CLUSTAL format seed alignment for MF_01393

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATP6_STRA3       ------------------------------------------------------------
ATP6_STRMU       ------------------------------------------------------------
ATP6_STRR6       ------------------------------------------------------------
ATP6_BACSU       ------------------------------------------------------------
ATP6_BUCAI       ------------------------------------------------------------
ATP6_BUCAP       ------------------------------------------------------------
ATP6_BUCBP       ------------------------------------------------------------
ATP6_WIGBR       ------------------------------------------------------------
ATP6_ECOLI       ------------------------------------------------------------
ATP6_PROMH       ------------------------------------------------------------
ATP6_PECAS       ------------------------------------------------------------
ATP6_AERHH       ------------------------------------------------------------
ATP6_AERS4       ------------------------------------------------------------
ATP6_BAUCH       ------------------------------------------------------------
ATP6_BLOFL       ------------------------------------------------------------
ATP6_BLOPB       ------------------------------------------------------------
ATP62_PHOPR      ------------------------------------------------------------
ATP62_VIBCB      ------------------------------------------------------------
ATP6_SHESW       ------------------------------------------------------------
ATP6_PSYIN       ------------------------------------------------------------
ATP6_SHEFN       ------------------------------------------------------------
ATP6_ALIFM       ------------------------------------------------------------
ATP61_PHOPR      ------------------------------------------------------------
ATP6_ALTMD       ------------------------------------------------------------
ATP6_PSEHT       ------------------------------------------------------------
ATP6_COLP3       ------------------------------------------------------------
ATP6_PSEA6       ------------------------------------------------------------
ATP6_IDILO       ------------------------------------------------------------
ATP6_MANSM       ------------------------------------------------------------
ATP6_PASMU       ------------------------------------------------------------
ATP6_HAEDU       ------------------------------------------------------------
ATP6_HISS2       ------------------------------------------------------------
ATP6_PSEAE       ------------------------------------------------------------
ATP6_PSEPK       ------------------------------------------------------------
ATP62_HAHCH      ------------------------------------------------------------
ATP6_MARMS       ------------------------------------------------------------
ATP6_CHRSD       ------------------------------------------------------------
ATP6_ACIAD       ------------------------------------------------------------
ATP6_PSYWF       ------------------------------------------------------------
ATP6_RUTMC       ------------------------------------------------------------
ATP6_THIDA       ------------------------------------------------------------
ATP6_PSEMY       ------------------------------------------------------------
ATP6_PSEU5       ------------------------------------------------------------
ATP6_MARHV       ------------------------------------------------------------
ATP6_ALKEH       ------------------------------------------------------------
ATP6_HALHL       ------------------------------------------------------------
ATP61_METCA      ------------------------------------------------------------
ATP6_CHRVO       ------------------------------------------------------------
ATP6_COXBR       ------------------------------------------------------------
ATP6_MYCTU       ------------------------------------------------------------
ATP6_MYCLE       ------------------------------------------------------------
ATP6_AQUAE       ------------------------------------------------------------
ATP6_HYDS0       ------------------------------------------------------------
ATP6_SULSY       ------------------------------------------------------------
ATP6_HELAH       ------------------------------------------------------------
ATP6_HELHP       ------------------------------------------------------------
ATP6_CAMHC       ------------------------------------------------------------
ATP6_CAMC5       ------------------------------------------------------------
ATP6_CAMFF       ------------------------------------------------------------
ATP6_CAMJD       ------------------------------------------------------------
ATP6_WOLSU       ------------------------------------------------------------
ATP6_NITSB       ------------------------------------------------------------
ATP6_SULNB       ------------------------------------------------------------
ATP6_SULDN       ------------------------------------------------------------
ATP6_ARCB4       ------------------------------------------------------------
ATP6_DESOH       ------------------------------------------------------------
ATP6_SYNFM       ------------------------------------------------------------
ATP6_DESPS       ------------------------------------------------------------
ATP6_GEOUR       ------------------------------------------------------------
ATP6_GEOSL       ------------------------------------------------------------
ATP63_PELPD      ------------------------------------------------------------
ATP6_GEOLS       ------------------------------------------------------------
ATP62_PELCD      ------------------------------------------------------------
ATP61_PELCD      ------------------------------------------------------------
ATP6_SYNAS       ------------------------------------------------------------
ATP6_DESVV       ------------------------------------------------------------
ATP6_DESAG       ------------------------------------------------------------
ATP6_LAWIP       ------------------------------------------------------------
ATP6_KORVE       ------------------------------------------------------------
ATP6_SOLUE       ------------------------------------------------------------
ATP6_BDEBA       ------------------------------------------------------------
ATP6_SORC5       ------------------------------------------------------------
ATP6_TRIV2       ------------------------------------------------------------
ATP6_SYNE7       ------------------------------------------------------------
ATP6_TRIEI       ------------------------------------------------------------
ATP6_NOSP7       ------------------------------------------------------------
ATP61_ACAM1      ------------------------------------------------------------
ATP6_MICAN       ------------------------------------------------------------
ATP61_SYNP2      ------------------------------------------------------------
ATP6_THEEB       ------------------------------------------------------------
ATP6_PROMM       ------------------------------------------------------------
ATP6_PROMP       ------------------------------------------------------------
ATP6_SYNS3       ------------------------------------------------------------
ATP6_SYNR3       ------------------------------------------------------------
ATPI_PAUCH       ------------------------------------------------------------
ATPI_PSINU       ------------------------------------------------------------
ATPI_ADICA       ------------------------------------------------------------
ATPI_SPIOL       ------------------------------------------------------------
ATPI_WELMI       ------------------------------------------------------------
ATPI_CHAGL       ------------------------------------------------------------
ATPI_STAPU       ------------------------------------------------------------
ATPI_CHLAT       ------------------------------------------------------------
ATPI_CHAVU       ------------------------------------------------------------
ATPI_MESVI       ------------------------------------------------------------
ATPI_NEPOL       ------------------------------------------------------------
ATPI_TETOB       ------------------------------------------------------------
ATPI_OLTVI       ------------------------------------------------------------
ATPI_OEDCA       ------------------------------------------------------------
ATPI_STIHE       ------------------------------------------------------------
ATPI_CHLVU       ------------------------------------------------------------
ATPI_TUPAK       ------------------------------------------------------------
ATPI_BIGNA       ------------------------------------------------------------
ATPI_EUGGR       ------------------------------------------------------------
ATPI_CYACA       ------------------------------------------------------------
ATPI_RHDSA       ------------------------------------------------------------
ATPI_PYRYE       ------------------------------------------------------------
ATPI_TRICV       ------------------------------------------------------------
ATP6_SYNJA       ------------------------------------------------------------
ATP6_GLOVI       ------------------------------------------------------------
ATP61_CHLTE      ------------------------------------------------------------
ATP61_PELLD      ------------------------------------------------------------
ATP6_RHOFT       ------------------------------------------------------------
ATP61_PROA2      ------------------------------------------------------------
ATP6_NITMU       ------------------------------------------------------------
ATP62_ACAM1      ------------------------------------------------------------
ATP61_CROS5      ------------------------------------------------------------
