------------------
CCS1_PYRYE      RAQLMFEEELLKISKMSSSI------------------------
CCS1_GRATL      RATLTFEEEIINIQEIYTQYTWS---------------------
CCS1_PROMA      RNLSGFANQFNSIIKAAYD-------------------------
CCS1_PROM4      RNLSGFANDFPTLLKVIKSS------------------------
CCS1_PROM1      RNLSGLSKELPNLISFLEN-------------------------
CCS1_PROMT      RNLSGLSKELPNLISFLET-------------------------
CCS1_PROM3      RNLTGFANELPSLLASITPASQH---------------------
CCS1_PROMM      RNLTGFANELPSLLAAAVPQQ-----------------------
CCS1_SYNSC      RNLAAFATELPQLLQQVVVDQQG---------------------
CCS1_SYNPX      RNLAAFAQELPLLLQRVVAREQHDSPQSVQSS------------
CCS1_SYNS9      RNLTAFSKELPSLLRQTALAHQQG--------------------
CCS1_SYNS3      RNLAGLAAELPRLISRVDESRD----------------------
CCS1_SYNPW      RNLLGFAAELPELINRVDVSHG----------------------
CCS1_PAUCH      REFTNFAQELPQFISEIQQI------------------------
CCS1_SYNR3      RNLVAFADELPKLGSSAITGAPHDAR------------------
CCS1_PROM2      KNLVGFKKEFFKLSEQIKNF------------------------
CCS1_PROM9      KNLVGFKKEFFKLSEEIKNF------------------------
CCS1_PROMS      KNLVGFKKEFFKLSDEIKNF------------------------
CCS1_PROM0      KNLVGFKKEFFKLSEEIKNF------------------------
CCS1_PROM5      RNLLGFKKEFQKLSDEIKNN------------------------
CCS1_PROMP      RNLLGFKKEFLKLSDEIKNN------------------------
CCS1_CYACA      --------------------------------------------