ATP62_SYNP2      ------------------------------------------------------------
ATP62_METCA      ------------------------------------------------------------
ATP62_PELPD      ------------------------------------------------------------
ATP61_HAHCH      ------------------------------------------------------------
ATP6_LEGPC       ------------------------------------------------------------
ATP62_BRASB      ------------------------------------------------------------
ATP6_MOOTA       ------------------------------------------------------------
ATP6_RICB8       ------------------------------------------------------------
ATP6_RICCK       ------------------------------------------------------------
ATP6_ORITI       ------------------------------------------------------------
ATP6_ANAMM       ------------------------------------------------------------
ATP6_ANAPZ       ------------------------------------------------------------
ATP6_WOLPM       ------------------------------------------------------------
ATP6_WOLTR       ------------------------------------------------------------
ATP6_EHRRW       ------------------------------------------------------------
ATP6_NEOSM       ------------------------------------------------------------
ATP6_SINMW       ------------------------------------------------------------
ATP6_AGRFC       ------------------------------------------------------------
ATP6_RHIL3       ------------------------------------------------------------
ATP6_CHESB       ------------------------------------------------------------
ATP6_RHILO       ------------------------------------------------------------
ATP61_OCHA4      ------------------------------------------------------------
ATP6_BART1       ------------------------------------------------------------
ATP6_PARL1       ------------------------------------------------------------
ATP6_AZOC5       ------------------------------------------------------------
ATP6_XANP2       ------------------------------------------------------------
ATP6_BEII9       ------------------------------------------------------------
ATP6_RHOP2       ------------------------------------------------------------
ATP6_BRADU       ------------------------------------------------------------
ATP6_RHOPB       ------------------------------------------------------------
ATP6_BRASO       ------------------------------------------------------------
ATP6_NITWN       ------------------------------------------------------------
ATP6_METS4       ------------------------------------------------------------
ATP62_OCHA4      ------------------------------------------------------------
ATP6_HYPNA       ------------------------------------------------------------
ATP6_MARMM       ------------------------------------------------------------
ATP6_PELUB       ------------------------------------------------------------
ATP6_MAGSA       ------------------------------------------------------------
ATP6_RHORT       ------------------------------------------------------------
ATP6_ERYLH       ------------------------------------------------------------
ATP6_NOVAD       ------------------------------------------------------------
ATP6_SPHWW       ------------------------------------------------------------
ATP6_SPHAL       ------------------------------------------------------------
ATP6_ZYMMO       ------------------------------------------------------------
ATP6_ACICJ       ------------------------------------------------------------
ATP6_GRABC       ------------------------------------------------------------
ATP6_GLUDA       ------------------------------------------------------------
ATP6_GLUOX       ------------------------------------------------------------
ATP6_DINSH       ------------------------------------------------------------
ATP6_ROSDO       ------------------------------------------------------------
ATP6_RHOS5       ------------------------------------------------------------
ATP6_MAGMM       ------------------------------------------------------------
ATP6_ANASK       -MTAATLVTLALSLSLAQHDAAPAPAPAAVEQHGAAPEAAASADPHAAPAGEHGAAVEAH
ATP6_ANADF       -MTAASLVTLALSLSLAQAAGHAGEHGAPAPEVATPAEGHGARDAAGAATDPHGAAAEHG
ATP6_MYXXD       --MDSPYLEIEVPLSSPIHAFDFPQWHVPLKAGACAPRMTEHGE----------------
ATP62_CHLP8      ------MRVKANSKILALIVPVLLSLNSLVCANPVQEDMSAHESLPAAAAPAEVHAPVEV
ATP62_CHLTE      ------MRKKAISRILALVVPVLLSLNSQAFATSVQDE----SPVTGSAVEAVHTVPSTV
ATP6_CHLPD       MKQERTSKVKGLIKVIALVVPFLLNVN--AFASPAESAGVTHDSIAAVARTEGAHAGEAP
ATP6_PELPB       MKRVNVIQAKAFLKVIALLVPLLLNANGPAFALTEQASTPPHDSVASVSAPTAEAAVAA-
ATP6_CHLCH       MERSSIFQPKRFVKVFAVLLPLLFNGYSVSGANPTEAPVAQHTEVTANAAESAHVAEAGA
ATP62_PELLD      MKRVKVIQIKGFFRVMALLAPLLLNAYLPVQASEEHAAPVAAVVAAHAEAAVDPALEPAH
ATP62_PROA2      MKRVNVFRSGVFSRLFALLLPFLLGINGLVYASAE-----APAEAVHAEAA-------AH
ATP6_CHLPB       MKRFNAIRIGELVRIAVLVMPLLLGFGAPIYAAAEVHGEAGAHEAAAVHTDEAHGEAGEH
ATP6_CHLT3       MIYLHNKRKGMLKRLSALIVIGLLMNLPAVFASGGEHAEAAHGDAAHAEAAHGG------
ATP6_ELUMP       ------------------------------------------------------------
ATP6_MYCGE       ------------------------------------------------------------
ATP6_MYCPN       ------------------------------------------------------------
ATP6_MYCGA       ------------------------------------------------------------
ATP6_RUBXD       ------------------------------------------------------------
ATP6_PARUW       ------------------------------------------------------------
ATP6_FRACC       ------------------------------------------------------------
ATP6_PAEAT       ------------------------------------------------------------
ATP6_DESRM       ------------------------------------------------------------
ATP6_CLOAB       ------------------------------------------------------------
                                                                             

ATP6_STRA3       --------------------------------------MESTSNPTVSFLGI--------
ATP6_STRMU       --------------------------------------MEKTINPTVKFLGI--------
ATP6_STRR6       --------------------------------------MEESINPIISIGPV--------
ATP6_BACSU       ---------------------------------------MNHGYRTIEFLGL--------
ATP6_BUCAI       ------------------------------MILEKISDPQKYISHHLSHLQIDLRS----
ATP6_BUCAP       ------------------------------MSLEKISNPQKYISHHLNHLQIDLCN----
ATP6_BUCBP       ------------------------------MNLEHNFNLPNYINHHLHHLQLNLSN----
ATP6_WIGBR       -----------------------------MTIYNQSLSSKEYISHHLKNLQIDLRT----
ATP6_ECOLI       -------------------------------MASENMTPQDYIGHHLNNLQLDLRT----
ATP6_PROMH       -----------------------------MSASGEALTTRDYIGGHLNNLQLDLRT----
ATP6_PECAS       ------------------------------MAAGEISTPQEYISHHLHHLQVG-------
ATP6_AERHH       -----------------------------MSATGEVLTPQGYISHHLTHLQVG-------
ATP6_AERS4       -----------------------------MAATGEALTTQGYISHHLHHLQVG-------
ATP6_BAUCH       -----------------------------MLKLVDNTTTRDYISHHLSHLQLNLNN----
ATP6_BLOFL       -------------------------------MLSTKSVTQKYIEHHLSNLQFDLKN----
ATP6_BLOPB       -------------------------------MSGIKGTSQEYIGHHLYHLQFDLST----
ATP62_PHOPR      --------------------------------MDNVSSAHEYIEHHLTFLTLG-------
ATP62_VIBCB      --------------------------------METVQSAHEYIEHHLTFLTAG-------
ATP6_SHESW       -----------------------------MATTGEALNASEYIQHHLTNAKMCSTD----
ATP6_PSYIN       -----------------------------------MLTSSGYIQHHLTNAQMCTVD----
ATP6_SHEFN       -----------------------------MSATGEEMTQQSYIQHHLTNLTV--------
ATP6_ALIFM       -----------------------------MAAPGEALTQSGYIEHHLTNLSLAK------
ATP61_PHOPR      -----------------------------MAAPGEALTSSSYITHHLTNLAVG-------
ATP6_ALTMD       --------------------------------MASEYTTSEYIKHHLTNATMCSTD----
ATP6_PSEHT       -------------------------------MAAEEVTLSSHIQHHLTNAKMCSTD----
ATP6_COLP3       ------------------------------MSSGAVLTSQEYITHHLSNLKV--------
ATP6_PSEA6       -----------------------------MAGSAGEQTISGYIQHHLTNASV--------
ATP6_IDILO       -------------------------------MISGEQTPTQYIQHHLQNWTV--------
ATP6_MANSM       ---------------------------------MSGQTTSEYIGHHLQFLKT--------
ATP6_PASMU       --------------------------------MAAELTTAGYIGHHLAFLKT--------
ATP6_HAEDU       ----------------------------------MAVNTAEYIGHHLSFLSS--------
ATP6_HISS2       ---------------------------------MAGHTTADYISHHLTFLTT--------
ATP6_PSEAE       -----------------------------MAAE----TASGYIQHHLQNLTFGRLP----
ATP6_PSEPK       -----------------------------MAAE----TASGYIQHHLQNLTYGQLP----
ATP62_HAHCH      -----------------------------MAGEN--PTASEYIQHHLQNLTFGNHP----
ATP6_MARMS       -----------------------------MGIES--PTASSYIKHHLQNLTYGQHP----
ATP6_CHRSD       -----------------------------MAGNN--PTSSEYIQHHLQNMTFGLHP----
ATP6_ACIAD       -----------------------------MAAEEHALTSTEYIKHHLTNLTYGKMP----
ATP6_PSYWF       -----------------------------MAAE---ITSTDYIAHHLTNWTYGYLP----
ATP6_RUTMC       -----------------------------MSATNEVITSGSYIKHHLQNLTYGQFP----
ATP6_THIDA       -------------------------------MATEYASSGEYIKHHLQNLTYGQHA----
ATP6_PSEMY       ------------------------------MAD----TPAEYIQHHLQNLVYGSHP----
ATP6_PSEU5       ------------------------------MAS----TPAEYIQHHLQNLTYGKLPAGYE
ATP6_MARHV       -----------------------------MAAD----TPVEYIKHHLTNLTYGKLPEGYE
ATP6_ALKEH       -----------------------------MSGNT----ALDYIQHHLTNLAV--------
ATP6_HALHL       -----------------------------MSADSE-FDATDYIQHHLTNLRLDLTE----
ATP61_METCA      ---------------------------MATEAHDA-GGATGYIVHHLTPLSS--------
ATP6_CHRVO       -----------------------------MASNA-----TDYIKHHLTFWNSD-------
ATP6_COXBR       ------------------------------MYAQPKLTSAEYVQHHMSHWKLNLYN----
ATP6_MYCTU       -----------------------------MTETILAA-QIEVGEHHTATWL---------
ATP6_MYCLE       -----------------------------MTETILSGGQIEVGEHHTTTWF---------
ATP6_AQUAE       --------------------------------------------MEYS------------
ATP6_HYDS0       -------------------------------------------MEHYE------------
ATP6_SULSY       --------------------------------------------MEQH------------
ATP6_HELAH       ----------------------------MEHRVFTVANFFS-SNHDFI------------
ATP6_HELHP       ----------------------------MDERLFTFAGLIN-PNHDFI------------
ATP6_CAMHC       ---------------------------MLKDIFLFWGSLFG-YDHTAI------------
ATP6_CAMC5       ----------------------------MKDLFLFSDLIY--HNHLFV------------
ATP6_CAMFF       ----------------------------MKELFLFSDMIM--HSHTFN------------
ATP6_CAMJD       ----------------------------MKDLFLFSSLLD--ASHTFS------------
ATP6_WOLSU       ----------------------------MNDIFTFAGLID--HSHDFI------------
ATP6_NITSB       ----------------------------MEGIFTFFGVIS--ENHTFL------------
ATP6_SULNB       ----------------------------MEGVFTYLGGILGEDSHSAV------------
ATP6_SULDN       ----------------------------MGELFTFFGLIS--HDKTFI------------
ATP6_ARCB4       ---------------------------MEGRLFTFLGAIGG-HGQEWI------------
ATP6_DESOH       ----------------------------MEHPYLFFVKLFEALGFEHFAHT---------
ATP6_SYNFM       ----------------------------MEHPILFLNLLFEKLGLHVVGPEQ--------
ATP6_DESPS       ----------------------------MEHPILFISIILEKLGLPVPHGPV--------
ATP6_GEOUR       ----------------------------MVHPYLFLQFFR-KLLEPLHISEA--------
ATP6_GEOSL       ----------------------------MVHPLLFLQFFR-KLLEPLHISEA--------
ATP63_PELPD      ----------------------------MVHPFLFLEFLR-KMLAPLHLSEA--------
ATP6_GEOLS       ----------------------------MVHPLLFLQFLSTKLQHLLHISDA--------
ATP62_PELCD      ----------------------------MTHPFVLLKWLIAKLHFGFSAEML--------
ATP61_PELCD      ----------------------------MTHPFLFLKWLVEHFTQGTSLENL--------
ATP6_SYNAS       -----------------------------MHSLSFLANPYVPSH----------------
ATP6_DESVV       ----------------------------MAGGLPHPVLWSTLLNVDTITIGG--------
ATP6_DESAG       ----------------------------MASGLPHPVLLSDLVGLGHINVGG--------
ATP6_LAWIP       ----------------------------MAEQLPEPVLLSELLHMDKVTIAG--------
ATP6_KORVE       ------------------MPHQLWFTAFLNQYLAGPVSAMMSVLHVPNPHPR--------
ATP6_SOLUE       ---------------------------MFNDHLAGAGNALTGIVGMA-PEAR--------
ATP6_BDEBA       ------------------------MSFNWTQLVPGVGHEYAHVATLGIAT----------
ATP6_SORC5       ------------------MPEHTGFLTYLLAQLPGLRENARNIGKTFIGHHT--------
ATP6_TRIV2       -----------------------------MLNFLNFYSV-PLAELEVGKHLY--------
ATP6_SYNE7       -----------------------------MPTLLELSSVLPLAELEVGQHFY--------
ATP6_TRIEI       -----------------------------MLDVLNTINFLPLAELEVGQHFY--------
ATP6_NOSP7       ---------------------------MQMLSVLNAFNSFPLAELEVGHHFY--------
ATP61_ACAM1      ---------------------------------------MPLASLEVGQHLY--------
ATP6_MICAN       -----------------------------MLDSLSVLNFYSLASLEVGQHWY--------
ATP61_SYNP2      -----------------------------MLNSLTTFSLFPLAELEVGKHFY--------
ATP6_THEEB       -----------------------------MMPLIDLWTALPLAKLEVGHHFY--------
ATP6_PROMM       --------------------------------MGFLPIALPFAELEVGQHLY--------
ATP6_PROMP       --------------------------------MFLNSLPTNFAALEVGQHLY--------
ATP6_SYNS3       --------------------------------MALLPFTLPLAELEVGHHLY--------
ATP6_SYNR3       -----------------------------------MLLHLPLAELEVGHHLY--------
ATPI_PAUCH       --------------------------------MVPLSFPFHVAELEVGQHLY--------
ATPI_PSINU       -------------------------MNIEKHLISLINDLCQISGVEVGQHFY--------
ATPI_ADICA       -------------------------MQIEQLQINEIDNLHQVSSVEVGQHLY--------
ATPI_SPIOL       -------------------------MNVLSYSINPLKGLYAISGVEVGQHFY--------
ATPI_WELMI       -------------------------MHIIQNTITILNNFVDISGVEVGQHLY--------
ATPI_CHAGL       ------------------------------MQQNHESLLFQLSSVEVGQHYY--------
ATPI_STAPU       -------------------------MYITEASIDSYSSLYQISAVEVGQHFY--------
ATPI_CHLAT       ------------------------MYSLNPSQIEASNLLYQVSSVEVGKHLY--------
ATPI_CHAVU       ---------------------------MYNLCYIQNLLEYQIAAVEVGQHLY--------
ATPI_MESVI       --------------------------MINPSSMENFNMLYQLSKVEVGQHFY--------
ATPI_NEPOL       --------------------------------MYAMNPLYDMCAVEVGQHYY--------
ATPI_TETOB       ------------------------------MSDFLLNPFSEIAEVSVGQHFY--------
ATPI_OLTVI       ---------------------------MLTMSTLVSNPLFELSEVSVGQHFY--------
ATPI_OEDCA       ---------------------MIEHIFIFNNSTSLSNPVFDISEVAVGQHLY--------
ATPI_STIHE       ---------------------------MLNLQNVIINPLFEISEVSVGEHYY--------
ATPI_CHLVU       ----------------------------------MTNIWFDVAEVSVGQHWY--------
ATPI_TUPAK       --------------------------MVDKIMNSTANLLFDFAEVSVGQHYY--------
ATPI_BIGNA       ------------------------------MNFFYYKDFYQLSEISVGQHYY--------
ATPI_EUGGR       ----------------------MKIVLLYYFVNMFISGIFQIANVEVGQHFY--------
ATPI_CYACA       ----------------------------------MISNNLEICSIDIGVHWY--------
ATPI_RHDSA       ---------------------------MYQDSFYILNSAFSLSEIEVGAHLY--------
ATPI_PYRYE       ---------------------------MYQNSLIDFNPYNSLSAVEVGKHLY--------
ATPI_TRICV       ---------------------------MYPDNFYS-STFTLLAEAEVGKHFY--------
ATP6_SYNJA       -----------------------------MNLFFS--APPLVAELEVGHHLY--------
ATP6_GLOVI       ----------------------------MELALATLGNQPLIAAVEVGKHLT--------
ATP61_CHLTE      ------------------------------------------MHLSSDEVIL--------
ATP61_PELLD      ------------------------------------------MHLSGDEIII--------
ATP6_RHOFT       ------------------------------------------MRLSPDEIIF--------
ATP61_PROA2      ------------------------------------------MHLSGDDVIV--------
ATP6_NITMU       ------------------------------------------MHISPDQLIF--------
ATP62_ACAM1      ------------------------------------------MHLTPDQTIF--------
ATP61_CROS5      ------------------------------------------MDITPDSIIY--------
ATP62_SYNP2      ------------------------------------------MQITPDNIIF--------
ATP62_METCA      -----------------------------------------MEQIDFFARVL--------
ATP62_PELPD      --------------------------------------------MLETTQAL--------
ATP61_HAHCH      ------------------------------------------MNDGVSTPVW--------
ATP6_LEGPC       -----------------------------------------MGEEGFLAHFA--------
ATP62_BRASB      -----------------------------------------MQSSPLTSTLL--------
ATP6_MOOTA       -------------------------------------------MTHVRPVEI--------
ATP6_RICB8       -------------------------MLHN-----------PLVQFDIKKL----------
ATP6_RICCK       -------------------------MTLN-----------PLVQFDIKKL----------
ATP6_ORITI       -------------------------MLAN-----------PLSQFLIKPI----------
ATP6_ANAMM       ---------------------------MS-----------PLEQFRVTKL----------
ATP6_ANAPZ       ---------------------------MS-----------PLEQFKVVRL----------
ATP6_WOLPM       -------------------------MALN-----------PLEQFKVYTI----------
ATP6_WOLTR       -------------------------MALN-----------PLEQFKIHTI----------
ATP6_EHRRW       -------------------------MSAN-----------PLDQFRISTI----------
ATP6_NEOSM       ---------------------------MS-----------PLKQFEIFPL----------
ATP6_SINMW       -------------------------MSND-----------PTHQFLVNKI----------
ATP6_AGRFC       -------------------------MAND-----------PTHQFLVQPI----------
ATP6_RHIL3       -------------------------MSSD-----------PTHQFLIQKI----------
ATP6_CHESB       -------------------------MATD-----------PIHQFQISKL----------
ATP6_RHILO       -------------------------MAADK--------VDPIHQFHIIKL----------
ATP61_OCHA4      -------------------------MAND-----------PIHQFQVSRW----------
ATP6_BART1       -------------------------MTAHA--------PDPIHQFEVSRL----------
ATP6_PARL1       -------------------------MATGAEQTGGGFPVDPLHQFVVQPL----------
ATP6_AZOC5       -------------------------MTVD-----------PIHQFEIQRY----------
ATP6_XANP2       -------------------------MTVD-----------PIHQFEIKRY----------
ATP6_BEII9       ---------------------MAEPHEID-----------PIHQFHIDRI----------
ATP6_RHOP2       -------------------------MAAD-----------PIHQFQITKL----------
ATP6_BRADU       -------------------------MKID-----------PIHQFNIEPL----------
ATP6_RHOPB       --------------------------MID-----------PIHQFNIEKI----------
ATP6_BRASO       --------------------------MID-----------PIEQFHLNKI----------
ATP6_NITWN       --------------------------MMD-----------PIHQFNIEPI----------
ATP6_METS4       -----------------------MAVKLD-----------PIHQFELKPL----------
ATP62_OCHA4      --------------------------MAG-----------PIEQFAIKPI----------
ATP6_HYPNA       ----------------------MPAIALD-----------PIHQFEVTKW----------
ATP6_MARMM       ------------------------MADTN-----------PIKQFEVHEV----------
ATP6_PELUB       -------------------------MATN-----------PMNQFEVYRI----------
ATP6_MAGSA       --------------------------MAN-----------PIEQFKIQPL----------
ATP6_RHORT       --------------------------MHS-----------PVEQFAIKPL----------
ATP6_ERYLH       -------------------------MAAE------SGKVDPMKQFSIEPMLG--------
ATP6_NOVAD       -------------------------MAE--------GKVDPVHQFTIETLFG--------
ATP6_SPHWW       -------------------------MAAE------SGKIDPMHQFMIEPLF---------
ATP6_SPHAL       -------------------------MAAE------SGKIDPMHQFEVTPL----------
ATP6_ZYMMO       -------------------------MAA-------TNNVDPMHQFTVEPL----------
ATP6_ACICJ       -------------------------MAQES-------GINALGQFQLTTG----------
ATP6_GRABC       -------------------------MAAEP-------TIDALGQFRLHHG----------
ATP6_GLUDA       -------------------------MAAGS-------TIDALGQFELHPV----------
ATP6_GLUOX       -------------------------MAAGS-------TIDALGQFELHPV----------
ATP6_DINSH       --------------------------MATEEGT--GLTFYPMDQFIVSPLFGD-------
ATP6_ROSDO       -------------------------MADKAEGG--GLVFKPMEQFEITALFG--------
ATP6_RHOS5       -------------------------METEVEHT--GLAIHPMDQFIVRKLFCHTESASP-
ATP6_MAGMM       -----------------------MSAEAMHAAASAAPKMDPLHHFMVQKV----------
ATP6_ANASK       AAAAGEHGE--AAGHEGGHDESLGAVMLHHVTDGYVIEHPGFCNGAFAWNCEWDLRATFG
ATP6_ANADF       AAAHEDPAQHGAAGAEAGHDESLGAVMMHHVADGYVLELPGFC-GGLSWACHVDLRDVFG
ATP6_MYXXD       -------------------------------------EIPGLM-----------------
ATP62_CHLP8      HNAAGTHVETAHESAVEGHEEKAGDVIMHHVQDSNVLAFEPFGEIELPHLQ---------
ATP62_CHLTE      AAPVAGHAEAAAGQAAKA-EEKPGDLIMHHILDNSTFSFEPFGEVHLPHLE---------
ATP6_CHLPD       HGEAAGHGEE-----------KAGDVIMHHILDSNVYSFEPFGEIVLPKIV---------
ATP6_PELPB       ----HAHGEE-----------KAGDVIMHHILDNDVFSFEPFGEVHLPKIPP--------
ATP6_CHLCH       AHGAEGHGEE-----------KAGDVIMHHILDSNVIAFDPFGEVDLPKIV---------
ATP62_PELLD      AEP-AGHEDE-----------KAGDVIMHHILNSHSFSFEPFGTIHLPTLPP--------
ATP62_PROA2      AE--GGHES-------------AGDVIMHHILDTGVMSFEPFGEVHLPQIV---------
ATP6_CHLPB       AE--GGHGEG-----------GAGDVIMHHILDSNAMEFEPFGKFPLPKIV---------
ATP6_CHLT3       ----GAHHDP------------EKLDAIHHVIDGHEFDFEPFGIVHLPKIE---------
ATP6_ELUMP       ----------------------MIEEILTHHIIDHKLTYKLFG-----------------
ATP6_MYCGE       -------------------------------MSPREIVLKETNQIDFISN----------
ATP6_MYCPN       -------------------------------MSPRAIVLKEPNGVNLVPH----------
ATP6_MYCGA       -------------------------------MLPQEIVYTKLSSTETQNGWIDFL-----
ATP6_RUBXD       -----------------------MEVTQEELRHEILHTWEAAREAWVIHLEI--------
ATP6_PARUW       --------------------------MIMGQYLFWLANAHEPIENRIPELPNFISV----
ATP6_FRACC       -----------------------------MPVLADEGFEGPTKEVFQTPHWF--------
ATP6_PAEAT       -----------------------MIALALPAQDSGSFTPPGIDEMHLPAILP--------
ATP6_DESRM       -----------------------MSAAAGAAQAAEHHDMLHMVEMDLNFWNIPLFT----
ATP6_CLOAB       ---------------------------------------MELGAKTVFSMKL--------
                                                                             

ATP6_STRA3       -----------------------------DFDLTILAMSLLTITIIFILVFWASRKMTIK
ATP6_STRMU       -----------------------------EFDLTILMMSLLVVLIAFLFVFWTSRHLKIK
ATP6_STRR6       -----------------------------IFNLTMLAMTLLIVGVIFVFIYWASRNMTLK
ATP6_BACSU       -----------------------------TFNLTNILMITVASVIVLLIAILTTRTLSIR
ATP6_BUCAI       --------------FKIIQ-PGALSSDYWTVNVDSMFFSLVLGSFFLSIFYMVGKKITQG
ATP6_BUCAP       --------------FKFVE-PGKIVSHFWVLNIDSIIFSLVLGCFFLSIFYTVAKKITTG
ATP6_BUCBP       --------------LKFLNFNDNYIRNFWVCNFDSIFLSIFLGLVILISFFKISKTFTIQ
ATP6_WIGBR       --------------FKIVQ--ENDSSSFWFLNIDSLFFSFFLGIIFLLFFNYISKKFTIG
ATP6_ECOLI       --------------FSLVDPQ-NPPATFWTINIDSMFFSVVLGLLFLVLFRSVAKKATSG
ATP6_PROMH       --------------FELVNPHAENTPSFWVLNIDSLFFSVLMGLLFLWIFRKVAVKATSG
ATP6_PECAS       -------------------------TGFWSINVDSMFFSIALGILFLVIFHRVAKRATSG
ATP6_AERHH       -------------------------SGFWTVNIDSMIFSVLLGALFIWSFRRVAVKATSG
ATP6_AERS4       -------------------------SGFWTVNIDSMIFSVILGALFIWIFRKVAATATSG
ATP6_BAUCH       --------------FTLVNHP--DIKSFWILNIDSIFFTLLLGIIFLLIFFYTAKTATSG
ATP6_BLOFL       --------------LTLVQSH--ENMSFWVLNIDSLFFSVLLCLLFLVIAGFVAKYSTVS
ATP6_BLOPB       --------------FSLVSSE--NTSSFWVLNVDSMFFSILLATLFLLIFGRLATVATYA
ATP62_PHOPR      -------------------------KGFWSINIDSMIMVWMVGLLFIGVFRYVAIRGTKG
ATP62_VIBCB      -------------------------DGWFGINLDSMIMVWLTGLVFILSFRYAVTKGTKG
ATP6_SHESW       --------------GGVAFNHACQDAGFWTWHIDSLLFSVGLGVLFLWLFYKTGQKATAG
ATP6_PSYIN       --------------GSIAFNYACADAGFWTWHIDSLLFSVGLGVLFLFVFYKVGQKATTG
ATP6_SHEFN       ------------------------GEGFWTWNIDSLLFSVGLGMLFLWLFYRAGKKATTG
ATP6_ALIFM       ------------------LGLVADEASFWNVHIDSLFFSVFTGMLFLWVFRSVAKKATTG
ATP61_PHOPR      ------------------------DGGFWTVHIDSLFFSVLTGLAFILVFHSVAKKATSG
ATP6_ALTMD       --------------NGIAFNKACSDAGFWAWHVDTLAWSIGLGLLFLIIFRSVASKATTG
ATP6_PSEHT       --------------AGLAFNKACADSGFWTWHVDTLAWSIGLGLIFLWIFRSAAKKSTLG
ATP6_COLP3       ------------------------GEGFWAVHLDSLGWSVFLGLVFLTIFRSVAKKATSG
ATP6_PSEA6       ------------------------GEGFWTFHVDTLAWSVVLGLVFILSFRAVAKKASAG
ATP6_IDILO       ------------------------GEGFWAVNVDTIFWSVLLGVLFLWSFRRVAKKSSAG
ATP6_MANSM       ------------------------GDSFWNVHIDTLFFSVLAAIIFLAVFRSVAKKATSG
ATP6_PASMU       ------------------------GDSFWHVHLDTLLFSIISGAIFLFVFSKVAKKATPG
ATP6_HAEDU       ------------------------GDGFWAVHLDTLFFSLVAGVLFLVVFSRVAKNATTG
ATP6_HISS2       ------------------------GQGFWNVHLDTLFFSLVSGVLFLFFFYRIASKATSG
ATP6_PSEAE       ----------NGDWGFAHTAEQAKEMGFWAFHVDTLGWSVLLGVVFLFIFRLAAKKATSG
ATP6_PSEPK       ----------DGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFLLIFRMAAKKATSG
ATP62_HAHCH      ----------EHGWSFAHTAQEAKEMGFWAVHVDSLGWSIALGALFVWLFRKAAVKATSG
ATP6_MARMS       ----------DGTWGLAHDAKEAADMGFWAIHVDTMAISIALGFLFLWLFRKAAKKISAD
ATP6_CHRSD       ----------ENGLGLAHSAQEAQEMGFWAIHLDTMGWSIGLGVLFLWLFRSVAKSVSTG
ATP6_ACIAD       ----------DGTWKLAENAKEAQEMGFSAIHLDSMGWSIGLGIIFCLVFWCAAKAAKAD
ATP6_PSYWF       ----------GEGWKVAHTAKEAGEMGFMAIHLDSMLWSIGLGIVFCALFWLVAKKATAG
ATP6_RUTMC       ----------DGHWRFAHTTSEAKEMGFWAFHLDTLSISFILGALFLIFFYKVGKKMTSD
ATP6_THIDA       ----------DGTWGFAHGAEEAKAMGFWAINVDSMLFSIGLGVLFLFLFRLAAKKATVG
ATP6_PSEMY       ----------EKGWIIAQTPEEVKAMGFWAVHVDTLGWSLFMGLIFITLFRMAAKKAVTG
ATP6_PSEU5       RADGSIL--DQATWTIAQTGAEARDMGFMAVHLDTLGWSLLMGAIFILLFRSAAKAATAG
ATP6_MARHV       RADGSVV--QEATWTFARTGQEATDMGFMAIHVDTLGWSIAMGILFLGLFRFVANRVTEG
ATP6_ALKEH       ------------------------GEGYWTFHVDSLIMSFSLGALFCYLFWLGARRATAG
ATP6_HALHL       ------------------GTIDSEATGFWTLHIDTLIMSFGLGALFCYVFWLAARQATPG
ATP61_METCA      ------------------------GEGFWTLHVDTLFFSVFLGAVFLFFFRKAAEQATAG
ATP6_CHRVO       -----------------------PSAGFWSLHVDTFSISLVLGFLFAAVFAMVARRASIE
ATP6_COXBR       --------------------FTFTDGGFWTLNLDTLIISVVLGALFILIFYIVARRATAS
ATP6_MYCTU       --------------------------GMTVNTDTVLSTAIAGLIVIALAFYLRAKVTSTD
ATP6_MYCLE       --------------------------GMTVNTDTVLSTAIAAAIVIALAFFLRTKVNSTG
ATP6_AQUAE       ---------------------------------HVVYALLAVALAIIFVLKGGKP-SLK-
ATP6_HYDS0       ---------------------------------HVITSIVAMVVALGVVLAAGKP-KIM-
ATP6_SULSY       ---------------------------------VIMALTVLIVVPVIFTIFAKKP-SLI-
ATP6_HELAH       ---------------------------------TGFFVVLTAVLMFLISLGASRKMQMV-
ATP6_HELHP       ---------------------------------IGFHTLLVAVILLILARYATHKMQVV-
ATP6_CAMHC       ---------------------------------YIFHFLLVVAITMFIAVAVTKSMRLV-
ATP6_CAMC5       ---------------------------------YAFHFCLVAIIVVLVAKLATSKMQLV-
ATP6_CAMFF       ---------------------------------YLFHLILVAIIVLIVAKLATRSMQLV-
ATP6_CAMJD       ---------------------------------YFFHIGLVALIAVIVAMMATRSMQLV-
ATP6_WOLSU       ---------------------------------IGFHAVLTALIALFLAKMATRSLQVV-
ATP6_NITSB       ---------------------------------FVSHMFLAALLTLIVAKLATKRLQVV-
ATP6_SULNB       ---------------------------------LIAHLLLVAVIVIMIAKMATKSFRAV-
ATP6_SULDN       ---------------------------------YMTHMLLAAGIALMLVKMAMSNLKVV-
ATP6_ARCB4       ---------------------------------ILSHYVLVIGIIFIIARAATRKLQLV-
ATP6_DESOH       -------------------------------SVHIIYTWVVMALLITLGVLGARNIQIV-
ATP6_SYNFM       ----------------------AKSFGDFLLQPHVTYTWVVMLVLLGLGSMAAKGLEMV-
ATP6_DESPS       ----------------------GQTFLEKMCEPYMTYTWLVMAFLFLVSKFTLGNLEII-
ATP6_GEOUR       ----------------------GADA--------IAYTWLIIALLLILSMLATKGLKTV-
ATP6_GEOSL       ----------------------GADA--------IAYTWLIIVCLLIVSLIATKALKAV-
ATP63_PELPD      ----------------------SADA--------VSYTWLIIALLLLLSFLATRALKTV-
ATP6_GEOLS       ----------------------SANA--------VVYTWTVIVLLLVLSLIATRALKTI-
ATP62_PELCD      ----------------------EQHGF----FQHVTHTWLVMAILIGVGLLATHRAGLV-
ATP61_PELCD      ----------------------EHYGF----LVHVTHAWLIMLLLTGVALLLKRRLSEV-
ATP6_SYNAS       ----------------------------------VVYAWFIMALLILCGLLLRRGMEIL-
ATP6_DESVV       ----------------------ATVEF-----KHVFYTWCAMAILFSLGLIVRSSLKVV-
ATP6_DESAG       ----------------------QSVEF-----KHVFYTWCVMAMLFAVSFIVRGKIKMV-
ATP6_LAWIP       ----------------------QLVEF-----RHVFYTWIAMLILFIVGLIVRRKLTLV-
ATP6_KORVE       ----------------------A--PISNYVAMEILVFLLLVLFFIATRISLS-------
ATP6_SOLUE       -------------------------PWANFVTMQLLVVAIIVVLFAILRPRLS-------
ATP6_BDEBA       --------------------------------------VAAVGIGAAARASLGKGEAAV-
ATP6_SORC5       ----------------------VDYRGTEPIFMSLLIMVLFVLLASEVRGQYRRLNESV-
ATP6_TRIV2       ----------------------WQIGNLKLHGQVFLTSWFVIGVLVLASVAASSNVKRI-
ATP6_SYNE7       ----------------------WQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI-
ATP6_TRIEI       ----------------------WELGSFKIHGQILLTSWFVIALILLAAFISSLNVQRI-
ATP6_NOSP7       ----------------------WQLGNLKIHGQVFLTSWFVISILVVASIAATRNAQRI-
ATP61_ACAM1      ----------------------WQIGGLKVHGQVLITSWIVIGILVIVSVLATRKVERI-
ATP6_MICAN       ----------------------WHIGGLKIHGQVIAVSWIVFAILIIASIAATRKIQKV-
ATP61_SYNP2      ----------------------WELGGLKVHGQVLMTSWFVIAVLVLASILATRNVQRV-
ATP6_THEEB       ----------------------WYIGNLRVHGQVFITTWFVMALLIAVAFVASRNIQRV-
ATP6_PROMM       ----------------------WQIGNLQLHGQVFMTSWIVIGAILALVVVGTRKMERD-
ATP6_PROMP       ----------------------WQIGNIRLHGQVFLTSWILLGALLVFISVGTKKMEND-
ATP6_SYNS3       ----------------------WQIGNLNLHGQIFLSSWILIGALLAFVLVGTKNLSRD-
ATP6_SYNR3       ----------------------WQIGNLNIHGQVFLSSWIVIGALLAVVVLGTRKMERD-
ATPI_PAUCH       ----------------------WQIGNLNLHGQVFISSWVVISALLVLVITGTRKMERD-
ATPI_PSINU       ----------------------WQLGGFQVHAQVLITSWVVIVLLSGLAFVTTRDLRTI-
ATPI_ADICA       ----------------------WQIGNFQVHAQVLITSWVVVAILVALPATTTGNLQSI-
ATPI_SPIOL       ----------------------WQIGGFQIHGQVLITSWVVIAILLGSAAIAVRSPQTI-
ATPI_WELMI       ----------------------WQIGNFEVHGQVLLTSWFVLAVLLGLAVLTVRDPQTI-
ATPI_CHAGL       ----------------------WNIGSFQVHAQVLITSWFVLGLLLGIALIATRKLETI-
ATPI_STAPU       ----------------------WEIGDLRVHGQVLITSWVVIGILLTVAFLGTRKLETV-
ATPI_CHLAT       ----------------------WQLGMFQVHGQVLITSWVVMAIIIITSVIASRNLQPI-
ATPI_CHAVU       ----------------------WEIGNFEVHAQVLITSWIVIGLILGLTFLATQNLQFI-
ATPI_MESVI       ----------------------WQIGDFEVHGQVLLVSWFVMTIIISLSIFGTRNLQTI-
ATPI_NEPOL       ----------------------WLIAGYQVHAQVLITSWFVIGFLLIGCFVASRNLQEI-
ATPI_TETOB       ----------------------WQLGSYEVHGQVLLVSWFVLAVIFGLSFVGNSNLKST-
ATPI_OLTVI       ----------------------WNLGGNEVHGQVLLVSWFVLAVIIGFGLTANSNLKPT-
ATPI_OEDCA       ----------------------WQIGDYQLHGQVLITSWIVLGGVIIFTLLANSDLKPL-
ATPI_STIHE       ----------------------WEIAGYEVHGQVLLTSWFVLGTVILFGLIANKDLKPL-
ATPI_CHLVU       ----------------------WQLGGYSLHGQVLITSWIVVAVIGVICLLGTQNLQPVS
ATPI_TUPAK       ----------------------WQIGEYSVHGQVLMTSWFVFAVIAILSIAGNRDLKAI-
ATPI_BIGNA       ----------------------WQISNFQVHGQTLMTSWFVISLIMIIAFLSNLNMKKIP
ATPI_EUGGR       ----------------------WSILGFQIHGQVLINSWIVILIIGFLSIYTTKNLTLV-
ATPI_CYACA       ----------------------WNFLGLKIHGQVLLVSWVAIIILLLLAILGTFNMQKE-
ATPI_RHDSA       ----------------------WEVAGLKLHGQVFIVSWLVIAALIGFALVGTKDLKQA-
ATPI_PYRYE       ----------------------WKIGSLQLHGQVFIVSWLVIATLLTLSFLGTRNLQRI-
ATPI_TRICV       ----------------------WDIAGFLVHGQVLVVVWFVLALLLLFAVLGTRDIDRI-
ATP6_SYNJA       ----------------------WHLGKFTVHGQVLIASWIAIALILTVVLLGTRQLQRE-
ATP6_GLOVI       ----------------------WQLGPLSVHGQTMITTWVVMLLLIGLTFIGTRKLQRV-
ATP61_CHLTE      ----------------------WQSGFLKLN-LTIVTTWALMLLLAGGSALITRRLSTGI
ATP61_PELLD      ----------------------WQHGFVKLN-LTIATTWALMLVLVGGSAFASRRLSNGM
ATP6_RHOFT       ----------------------WQHGFLKLN-ATIVFTWGLMLVLAVGSKLITRKLSTGL
ATP61_PROA2      ----------------------WQYGVVKLN-QTIVMTWVIMVFLAGGSAFLTRRLSSGI
ATP6_NITMU       ----------------------WEYGFVKLN-GTIIYTWLLMLLLAVGSKTITKRLSRGE
ATP62_ACAM1      ----------------------WQWGLFSLN-ATLIFTWLVMGVLVVGSWFVTRHLSAST
ATP61_CROS5      ----------------------WQWQWINLN-ATIVFSWLVMLILVLGSWLITRNLSIEP
ATP62_SYNP2      ----------------------YQYQFVVIN-ATLVYTWLTMALLVIGAAWVTKKLVVRP
ATP62_METCA      ----------------------GHLGPVTVS-DSLLTSVLVAGLLSAASAVLTRRRTAL-
ATP62_PELPD      ----------------------FHLGPLAVG-TTVVTTWGIMVVLSLGAWLASRRLRLD-
ATP61_HAHCH      ----------------------LHIGPLEIH-ETVVTTWLIMLVLVVASILLTRRLSLQ-
ATP6_LEGPC       ----------------------FSIGGLPIT-QSVLTTWFIMISLFIMAWSTTYKCSLLQ
ATP62_BRASB      ----------------------FHIGPVAIT-RPVVTTWVIMAALALVCRFVTRRLAIL-
ATP6_MOOTA       ----------------------FHLGPIPIY-STVVNTWIIMILLLAGIFLATRKLSFI-
ATP6_RICB8       --------------------IDI-KVMDFDISFTNSAAYMLLASVLALTYFYLAFSNPR-
ATP6_RICCK       --------------------IEI-KIFGFDISFTNSSIYMLLASILALTYFYLAFYNWK-
ATP6_ORITI       --------------------IPL-EALGYNISITNSAVAMIFVSIAASMLLITAFVNSK-
ATP6_ANAMM       --------------------LDIPALWGIDLSFTNCSLVMVLASVSSILLLCWALRKIN-
ATP6_ANAPZ       --------------------LEIPMPFGMDISFTNCALFMILASLVSAVLLCCALRKRT-
ATP6_WOLPM       --------------------IELPRLFGYDVSFTNSSFFTMISVILMILFLLFGIKKGS-
ATP6_WOLTR       --------------------VELPKLFGHDINFTNSSLFMMISVVSVILFLLLGVRKGA-
ATP6_EHRRW       --------------------FKLPDIGEYNIDFTNASLFMVLSTFLISLSCYVGLRKES-
ATP6_NEOSM       --------------------IRLPEFFGWDINFTNSSLYMVLTVVFASLFLFAGVFRGK-
ATP6_SINMW       --------------------VSI-DIGGIDFSFTNASLFMVATVGAAAGFLYLTTSQRG-
ATP6_AGRFC       --------------------IPI-EIGGVDFSFTNASLFMVATVAAASGFLYFATSNRG-
ATP6_RHIL3       --------------------VPI-EIGGIDFSFTNASLFMAASAAIAAGFLYFATSNRA-
ATP6_CHESB       --------------------IPI-EIGGLDFSFTNSSLFMVATVAAAGAFLYLTTSSRG-
ATP6_RHILO       --------------------VPI-NIGGYDLSFTNSALFMVATVVVAAAFLFLTTSSRS-
ATP61_OCHA4      --------------------IPI-DVGGVDLSFTNVSAFMVATVVVASGFLYLTSSGRG-
ATP6_BART1       --------------------IKI-SIGNMDLSFTNVSLFTVVTVVITAAFLFISSSSRG-
ATP6_PARL1       --------------------IPL-NIGGLDASFTNASLWMVVTVVAIGLFMTLGMRSGA-
ATP6_AZOC5       --------------------VELLRVSGVTVSFTNSAAFMVGIVALIFFFLTYATRGRT-
ATP6_XANP2       --------------------VDLLNFGGVQFSFTNAALFMFGIVAIIFFFLTFATRGRT-
ATP6_BEII9       --------------------IPL-HFLGTDVSFTNAAFFMLVIVALASLVLLAGTRNHS-
ATP6_RHOP2       --------------------FSLGHIGGQEIAFTNSSAYMFAAVAIIAVMMLAP--GRQ-
ATP6_BRADU       --------------------FTIGHIGHQTIAFTNSSLYMLIAVAIISLLMLAS--GAQ-
ATP6_RHOPB       --------------------FTIGHIGGQEIAFTNSSAYMLVAVAVISLLMIGGVAGRQ-
ATP6_BRASO       --------------------FTIGHIGNQEIAFTTSSAYMLLAVVLIAAMMLGA--GRA-
ATP6_NITWN       --------------------FTIGHIGGQEIAFTNSSAYMFLAVALTSLLMLGT--GRR-
ATP6_METS4       --------------------VSFGHIGHQHIAFTQSALYMFAAVGIIALITLVATRQRA-
ATP62_OCHA4      --------------------VELGEIGGQPVAFTNSALFMVLTVLGAAAFMFLSSRRGT-
ATP6_HYPNA       --------------------LDL-RLGNIDISFTNASGFMLLGVVLVIGFFSMATRKGE-
ATP6_MARMM       --------------------FPF-EAFGLNLAFTNSSYFMVLTTVLTIVLFMVAMSSRA-
ATP6_PELUB       --------------------GPEIKLGAIDISFTNASLFMVISSLAILLIFNLGSKKNS-
ATP6_MAGSA       --------------------VPL-KVGSVDISFTNSSAMMVLSICLITLFLTLSVRSRA-
ATP6_RHORT       --------------------VSI-QVAGVDVSFTNSSLLMLLTVGLAAAFFWNATARRT-
ATP6_ERYLH       --------------------SEGWEIAGYNIAFTNSAAWMALTTVLLAVFVWGGM-KGQ-
ATP6_NOVAD       --------------------TDHWSIGGYNIAFTNSALWMAITTAVLIVFVAGGA-KRE-
ATP6_SPHWW       --------------------GQGWSIAGHNIAFTNSAMWMVVTLAALLIFMIGGM-KRD-
ATP6_SPHAL       --------------------GGGFNLGGQEVLFTNSALWMVVAAITLGLFMWGGM-RRQ-
ATP6_ZYMMO       ---------------------HGLHIGKYDISFTNSALWMVIAMAALAIFMAGGR-RKA-
ATP6_ACICJ       -----------------------FGAFGKAIEFTNSNEMMLLAAVIVTSLFVVALRQRA-
ATP6_GRABC       -----------------------LGPIGGLVNFTQSNEIMVLGTAIVLGIIALGMRQRA-
ATP6_GLUDA       -----------------------LGGLGESLRFSQSPVMMIVASVLVLAFLYVGMRPAA-
ATP6_GLUOX       -----------------------LGHLGEALRFSQSPLFMLIAAAVVLVFLYVGMRPAA-
ATP6_DINSH       -------------------------GPVHFYTPTNVTLWMALAVAAIALLLVAGTRGRA-
ATP6_ROSDO       -------------------------GDVTWYTPTNTALWMGFSIIAVVLLLVVGSSKRA-
ATP6_RHOS5       --------------------MNECTTNIHWYDITNVTMWMAIAVLVIAAILVLGTRRRA-
ATP6_MAGMM       ---------------------VPIEIAGIDLSITNSTIWMWLAVAVAFLFMKWSFRGRAE
ATP6_ANASK       D-------------------ALKFGKLDLTPTKHVIMMWLASALLLVVVLAAVR--KKSL
ATP6_ANADF       TEHVSEIDAHGHAVERNVSGPLVFGKVDMTPTKHVVMMWIASAILLLVVFAAVR--KKSL
ATP6_MYXXD       -----------------------DGCLDLSITKHTVMMWLAALLLMATLFIWGNRDKTKL
ATP62_CHLP8      -----------------------LGSLDISITKHVVMMWVAAVILILVGAAAGAGVKKIS
ATP62_CHLTE      -----------------------VAGFDISITKHVVMIWLAAILLVVIASAAGASVKKMS
ATP6_CHLPD       -----------------------VGGFDISITKHVVTLWVVSAIVLIVFTIIGSKYKTMS
ATP6_PELPB       -----------------------IAGVDISITKHVVMLWVVSAILLILFSLVGSKYKKMT
ATP6_CHLCH       -----------------------VAGFDISITKHVVMLWVVSAIVIALFAAANGQYKTGS
ATP62_PELLD      -----------------------VFGIDISITKHVVMLWIVSAILLVLFSFVGAAYRKIT
ATP62_PROA2      -----------------------IGGFDISITRHVVMMWIASAILLVVFLLVGNRYKTMT
ATP6_CHLPB       -----------------------IGGFDLSITRHVVFMWLAALILLLVFGYVGNKYKSIK
ATP6_CHLT3       -----------------------VGGFDISLTRHVVMMWIAAAILLLIMFGVGNQYKKMT
ATP6_ELUMP       ---------------------------VIPLSSNLITLFCITIGVFILFTLIAKFRRPVL
ATP6_MYCGE       --------------QSIFDISPISGWKPFAPTDQILGIFIVFVLLLTFFIFYKLKLKKAD
ATP6_MYCPN       --------------EGIFDISPVAGWKPLLPTDQVFGIFVVFIVLLTLFLVYWIKLRKAD
ATP6_MYCGA       --------------TTKPLASQGIEWTPLIPTAHVLSIFMVLFMIAILTAVYYTKLKKLK
ATP6_RUBXD       ------------------------AGINLSINKPVWFLWLGAAITFLFMYVGARTLRDR-
ATP6_PARUW       ---------------LYHRFQHTTWAQFLHRWENIIFAILVASLISLVAYLGARKKEII-
ATP6_FRACC       ----------------------DVGIGSVNLYLNKATALTIFAALFVGVIFWLGFRRAKI
ATP6_PAEAT       --------------------------WGAHDGFSKQMLLVILSVVIIATFFILAARKQQ-
ATP6_DESRM       -----------------EYDKYWHIMGLSISPRTMIMTWITMALVLLFAWACTKNQNVRS
ATP6_CLOAB       ------------------------GSYNFAITETVVLQWIIMAVIILLAIFLTKNLKKV-
                                                                             

ATP6_STRA3       -------PKGKQNVLEYVYELVNNTISQNL--GH---YTKNYSLLMFILFSFVFVANNLG
ATP6_STRMU       -------PTGRQNVLEWIYDFVLGIIKPNL--GS---YTKNYSLFAFCLFLFVFVANNIG
ATP6_STRR6       -------PKGKQNVLEYVYDFVIGFTEPNI--GSR--YMKDYSLFFLCLFLFMVIANNLG
ATP6_BACSU       -------PGKAQNFMEWIVDFVRNIIGSTM--DLK--TGANFLALGVTLLMYIFVSNMLG
ATP6_BUCAI       I------PGKLQTAIELIFEFVNLNVKSMY-QGK----NALIAPLSLTVFIWVFLMNLMD
ATP6_BUCAP       V------PNGLQASIELIFDFIRSNVKSMY-QGK----NPLIAPLSLTVFVWVFLMNLMD
ATP6_BUCBP       T------PNKIQICIELIIDFINNNVKEIY-HGK----NKLIAPLSLTIFVWIFLMNLMD
ATP6_WIGBR       T------PGRIQASIEILVEFINSNVKDIFGHNT----NKIIPPLSLTIFVWLFLMNLMD
ATP6_ECOLI       V------PGKFQTAIELVIGFVNGSVKDMY-HGK----SKLIAPLALTIFVWVFLMNLMD
ATP6_PROMH       V------PGKFQTAVEMVIGFVDSSVRDMY-HGK----SKVIAPLALTVFVWVLLMNALD
ATP6_PECAS       V------PGKLQTAVELLIGFVDGTVRDMF-HGK----SKLIAPLALTIFVWVFLMNMMD
ATP6_AERHH       V------PGKLQCFVEMLVEFVSGNVKDIF-HGR----NKVIAPLGLTVFVWIFLMNLMD
ATP6_AERS4       V------PGKLQCFVEMVVEFVDDTVKGIF-HGK----SKLIAPLALTVFIWVFLMNLMD
ATP6_BAUCH       I------PSKLQTIVELLVSFIDKNVNDIL-FCK----NKLIAPLALTIFIWIFLMNLMD
ATP6_BLOFL       V------PGKLQAFVELIISFVDGCVKDMF-HGT----SKLISPLSMTVFVWIILMNSMD
ATP6_BLOPB       V------PTKLQVFIELVILFIDSNVKDMF-HGK----NKLIAPLSMTVFVWIFLMNTMD
ATP62_PHOPR      V------PGRLQCFIEITFDFVNNLVKEIF-KTE----DKLIGPLALTIFVWVFLMNSID
ATP62_VIBCB      V------PGRFQCLIEIIFEFVDDIVKEIF-QAK----DKLIGPLALTIFVWVLLMNAVD
ATP6_SHESW       V------PGKLQCFVEMCVEGVDKIAKESF-HGK----NVVIAPLALTIFIWVFLMNFMD
ATP6_PSYIN       V------PGKLQCAVEMLMEFVSNAVKDSF-HGR----SPVIAPLALTIFVWILLMNTMD
ATP6_SHEFN       V------PGKFQCFVEIIVEFVDSSVKETF-HGR----NPVIAPLALTIFVWIFMMNFMD
ATP6_ALIFM       V------PGKLQCFVEMIVEFVADNVKETF-HGR----NPLIAPLALTIFCWVILMNLMD
ATP61_PHOPR      V------PSKLQCFVEMLVEFVDNSVKETF-HGR----NPLIAPLGLTIFCWIMLMNIMD
ATP6_ALTMD       V------PGKMQAFVELVVEFVDDNVKSTF-HGK----SALIAPLALTIFVWVLLMNLMD
ATP6_PSEHT       V------PGKFQCFIEIIVEFVGDNVRDTF-HGK----SKLIAPLALTIFVWVFLMNLMD
ATP6_COLP3       V------PGKLQCAVEMVVGFVDDSVKSTF-HGK----NALIAPLSLTIFVWILLMNSMD
ATP6_PSEA6       V------PGKWQACVELIVEFVDDTVKSTY-HGK----SALIAPLALTIFVWVLLMNLMD
ATP6_IDILO       V------PGKWQCFVEMIVEFVDNSVKESF-HGK----DKLIAPLALTIFVWIFLMNLMD
ATP6_MANSM       V------PGKLQCMVEILVEWINGIVKENF-HGP----RNVVAPLALTIFCWVFIMNAID
ATP6_PASMU       V------PSKMQCFVEIMVDWIDGIVKENF-HGP----RHAVGPLALTIFCWVFIMNAID
ATP6_HAEDU       V------PGKLQCLVEMVVEWVDGLVKDNF-HGP----RHMIAPLALTIFCWVFIMNAID
ATP6_HISS2       V------PGKFQCLVEMLVEWVDGVVKDNI-HGSD--VRHQIGSLALTIFCWVFIMNAID
ATP6_PSEAE       Q------PGGLQNFVEVMVEFVDTSVKDTF-HGR----NPLIAPLALTVFVWIFLLNLID
ATP6_PSEPK       Q------PGGLQNFVEVMVDFVNGSVKDSF-HGR----SPVIAPLALTIFVWVFLMNAVD
ATP62_HAHCH      V------PSGLQNFVEIMVDFVDKSVKETF-HGK----NAVIAPLALTVFCWIFLMNLMD
ATP6_MARMS       T------PSGLQNFVELMVEFVDGSVKETF-HGK----SKVIAPLALTIFVWVFLMNFMD
ATP6_CHRSD       V------PGGLQNFVEMMVEFVDNSVRETF-HGK----SKLIAPLSLTIFCWIFLMNLMD
ATP6_ACIAD       V------PSKFQSAIEMIIEFVDSSVRDTF-HGK----SRLIAPLALTIFVWIFLMNLMD
ATP6_PSYWF       V------PGKLQAAIEMIVEFVDTNVRDSY-NGT----SKLIAPLALTIFVWIFLMNLMD
ATP6_RUTMC       T------PSGAQNFIESVIDFINDNVRGSF-NSQ----NPMVAPLALTTFIWIVLMNTMD
ATP6_THIDA       V------PTGLQNFVEWVIEFIDTSVRGSF-SHQ----NALVAPLALTVFMWVFLMNLMD
ATP6_PSEMY       V------PSGLQNMAEMCIEFVQGIVKDTF-HGK----NPLVAPLALTIFVWVFLMNSLK
ATP6_PSEU5       V------PGKLQNLVEMCVEFVEGVVKDTF-HGR----NPLIAPLALTIFVWVFLMNSLK
ATP6_MARHV       T------PSGLQNLIEMTFEFVQGIVRDVF-HGK----NPLIAPLALTIFVWILLMNILK
ATP6_ALKEH       V------PSGLQNFVELMVEFVDQTTRETF-QGK----SRLIAPLALTIFCWIFLMNLMD
ATP6_HALHL       V------PGGLQNFVEAMIEFIDKTVKETF-HAK----SKVIAPLALTIFCWVFLSNLMD
ATP61_METCA      V------PGPFQNFVEMIVEFVDTQVKDSF-HGR----NALIAPLALSIFAWVFLMNAMD
ATP6_CHRVO       A------PGRLQLFVEMIVELVQTQVREVF-HGK----SKMIAPLALTIFCWVFLMNFMD
ATP6_COXBR       V------PGKWQNAIEMAVEAVDGTVKDSF-HGD----RSLVAPLALTIFIWVFLMNFMD
ATP6_MYCTU       V------PGGVQLFFEAITIQMRNQVESAI--GMR--IAPFVLPLAVTIFVFILISNWLA
ATP6_MYCLE       V------PCGMQLFWEAITVQMRTQIESAI--GMR--IAPFVLPLAVTIFVFILISNWLS
ATP6_AQUAE       -------PTKYQALLEGYLRFVRNMLLENVGERG-----LKYVPLIAAIGLFVFFGNILG
ATP6_HYDS0       -------PSKLQFVIESYINFCKSMVTENMGEQG-----LRYLPLIASIGLFVFFGNVME
ATP6_SULSY       -------PTPIQNVFEIYIEFIDNLIKENMGEKG-----RKYFPLIASIGLFVFFGNLLG
ATP6_HELAH       -------PMGLQNVYESIISAILSVAKDIIG-EEL---ARKYFPLAGTIALYVFFSNMIG
ATP6_HELHP       -------PSGIQNVFEFIISGIISFAKDIVG-EQV---ARKYFPLAATIAFLVFFGNAIG
ATP6_CAMHC       -------PRGLQNIIEAYLSGVIALGKDAMGSEKL---ARKYMPLIATIGFIVFLSNIIG
ATP6_CAMC5       -------PRGLQNIVEAYLEGVISMGRDTLGSEAL---ARKYLPLVATIGFVVFFSNAIG
ATP6_CAMFF       -------PRGSQNLLEAYLEGIVSMGRDVMGSDEL---ARKYLPLVATIGLIVLTSNVIG
ATP6_CAMJD       -------PRGMQNLAEAFLEGVLSMGRDTMGSEKG---VRKYLPLVATLGIIVFFSNIIG
ATP6_WOLSU       -------PGALQNVFEALLDGILMMARDVIGEEK----ARKYLPLTGTIAILVFFSNAIG
ATP6_NITSB       -------PTGCQNVMEAYLEGVVAMGRDVIGESY----AKKYLPLVATLGLFIFFANLME
ATP6_SULNB       -------PNGTQNVMEAYLGGVVAMGKDVIGEEL----ARKYLPLVAAVGLFIFVSNVIG
ATP6_SULDN       -------PTGTQNVMEAYISGVLKMGTDVMGQEA----ARRYLPLVATIGLFVGIANLIG
ATP6_ARCB4       -------PTGSQNVLEAFVGGIISMGADTMGEKN----ARTYMPLIGSLALVIFVSNMIG
ATP6_DESOH       -------PTKMQNFLEVLISGIEEFMVSVTGEE-----GRWFFPLAGTIAIFIAVSNLIG
ATP6_SYNFM       -------PKGAQNFFEVVITGIEDFMISITGEE-----GRFVFPLIASLGMFILFSNYLG
ATP6_DESPS       -------PGKGQNFWEMIIGGMDDFFADNMGREM----ADKFFPMIATFALYIAVANLIG
ATP6_GEOUR       -------PGGLQNFMEVIIGGVENMVVETMGHH-----GKPFFPLIATLAIFILVSNLIG
ATP6_GEOSL       -------PTGMQNFMEVVIGGIENMVEETMGEK-----GKPYFPLIATLALFVLVSNLIG
ATP63_PELPD      -------PGGLQNFMEIIVGGIENMVTETMGEH-----GRPYFPLVATIGIFVLVSNLIG
ATP6_GEOLS       -------PSGVQNFMEVVVDGIENMIVETMGEH-----GRSFFPLIATLAIFILVSNLVG
ATP62_PELCD      -------PGGMQNFMELVLVEIRGMVRDTMGPK-----GMVYFPLIATLALFLLVSNLIG
ATP61_PELCD      -------PGGLQNLVEIVLVELGRLADETMGPK-----GRRYFPLIATLALFILFSNLIA
ATP6_SYNAS       -------PGSFQSFMEVVIGGFDSLVTDTMGHE-----GKKFFPLIATIGLFILVSNLLG
ATP6_DESVV       -------PGALQNVFEVVIGGLEDFVVGNIGED-----GRKVFPLLGGIFLFILFQNLLG
ATP6_DESAG       -------PGKLQNIFEVIIGGLEEFVVSITGED-----GRKVYPVLIVFFLFILCMNLTG
ATP6_LAWIP       -------PGRLQNFFEVLISSFENFTVINIGEE-----GRKFFPVLIGIFLLIAVENLLG
ATP6_KORVE       --------WDKPGVLQHIAEGMNNFVSNQGEEMIG-HGYETYTSYIVTLGVFILSMNLIG
ATP6_SOLUE       --------PDRPGKLQHTFELVYGFLHEQAEEQIG-HEGHHYLAFFGTIFIFILFANLIG
ATP6_BDEBA       -------LPASKFSLRGIFELLTEMTSGLADMVIG-EHGKHYIPFFASVFFFILFNNLLG
ATP6_SORC5       -------IPEDKLTLRTFFEAFFGYFYGMARDVMGPANAKRYFPLIGGSAAFIFFSNASA
ATP6_TRIV2       -------PSGIQNLLEYALEFIRDLAKNQIGEKE----YRPWVPFVGTLFLFIFVSNWSG
ATP6_SYNE7       -------PSGLQNFMEYVLDFIRNLARTQIGEKE----YRPWVPFIGTLFLFIFLSNWSG
ATP6_TRIEI       -------PSGMQNFMESVLEFIRSLTKDQIGEKD----YRPWVPFIGTLFLFIFVSNWSG
ATP6_NOSP7       -------PKGIQNLMEYALEFIRDLAKNQLGEKE----YRPWVPFIGTLFLFIFVSNWSG
ATP61_ACAM1      -------PSGLQNFMEYALEFVRDLTKNQIGEKE----YRPWVPFIGTLFLFIFVSNWSG
ATP6_MICAN       -------PSGIQNLMEYVLEFLRDLAKNQLGEKE----YRPWLPFIGTLFLFIFVSNWLG
ATP61_SYNP2      -------PGGFQNFMEYALEFIRDLAKNQLGEKE----YRPWVPFIGTLFLFIFIANWSG
ATP6_THEEB       -------PSGIQNLMEYALEFIRDLTKSQMGEHE----YRAWVPFVGTLFLFIFVCNWSG
ATP6_PROMM       -------PHGVQNLLEFLWDYIRDLARTQIGEKA----YRDWMPFIGTLFLFIFVSNWGG
ATP6_PROMP       -------PKGLQNLLEFLWDYIRDLSRTQIGEKV----YRDWMPFIGTLFLFVFVSNWGG
ATP6_SYNS3       -------PKGAQNLLEFLWDYIRDLSRDQIGEKY----YREWLPFIGTLFLFIFVSNWGG
ATP6_SYNR3       -------PRGVQNLLEFLWDYLRDLARDQIGEKV----YRDWLPFIGTLFLFIFVSNWGG
ATPI_PAUCH       -------PQGVQNLLEFLWDYLRDLAREQIGEKA----YRDWLPFIGTLFLFIFGCNWGG
ATPI_PSINU       -------PTGGQNFVEYVLEFIRDLTRTQIGEEE----YRPWVPFIGTLFLFIFVSNWSG
ATPI_ADICA       -------PTGTQNFIEYVLEFIRDLTRTQMGEEG----YRPWVPFIGTMFLFIFASNWSG
ATPI_SPIOL       -------PTGGQNFFEYVLEFIRDVSKTQIGEE-----YRPWVPFIGTMFLFIFVSNWSG
ATPI_WELMI       -------PTGQQNFAEYLLEFIRDLARTQIGEEE----YISWVPFIGTLFLFIFVSNWSG
ATPI_CHAGL       -------PNTTQNFIEYVLEFIRDLTRTQIGEEE----YRSWIPFVGTLFLFIFVSNWSG
ATPI_STAPU       -------PNATQNFVEYVLQFIRDLARTQIGEEE----YRDWVPFVGTLFLFIFVSNWSG
ATPI_CHLAT       -------PSGTQNFLEYVLEFIRDLTKTQVGEEE----YRSWVPFVGTLFLFIFISNWSG
ATPI_CHAVU       -------PTQNQNLIEYILEFIRDLTKSQIGESE----YRPWIPFIGTMFLFIFVSNWSG
ATPI_MESVI       -------PTGTQNFVEYVLEFIRDLAKTQIGEED----YRSWVPFIGTIFLFIFVSNWSG
ATPI_NEPOL       -------PEGGQNFLEYVLEFIRDLAKTQIGHE-----SRKWVPYLGTLFLFIFVSNWSG
ATPI_TETOB       -------PDGLQNFTEFVTEFIRDLAKTQIGEEE----YLKWVPYLGTVFLFIFVSNWSG
ATPI_OLTVI       -------PDGLQNLSEYVTEFIRDLAKTQIGEED----YLSWVPFLGTIFLFVFVSNWSG
ATPI_OEDCA       -------PVGLQNFTELVTEFIRDLAKTQIGEEE----YLKWVPFLGTIFIFVFVSNWAG
ATPI_STIHE       -------PEGLQNFSELVTEFIRDLAKTQVGEEE----YLKWVPFIGTIFIFVLVSNWSG
ATPI_CHLVU       GGSAATAPKGLQNLTEYITEFIRDLAKTQIGEED----YLKWVPFLGTIFLFIFVSNWSG
ATPI_TUPAK       -------PEGLQNLTEYITEFIRDLAKTQIGEEE----YVKWIPFLGTLFLFIFVSNWSG
ATPI_BIGNA       ------LAKSFQNLAEFVTEFILDLARTQVGKED----YLNWVPFLGAVFLFIFVSNWGG
ATPI_EUGGR       -------PANKQIFIELVTEFITDISKTQIGEKE----YSKWVPYIGTMFLFIFVSNWSG
ATPI_CYACA       -------PRGFQNFLEYVFEFLQDISKNQIEEKY----YKSWVPFISTLFLFIFVSNWLG
ATPI_RHDSA       -------PQGIQNFMEYVYEFLQDIAKNQIGEEE----YRPWVPYIATVFLFIFGANWAG
ATPI_PYRYE       -------PEKFQNFMEFILEFLQDIAKNQIGEHE----YRPWVPYIATLFLFILGCNWAG
ATPI_TRICV       -------PNSWQNFAESAVDFVTDIARDQLGESF----YREWVPFIGTLFLFIFGCNWAG
ATP6_SYNJA       -------PAGLQNFIEYTLEFVQSIARAQIGEKN----FRPWVPYVGTLFLFIFVSNWMG
ATP6_GLOVI       -------PSGLQNFLEYAYDLLASIARNQIGEKQ----YRSWVPLIGTIFLFVLFANWLG
ATP61_CHLTE      T------ISRWQSMLEIIVTMAHRQIS-EVGLQK----PEKYLPFIAALFLFIATANLCT
ATP61_PELLD      H------RPRWQNVLEIIVGMARRQIE-EVGLRR----SMQYLPYLGTLFIFIAFSNLCT
ATP6_RHOFT       K------RSRWQNLLEIVVTAIEKQIE-EVGLRD----PKKYLGFLGTLFLFVATASLCT
ATP61_PROA2      R------ISRWQSFLEMIVTMAMQQIR-EIGLRQ----PEKYLSYLATLFLFVATAVLFT
ATP6_NITMU       E------RSRWQNLLEVIIITIQKQIS-EVGLRQ----PRTYLPFLGTLFVFVAVANLFA
ATP62_ACAM1      Q------ISRGQNLLEVIVLGIRDQIQ-EIIDQP----ADPYLPFIGTLFIFIALSNLLS
ATP61_CROS5      P------LSRWQVALEIIVEQIRQQIR-DASQQK----ADQFLPFIGTLFLFITMANLLT
ATP62_SYNP2      K------LPPWQNFLEIVVDGIYQHIA-EVTQQE----PEPYLAFVGTLFLFILTANLLT
ATP62_METCA      -------PDRVQVVLEGIVSACENAVR-DVIPTA----YREVTPFIMSLWLFLATANLIS
ATP62_PELPD      -------PGPFQVALEGVVQTIRAAVE-EVVPRR----ADTVFPFVATLWLFIGIANLSS
ATP61_HAHCH      -------PGRLQAMLEGVVLTLESAIA-NADSRN----ARRLLPLIGTFWIFLPVANLLG
ATP6_LEGPC       -------PSTYQLLWEGVLSTMYDAIK-EVLPDH----VELIFPFVATLWIFILVSNLIG
ATP62_BRASB      -------PDGRQALLEGIVTSVAGQIE-DVIRKD----ARPFLPLLGTLIIFLVVANLSG
ATP6_MOOTA       -------PRGAQHVLEMFLEFFYGLLE-EIIGKE----GRRYLPLVATLFIFILSLNLSW
ATP6_RICB8       ----LVPS-RLQISGEIIYNLVTDMLNQNVG-----SKGRKFVPVIFTLFVFILFCNLFG
ATP6_RICCK       ----LVPS-RLQVSAEIVYNLVADMLNQNIG-----AKGHKFIPLFFSLFIFILFCNLLG
ATP6_ORITI       ----LVPS-RWQAFGEILYESNIKLVHSIIG-----PQGKKFFPLILTLFLFISLGNILG
ATP6_ANAMM       ----VVPG-PSQTAVELIYGFVANTLESNAG-----AEGLRYIPLVMTTFLFVLACNLVG
ATP6_ANAPZ       ----DGSSSMSHTAVELIYNFVVGAIESNAG-----VGGLRYIPFVLSIFLFVLACNIIG
ATP6_WOLPM       ----VIPG-YLQAAVEYVYDFVISIIENNTG-----SKGLQHIPLIFTVFIFILSCNLVG
ATP6_WOLTR       ----VIPG-YLQAAVEYVYDFITSIIESNTG-----SKGLKHIPLVFTVFTFTLSCNLVG
ATP6_EHRRW       ----VIPN-PLQSIIEIIYDFIVSTIESNVG-----KEGLQYVPLVFTIFTFILVCNLLG
ATP6_NEOSM       ----VIPG-PMQSFVEIVCSFVLGIIKGSCG-----KAGSDYFPLILSVFLYVLFANLVG
ATP6_SINMW       ----LIPT-RMQSVSEMSYEFIASMLREGAG-----SQGMKFFPMVFSLFMFILTANLLG
ATP6_AGRFC       ----LIPT-RMQSVAEMSYEFIASMLREGAG-----KKGMVFFPFVFSLFMFVLTANLLG
ATP6_RHIL3       ----IVPG-RSQSVAEIFYEFIAKMLTEGAG-----KQGMQFFPLVFSLFMFVLTANLLG
ATP6_CHESB       ----LVPS-RMQSVSEMSYEFVASMLRDAAG-----SHGMRFFPFVFSLFMFVLVANLLG
ATP6_RHILO       ----LVPG-RLQSISEMAYEFVANMLRDAAG-----TQGMKFFPLVFSLFMFVLVANLLG
ATP61_OCHA4      ----LIPT-RLQSVSEMAYEFVATSLRDSAG-----SKGMKFFPFVFSLFMFVLVANFLG
ATP6_BART1       ----LVPT-RMQSLSEMAYEFVASTLRESSG-----VQGMQFFPLVFSLFTFILVANFIG
ATP6_PARL1       ----MVPG-RMQSVVESFYTFIANMVRDNAG-----HDAMRFFPFIFSLFMFIFFANMIG
ATP6_AZOC5       ----LVPG-RMQSVAEMGYEFIAKMVRESAG-----TEGMVFFPLVFSLFVFVFVANVIG
ATP6_XANP2       ----LVPG-RAQSAAEMSYEFIAKMVRDSAG-----SEGMVFFPLVFSLFTFVLVSNVVG
ATP6_BEII9       ----LVPG-RLQSIAEVSYEFIASTLQLSSG-----RDGMRFFPFVFSIFMFVFLANLIG
ATP6_RHOP2       ----LVPG-RFQSVAELSYEFVANMIRSTAG-----KEGLKFFPLVFSLFMFIAVSNLVG
ATP6_BRADU       ----LVPG-RLQSVAEISYEFVASTIRSTAG-----SEGMKFFPLIFSLFMFICVSNLIG
ATP6_RHOPB       ----MVPG-RIQSLAEISYEFVAGTIRSTAG-----VEGLKFFPLVFSLFMFIMISNMVG
ATP6_BRASO       ----LVPG-RFQSVVELAYEFVANTIRTSAG-----SHGMTFFPLVFSLFMFIFVSNIVG
ATP6_NITWN       ----LVPG-RMQSIAEISYEFVADTIRTTAG-----KEGMKFFPFVFSIFMLVTVSNLVG
ATP6_METS4       ----LVPG-RMQSLAEAFYEFIASTVHQSAG-----HGSERFVPLVFSLFMFVLVLNLFG
ATP62_OCHA4      ----VVPG-RWQSSAEILYEFVSKTLRENAG-----EKGMAFFPLVFSLFLFILFANLIG
ATP6_HYPNA       ----LVPS-RLQSVAEMGYGFIADMVRSAAG-----EEGLKFFPFVFTLFFFILFANLIG
ATP6_MARMM       ----LVPN-RAQSVAEIIYGFVADMVRSTAG-----QEGLRFFPFVFTLFIFILVANMLG
ATP6_PELUB       ----LLPS-KMQLLSELSYTFVSKMISDTAG-----SKAKPYFAFIFSIFMFVLFCNMFG
ATP6_MAGSA       ----LVPG-RWQSMAEVFYEFIAGMLRDNVG-----QEGRKYFPFIFSLFMFVLFGNLLG
ATP6_RHORT       ----LIPG-RLQSAAEMLYEFVANMIRDNVG-----KEGMKYFPYILTLFVFVFLGNMLG
ATP6_ERYLH       ----LVPG-RWQMMVESFTSFIDDMLEVNIG-----KAGRKYVPYVFSLFMFILFGNLLG
ATP6_NOVAD       ----LVPG-RWQMAVEGLTGFVDNLLQANIG-----KAGRKYLPYVFSLFAFILFANMLG
ATP6_SPHWW       ----LVPG-RWQAAVESFTGFVAGMMATNIG-----PEGKKFTPYVFSLFMFILIANIMG
ATP6_SPHAL       ----LVPG-RWQVAVEGFTGFISSMMMANIG-----TEGRKYTPYVFSLFMFILFCNLLG
ATP6_ZYMMO       ----LIPG-RWQMAVEVMTRFVNDMVSTNIG-----PKGRPFTPLIFTLFMFILFANLLG
ATP6_ACICJ       ----LVPG-RMQGLAEISYEFVHNMVLDTIG-----EEGKRFFPFVFTLFAFILIGNILG
ATP6_GRABC       ----VVPG-RLQSLVEISYNFIMGLCIEQIG-----HEGKKFFPFIFTLFFFVLMGNLLG
ATP6_GLUDA       ----IVPG-RLQAAAEICYDFIHDMAVDTIG-----PEGRAFFPFIFTLFFFILAGNYLG
ATP6_GLUOX       ----VVPG-RLQAAAEISYDFVHDLAVSTIG-----ENGATFFPFVFAIFFFILAGNYLG
ATP6_DINSH       ----VVPS-RAQSIAELAYGFVYKMVEDVTG-----KDGIKYFPYIFTLFMFILVANFLG
ATP6_ROSDO       ----VVPS-RAQSVAELAYGFIYKMVEDICG-----KEGLKFFPYIMTLFMFIVCANFLG
ATP6_RHOS5       ----IVPS-RSQSVAELLYGFIHNMVEEVTG-----HEGVKYFPYVMTLFLFVLCGNVLG
ATP6_MAGMM       DK--LIPT-KMQSLAEMTFTFVRQIVDQNIGG----AEGRKYFPAIFTLFLLVLFCNLLG
ATP6_ANASK       V-----PRGL-YNFIELLVAFVRNEIAVKNIGE---KDADRFTPYLVTAFFFILFLNLFG
ATP6_ANADF       V-----PRGL-YNFIEMLVQFVRNEIAVKNIGE---KDADRFVPYLVSAFFFILFLNLFG
ATP6_MYXXD       V-----PRGAGANILEMLVLFVRDELAIKNIGK---EEGPRYVPFLLTVFFFILFMNMLG
ATP62_CHLP8      VK--QAPSGI-ANVMEALVDFIRLDVAKSNIG----HGYEKHLPYLISVFFFILVCNLLG
ATP62_CHLTE      AN--QAPKGV-ANVFESLVDFISNDVAKPNIG----HGYEKFLPYLLTVFFFILVCNLLG
ATP6_CHLPD       PK--TAPKGF-VNAMEALVEFIRLDVAKANIG----PGYEKYLPYLLTVFMFVLLCNVLG
ATP6_PELPB       AR--QAPTGL-VNAMEALVEFIRIDVAKANIG----VGYEKYLNYLLTVFFFVLLCNLLG
ATP6_CHLCH       AM--RAPKGI-ANALEALVDFIRLDVAKANIG----KGYEKYLPYLLTVFFFILVCNLLG
ATP62_PELLD      PK--TAPSGV-ANTMEALVEFIRLDVAKSNIG----HGYEAHLPYLLTVFMFILLCNILG
ATP62_PROA2      SR--QAPGGM-ANAMEALVEFIRLDVAKSNIG----AGYEKHLPYLLTVFAFILLLNLLG
ATP6_CHLPB       SN--EAPGGV-ANAMEALVEFIRLDVAKSNIG----EGYEKHMPYLLTVFVFILVLNLLG
ATP6_CHLT3       KN--QAPKGM-ANLMEVLVDFIRLDVAKQNIG----HGYERFMPFLLTIFFFILVCNLIG
ATP6_ELUMP       L----------MTAIEGLVVFIRDEIVVANFG----EHGKKLTPYFCTLFIFLLFSNSLG
ATP6_MYCGE       SLK---NNSYFLLLFQMLFVWVQDTTADLLGEEN-----KKFAPYFLMLLLYIVSSNLVS
ATP6_MYCPN       PLR---NHSSFVLLMQMLFVWAQDTTADLIGEEN-----KKFTPYFLMLLLYLVSSNLIG
ATP6_MYCGA       PTE---PPTGYVLVVQLLILQFENLTVDLLGEKN-----RRLSLLFIIIFVYILISNLMS
ATP6_RUBXD       -------PGAYQVLVEELFRFGRDMFGGQINEEG-----RKWFPYSLTLFIFLLVLNIIG
ATP6_PARUW       -------PSKFQNLLEIAVEKFSHLILEVLGPEG-----KAYIPFLGTLFIYIFTMNIFG
ATP6_FRACC       I------PRGLQNLCESAYDFIDLQIARGVIGEK----GTRYTPYLLVLFSFVLICNVLA
ATP6_PAEAT       -----LVPGKLQFAGEMAYGFVRNGIAKDIIGGK---DFIKYVPLLFSLFFFILVNNIYG
ATP6_DESRM       -------PGKAQATFEVLWEFLGGQVFSNLGNKL----GAAMMPIIVTFFIYIVFANLLG
ATP6_CLOAB       -------PNRKQSVIEMIVNLINGLVKENMGEKF-----MNFVPIIGTMAVFILFLNLTG
                                .                                            

ATP6_STRA3       LMTSLKTHE-HNFWTS------------------PTANFGVDITLSLLVAFICHIEGIRK
ATP6_STRMU       LLTKIQVKD-YNLWTS------------------PTANFAVDFGLSLMVAVICHFEGIRK
ATP6_STRR6       LMTKLQTIDGTNWWSS------------------PTANLQYDLTLSFLVILLTHIESVRR
ATP6_BACSU       LPFSITIGH-ELWWKS------------------PTADPAITLTLAVMVVALTHYYGVKM
ATP6_BUCAI       LVPIDFFPFISEKVFELP-----------AMRIVPSADINITLSMSLGVFFLILFYTVKI
ATP6_BUCAP       LIPIDFFPFISERFFHFP-----------AMRIVPSADINITLSMSLGVFILILFYSVKM
ATP6_BUCBP       LIPIDLVPFIFQNFFETQI----------PIKLVPTTDVNITISMSLVVFLLIIFYSIKI
ATP6_WIGBR       LIPVDFVPYIANFIFNIS-----------ELRIVPSSDINITLSMSLGVFLLILYFGIKN
ATP6_ECOLI       LLPIDLLPYIAEHVLGLPA-----------LRVVPSADVNVTLSMALGVFILILFYSIKM
ATP6_PROMH       LLPIDFIPYIGEHILGLPA-----------LRIVPTADVSITLSMAIGVFILILFYSIKM
ATP6_PECAS       LLPIDLLPQLWAGVYSLLGYDPAHA----YLRAVPTADVNITLSMALGVFILVLFYSIKM
ATP6_AERHH       LIPVDFIPH-AAQLMGVPY-----------LRVVPSADVNITMSMALGVFFLILYYSIKV
ATP6_AERS4       LIPVDYLPY-TAQVLGIPY-----------LRVVPSADVNITMSMALGVFALIIIYSIKM
ATP6_BAUCH       LLAVDMLPYIAMYILHIPA-----------LRVVPSADINITLSLALGVFILIIYYNLKI
ATP6_BLOFL       LIPIDLLPCIADYFFGIPT-----------LRILPSADINITCAMALNIFALMIFYYIKT
ATP6_BLOPB       LFPIDLFPAIAK-LLGLPA-----------LRVVPSADVNITSSLALNVFVLVMYYNIYV
ATP62_PHOPR      LLPVDFVPALTRLFGVEH------------FRDLPSADVNVPVSMALGVFILIIGYTLKN
ATP62_VIBCB      LLPIDLIPALTSAVGVEH------------FRDLPSADINITMSMALGVFILVLGYTFKN
ATP6_SHESW       LIPVDFIPEAANRFLGVP-----------YLKVVPTTDLNVTLGLSLSVFVLIVFYSIKA
ATP6_PSYIN       LIPVDFIPEAAKQILGVP-----------YLKVVPTTDMNITFGLSLSVFALIVFYSIKI
ATP6_SHEFN       MIPVDWLPSLA-LLAGVP-----------YLKVVPTTDVNITFSLALGVFVLIIYYSIKV
ATP6_ALIFM       LVPIDFLPYPAEHWLGIP-----------YLKVVPSADVNITMAMALGVFALMIYYSIKV
ATP61_PHOPR      LIPIDFIPYAAEHALGIP-----------YLKIVPTADVNITMAMALGVFALMLYYSVKV
ATP6_ALTMD       LVPVDLIPWVSGLIGQAAFGMDPHD---VYNKAVPTTDLNLTFALASGVFILILFYSIKM
ATP6_PSEHT       LIPVDFLPSFAGFVGETAFGMDSHD---VYMKIVPTTDINMTSALALGVFILMVGFAIKI
ATP6_COLP3       WVPVDLLPHLIHWVTGMPLGDI-------YMKPVPTADPNITFGLALGVFILIIYYSIKV
ATP6_PSEA6       LIPVDFLPTAAALIAGESMDVIAAGQSHTYMKVVPTTDVNMTFALSLGVFALMIFYSVKI
ATP6_IDILO       LIPVDWLPTAAMY-GGYWLGFVEDPHD-VYMKVVPTTDLNTTFALSLSVFALIIIYSIKY
ATP6_MANSM       LIPVDFLPQLAGLFGIH------------YLRAVPTADISATLGMSLCVFALILFYTVKS
ATP6_PASMU       LIPVDFLPQLAHLFGIE------------YLRAVPTADISGTLGLSIGVFFLIIFYTIKS
ATP6_HAEDU       LVPVDFLPQLANMFGIH------------YLRAVPTADISATLGMSICVFGLILFYTVKS
ATP6_HISS2       LIPVDFPPQFAELLGIH------------YLRAVPTADISATLGMSVCVFALIIFYTIKS
ATP6_PSEAE       LVPVDYLPMLAAKIT------GDEH---LFFRAVATTDPNATLGLSISVFALIVFYSIKV
ATP6_PSEPK       LIPVDWIPQLAILIS------GDPH---IPFRAVSTTDPNATLAMAFCVFALIIFYSIKV
ATP62_HAHCH      LVPVDFLPRLFQVI------TGDDH---AYFKVVPTTDVNVTLGMSLSVFFLIIYYSIKV
ATP6_MARMS       LIPVDFLPATAQWIGVTLFGADPHH---VYFKFVPTTDINATLGMSLSVFVLIVFYSIKV
ATP6_CHRSD       LVPVDFLPMLAQKIG-AWFGADPAH---VYFKVVPTTDVNATLGMSLAVFALIIFYSIRS
ATP6_ACIAD       LIPVDWVPMLAQIVGAHVFGMDPHH---VYFKIVPSTDPNITLGMSLSVFVLILFYSIRE
ATP6_PSYWF       LMPIDYIPVLAQKVGA-AMGHDPHH---VFFKIVPTTDPNITLGMSFSVFALIIYYSIKE
ATP6_RUTMC       LVPVDWLPYVAQQIGVW-LGADPHH---VFFKMVPTADPNATLGMSIGIFILIIYYSIKE
ATP6_THIDA       LLPVDWLPYVATMAGI------------PYLKVVPSTDPNVTFGLSLSIFFLVLYYSVKM
ATP6_PSEMY       WIPVDYIPGLAHAMGL------------PYFKIVPTADPNGTFGISLGVFLLIIFYSIKV
ATP6_PSEU5       WIPVDYIPGIAHLLGL------------PAFKIVPTADPNGTFGLSLGVFILILFYSFKV
ATP6_MARHV       LIPIDYIPSIAHALGL------------EYFKIVPTTDPNATFGMSIGVFLLILFYSFKV
ATP6_ALKEH       LVPIDMVPSLMYAAGVD------------YFKILPTVDLNVTFALSISVFFLIIAYSFKG
ATP6_HALHL       LVPIDMVPSIMMAVGVD------------YWKILPSVDLNFTFGLSLSVLALIIIYGVMG
ATP61_METCA      LLPVDLLPDVGKAIGLE------------YLRVVPSTDLNATFGMSISVFFLIIFYSLKV
ATP6_CHRVO       LFPVDLFPMAAQWIGYTFFGLEPHH---VYFRVVPSADVNATFAMSLSVLILIVGFSIKA
ATP6_COXBR       LVPVDLIPRLFQMGGVE------------HFKAVPTADPTLTFAMSITVFVLVIFYNFKM
ATP6_MYCTU       VLPVQYTDKHGHTTELLK---------------SAAADINYVLALALFVFVCYHTAGIWR
ATP6_MYCLE       VLPLQYTNADGHTTEVLS---------------SAAADINYVLALAFFVFVCYHLAGIWR
ATP6_AQUAE       MV---------------------------PGFEAPTANINTNLALALLVFFYYHFEGFRE
ATP6_HYDS0       LL---------------------------PFVDAPTGNINTTLALTLIVFFLYHFEGFRV
ATP6_SULSY       II---------------------------PGLESPTANLNTTMALALLVFFIYNFEGIRE
ATP6_HELAH       II---------------------------PSFESPTASWSFTLVLALIVFFYYHFEGIRV
ATP6_HELHP       II---------------------------PGFEAPTSSWSFTLVLALVVFFYYHFEGIRA
ATP6_CAMHC       LI---------------------------PGFEAPTASLNLTLSLTLCVFFYYHFEGIRE
ATP6_CAMC5       II---------------------------PGFESPTSSLNLTLTLALIVFFYYHFEGIKK
ATP6_CAMFF       II---------------------------PGFEAPSSSLNLTLCLALSVFLYYNFEGIRT
ATP6_CAMJD       IL---------------------------PGFHAPTASLNLTLSLAIIVFVYYHFEGIRA
ATP6_WOLSU       II---------------------------PGFESPTSSLNYTLTLALIVFVYYNFEGIRT
ATP6_NITSB       II---------------------------PGFEPPSGNINFTLALALIVFIYYNFEGIRK
ATP6_SULNB       II---------------------------PGFESPTSNINVTLPLALMVFVYYNYEGIKK
ATP6_SULDN       VV---------------------------PGFEAPTAFLEFAFTLALSVFIYYNYEGIRR
ATP6_ARCB4       VI---------------------------PGFEAPTSNINFTLSLALIVFVYYNYLGIKK
ATP6_DESOH       LV---------------------------PGFFPPTASINTPLACAIVVFVFTHFIGIKY
ATP6_SYNFM       MI---------------------------PGFFSPTANINTTAACALISVVFTHVIGIKF
ATP6_DESPS       LI---------------------------PGFMSPTASINTTLALTLIVWATHHVIGFKE
ATP6_GEOUR       LV---------------------------PGFFPPTANINTTAACAVIVFVTTHVVGIKE
ATP6_GEOSL       LI---------------------------PGFFPPTANLNTTAACAVIVFLSTHIVGIKK
ATP63_PELPD      LI---------------------------PGFFPPTANINTTAACAIVVFLSTHVVGIKR
ATP6_GEOLS       LI---------------------------PGFYPPTANVNTTAACAIVVFLATHVVGIKH
ATP62_PELCD      LI---------------------------PGFAPPTASLNTNAALAVGVFLVTHIVGVRE
ATP61_PELCD      LI---------------------------PGFAPPTANLNTNAALALAVFGMTHVVGVRE
ATP6_SYNAS       LV---------------------------PGFESPTANLNTNAAMAVVVFILTHYVGIKV
ATP6_DESVV       LV---------------------------PGCDAPTANVNTNAAMALFVFGYYNYQGLKR
ATP6_DESAG       LV---------------------------PGFDAPTANINTTASLALFCFIYYNYIGIQR
ATP6_LAWIP       LI---------------------------PLCDAPTANINTNIGMAIFVFLYYNYEGIKK
ATP6_KORVE       LI---------------------------PGFEAPTAFPSVPLGCALVTWFFYHVHGLRE
ATP6_SOLUE       VV---------------------------PGFEAPTMVPSVPAGCAIAAFFYYNIVGVQA
ATP6_BDEBA       MI---------------------------PGMTPATENMNTTFGFGVLMFLFYNFQGVKE
ATP6_SORC5       LI---------------------------PGVNPPTSNLNITIGCAVVVFVLFNYYGLKE
ATP6_TRIV2       ALVPFKLIH-----------------LPEGELAAPTSDINTTVALALLTSLAYFYAGFSK
ATP6_SYNE7       ALIPWKLIK-----------------LPSGELAAPTSDINTTVALALLTSLAYFYAGFSR
ATP6_TRIEI       ALVPWKVIE-----------------LPSGELAAPTSDINTTVALALLTSIAYFYAGISK
ATP6_NOSP7       ALIPWKLIK-----------------LPSGELAAPTNDINTTVALALLTSLAYFYAGFSK
ATP61_ACAM1      ALFPWKLIS-----------------LPEGELAAPTNDINTTVALALCTSFVYFYAGFRK
ATP6_MICAN       ALIPWKLIE-----------------LPEGELAAPTNDINTTVALALLTSLAYFYAGISK
ATP61_SYNP2      ALVPWKIIG-----------------LPEGELAAPTNDINTTVALALLTSLAYFYAGFKK
ATP6_THEEB       ALVPWKLIE-----------------LPEGELAAPTNDINTTVALALLVSLAYFYAGLRK
ATP6_PROMM       SLVPWKLIH-----------------LPSGELGAPTADINTTVALALLVSLSYFYAGLSR
ATP6_PROMP       ALIPWRLIK-----------------LPSGELGAPTADINTTIALALLVSLSYFYAGLSN
ATP6_SYNS3       ALIPWKVIE-----------------LPEGELGAPTADINTTVAMALLVTLAYFYAGLSK
ATP6_SYNR3       ALIPWRIVH-----------------LPSGELGAPTADINTTVAMALLVSLAFFYAGLSN
ATPI_PAUCH       ALVPWKLIE-----------------LPNGELGAPTADINTTVAMALLVSLSYFYAGLSR
ATPI_PSINU       ALFPWKIIQ-----------------LPHGELAAPTNDINTTVALALLTSVAYFYAGLHK
ATPI_ADICA       ALLPWRVIQ-----------------LPHGELAAPTNDINTTVALALLTSVAYFYAGLYK
ATPI_SPIOL       ALLPWKIIQ-----------------LPHGELAAPTNDINTTVALALLTSVAYFYAGLTK
ATPI_WELMI       ALVPWGVVK-----------------LPHGELAAPTNDINTTVALALLTSVAYFYAGLAK
ATPI_CHAGL       ALIPWKVIE-----------------LPNGELAAPTNDINTTVALALLTSVAYFYAGLNK
ATPI_STAPU       ALVPWKLIE-----------------LPHGELAAPTNDINTTVALALLTSGAYFYAGFHK
ATPI_CHLAT       ALIPWRLIE-----------------LPSGELAAPTNDINTTVALALLTSVAYFYAGLSK
ATPI_CHAVU       ALIPFKLVQ-----------------LPNGELAAPTNDINTTVALALLTSVAYFYAGLRK
ATPI_MESVI       ALVPWKLIE-----------------IPNGELAAPTNDINTTAALALLTSISYFYAGFSK
ATPI_NEPOL       ALVPWRLIE-----------------LPNGELGAPTADINTTVALALMTSTAYFYAGLTK
ATPI_TETOB       ALLPWALIE-----------------LPNGELAAPTNDINTTVALALLTSISYFYAGIRK
ATPI_OLTVI       ALVPWALIE-----------------LPSGELAAPTNDINTTVALALLTSIAYFYAGINK
ATPI_OEDCA       ALLPWRLIE-----------------LPNGELAAPTNDINTTVSLALLTSVSYFYAGIRK
ATPI_STIHE       ALLPWRLIE-----------------IPNGELAAPTNDINTTVALALLTSISYFYAGIRK
ATPI_CHLVU       ALIPWRILE-----------------LPNGELAAPTNDINTTVALALLTSIAYFYAGISK
ATPI_TUPAK       ALIPWHIFE-----------------IPNGELAAPTNDINTTVALALLTSTAYFYAGFSK
ATPI_BIGNA       ALLPWKLLE-----------------LPNGELAAPTNDINTTVALALLTSFSYFYAGISK
ATPI_EUGGR       ALIPWKIIE-----------------LPNGELGAPTNDINTTAGLAILTSLAYFYAGLNK
ATPI_CYACA       ALVPWKLIK-----------------IPEGELAAPTNDINTTVALAMLTSVSYFYAGLSK
ATPI_RHDSA       ALIPWKLIQ-----------------LPEGELAAPTNDINVTVALALLTSLSYFYAGLSK
ATPI_PYRYE       ALIPWKLIH-----------------LPEGELAAPTNDINTTVALSLLTSLAYFYAGLSK
ATPI_TRICV       AIIPWKLIE-----------------LPEGELAAPTNDINTTVALALLTSLAYFYAGLSK
ATP6_SYNJA       NLFPWKLIP-----------------LPEGELASPTNDINTTAGLALLTSVMYFVAGISK
ATP6_GLOVI       QL-PLRLFH-----------------IPEGELASPTNDINTTVALSLIALVSYIYAGLRK
ATP61_CHLTE      VI---------------------------PGYEPPTGSLSTTAALALSVFIAVPLFGIAE
ATP61_PELLD      II---------------------------PGYEPPTGSLSTTAALAMSVFVAVPLFGIAE
ATP6_RHOFT       VI---------------------------PGYEPPTGSLSTTAALAFCVFVAVPFFGIKD
ATP61_PROA2      II---------------------------PGYEPPTGSLSTTAALALSVFVAVPLYGIER
ATP6_NITMU       VF---------------------------PGYEPPTGSLSTTVALAICVFVAVPFYGIRE
ATP62_ACAM1      VI---------------------------PGYQPPTGSLSTTTALALCVFFAVPLYGVQK
ATP61_CROS5      IF---------------------------PVYQSPAGSLSTTAALALCVFVAVPIYGIKN
ATP62_SYNP2      VV---------------------------PGYQAPTGSLSTTTALAIAVFIAVPIYGIRQ
ATP62_METCA      LV---------------------------PGFDSPTRDLSVTSALAVLVFFSVHWFGIRQ
ATP62_PELPD      LI---------------------------PRVHSPTADLSATTALALLVFFSVHWFGIRI
ATP61_HAHCH      VI---------------------------PGMHSPTRDLSVTAALALVVFFAVHAYGVRQ
ATP6_LEGPC       VI---------------------------PGFYSPTADLSVTASLAMMTFLSVHWFGIRA
ATP62_BRASB      VL---------------------------PGVEAPTSKIETPAALALIVFFSVHYFGVRE
ATP6_MOOTA       FI---------------------------PGMKPPTMDLSTTAAFAVTTIILVQIFGIRK
ATP6_RICB8       MIPY---------------------------GFTVTSHIIITFALAILVFLMVTIVGFVK
ATP6_RICCK       MTPY---------------------------SFTVTSHIIVTFALAILVFLTITIVGFVK
ATP6_ORITI       MVPH---------------------------AFTFTSHIIVTFSLAMIVFTTTLVYGIYR
ATP6_ANAMM       ILPF---------------------------GFTATSHLSVTLALSLVVCTAITVIGFRH
ATP6_ANAPZ       ILPL---------------------------GFTATSHVSVTLALSVVVCASVTVLGFNH
ATP6_WOLPM       VLPY---------------------------SFTVTSHVIVTFALSMVVFIYITIVGFKE
ATP6_WOLTR       MLPY---------------------------SFTVTSHVIVTFALSMIVFTYTTIVGFKE
ATP6_EHRRW       ILPL---------------------------GFTVTSHIAVTFAISMIVFISVTFIGFKH
ATP6_NEOSM       MLPLPM-------------------------SFTVTSHIVVTLALAMVVFIFVTLIGLKK
ATP6_SINMW       MVPY---------------------------FFTVTSQIIVTFALAVFVIGTVILYGFYK
ATP6_AGRFC       MFPY---------------------------FFTVTSQIIVTFALACLVIGTVIVYGFYK
ATP6_RHIL3       MFPY---------------------------FFTVTSQIIVTAALAILVIGTVVVYGFYK
ATP6_CHESB       LFPY---------------------------FFTVTSHIVVTFALALLVIGTVLVYGFWK
ATP6_RHILO       LFPY---------------------------FFTVTSHIIVTFGLAILVIGTVIVYGFMK
ATP61_OCHA4      LFPY---------------------------FYTVTSQIIVTFALAVLVIGTVIVYGFFK
ATP6_BART1       LFPY---------------------------FYTVTSQIMITFSLAMVVILTVIGYGFYK
ATP6_PARL1       MFPY---------------------------AFTVTSHIVVTFALAIVVFLGVTLTGFVL
ATP6_AZOC5       LVPY---------------------------TFTITAHIVVTAALALLVIGTVVIYGFYK
ATP6_XANP2       LIPY---------------------------TFTVTAHLIVTAAMALLVIGTVIVYGFVR
ATP6_BEII9       LVPY---------------------------TFTVTSQIAVTFGLAMIVIGTVVIYGLIK
ATP6_RHOP2       IIPY---------------------------TFTVSSHLIVTVTLAMLVFVTVLVYGLAK
ATP6_BRADU       IIPY---------------------------TFTISSHLIVTAALALLVFFTVLIYGVAK
ATP6_RHOPB       IIPY---------------------------TFTITSHLIVTAALALLVFLTVLIYGFYR
ATP6_BRASO       IIPY---------------------------TFTVSSHIIVTFSLALLVFLTVIIYGFYK
ATP6_NITWN       IIPY---------------------------TFTISSHIIVTAALAFLVFFTVLIYGFYK
ATP6_METS4       MIPY---------------------------AFTVTSHIIVTFMLALVVILTVVIYGFMA
ATP62_OCHA4      MFPY---------------------------AFTVTSHIIVTFALAMLVFLTVTIYGLVR
ATP6_HYPNA       MVPY---------------------------AFTTTSHIIVTGALAMTVILMVIVVGLIK
ATP6_MARMM       MFPYFP--------------------APGAHSFTITSHLIVTVALAMLVWLTVIIYGVFK
ATP6_PELUB       MIPY---------------------------AFTVTSHIIVTFILASFIFVGVTIIGFMK
ATP6_MAGSA       MMPIPV------------------------IGFTYTSHVIVTFAMALVVFVGVTVIGFAR
ATP6_RHORT       MLPYS---------------------------FTFTSHIAVTAALAVGIFIAVTIIGFAR
ATP6_ERYLH       LLPLG---------------------VLGIHPFTFTSHFTITGVLAIISFSIVLIVGFWK
ATP6_NOVAD       LLPLA---------------------LVGVHPFTATSHFTVTGVLAIMSFAIVLGVGFAK
ATP6_SPHWW       MMPTG---------------------VVGVHPFTVTSHLTVTGVLAVISFSIVLVVGFWR
ATP6_SPHAL       MLPLG---------------------VLGLHPFTVTSHIAITGVLALISFAIVLVVGFWR
ATP6_ZYMMO       LVPLFGF-------------------LPGAEPFTSTSHVTVTATLAAIAFGTVLVVGFTR
ATP6_ACICJ       LFPY---------------------------FFAFTSHIAITGALALFVFALSTLVGFWY
ATP6_GRABC       LFPY---------------------------FFTYTSHVAVTGGLAVLVIVLVTAVALRY
ATP6_GLUDA       LLPF---------------------------SFAFTSHIAVTLALALLVFVLAVIVSLKA
ATP6_GLUOX       LLPF---------------------------SFTYTSHIAVTFGLAIMVFIISILASIRF
ATP6_DINSH       LIPM---------------------------SFTTTSHIAVTAVLALAVFITVTVIGFVK
ATP6_ROSDO       LIPS---------------------------SFTPTSHFAVTVVLALAVFVTVTILGFVK
ATP6_RHOS5       LLPL---------------------------SFTTTSHMAVTVPLALMVFVGVTALGFMR
ATP6_MAGMM       LIPG---------------------------SFTPTSQLVVTATLALSVFFFATGLAIVK
ATP6_ANASK       LLPF---------------------------SATATANLSVTVAMALFTFFITQYAAIRA
ATP6_ANADF       LVPF---------------------------AATATANISVTVMMAVFTFLITQYAQIRA
ATP6_MYXXD       MVPW---------------------------MATATGNLAVTMALALCTFVITQVAGIRA
ATP62_CHLP8      LIPY---------------------------GATATGNINVTLALSIFTFFITQIAAFKE
ATP62_CHLTE      LIPY---------------------------GATATGNINVTLTLSVFTFVITQFSAFKA
ATP6_CHLPD       LVPY---------------------------GATATGNINVTLTLATFTFVLTQIAALKA
ATP6_PELPB       LVPY---------------------------GATATGNINVTLTLATFTFFITQVAALKA
ATP6_CHLCH       LVPY---------------------------GATATGNINVTLTLATFTFFLTQAAALKA
ATP62_PELLD      LIPY---------------------------GATATGNINVTLTLAVFTFFITQAASLKA
ATP62_PROA2      LVPY---------------------------GATATGNINVTLTLAVFTFFITQVASLKA
ATP6_CHLPB       LIPY---------------------------GASATGNINVTLTLSVFTFFITQVSAIKS
ATP6_CHLT3       LVPY---------------------------SATATGNINVTATLAIFTFLVTQASAIRA
ATP6_ELUMP       MIPQ---------------------------MRTITGSISVTIGMALTSLSLIIFLGVKQ
ATP6_MYCGE       LLGG---------------------------ISPPTSSLTFTFSLGLATFIGIVVMGIRY
ATP6_MYCPN       LLGG---------------------------ISPPTSSLTFTFSLGLATFLGIVIMGIRY
ATP6_MYCGA       MVGG---------------------------IAAPTSSSTVTFSLGLMSFFGTFIMGVKY
ATP6_RUBXD       LFPN---------------------------SYPVTSNISFTATLALFTFVLTQYEGVRR
ATP6_PARUW       MVPL---------------------------MKAPSSSLNITAALAICVFCLVQFLNIRN
ATP6_FRACC       VVPG--------------------------AQFPATSRIAVPMVLALVTYVLFNYAGIKA
ATP6_PAEAT       AIPV--------------------------IQLPSFSHVGGAYVMAGIVYFTWIIIGIKK
ATP6_DESRM       LIPT---------------------------LSSPTADKNTTFGLALIVVLLIHYHGLKA
ATP6_CLOAB       LVGI----------------------------EPATKDISVTAGFALVSAFLINATAIKR
                                                                          .  

ATP6_STRA3       KGIGGYLKGFL-------------SPTPAMLPMNLLE-EVTNVASLALRLFGNIFSGEVV
ATP6_STRMU       HGLKTYLKDYL-------------EPTAAMLPMNLLE-ELTNIISLSLRLYGNIYAGEVV
ATP6_STRR6       RGFKKSIKSFM-------------SPV-FVIPMNILE-EFTNFLSLALRIFGNIFAGEVM
ATP6_BACSU       KGLKEYSKDYL-------------RPVPFMLPMKIIE-EFANTLTLGLRLYGNIFAGEIL
ATP6_BUCAI       KGYVGFLKELILQPFNH------PVFSIFNFILEFVS-LVSKPISLGLRLFGNMYAGEMI
ATP6_BUCAP       KGLIGFCKELTLQPFNH------PVFFIFNFLLELVS-LLSKPISLGLRLFGNMYSGEMI
ATP6_BUCBP       KGIKGFLKDLFLQPFHN------PIFFVFNFILESIS-LLSKPVSLGLRLFGNMYAGEMI
ATP6_WIGBR       KGIVVFLKEFFFQPFNN------YLLIPVNLVLELIS-LLSKPVSLSLRLFGNIYSGELI
ATP6_ECOLI       KGIGGFTKELTLQPFNH------WAFIPVNLILEGVS-LLSKPVSLGLRLFGNMYAGELI
ATP6_PROMH       KGVKGFTKELTLQPFNH------PVFIPINLILEGVS-LLSKPVSLGLRLFGNMYAGELI
ATP6_PECAS       KGLGGFVKELTMQPFNH------PVFIPINLILEGVS-LLSKPISLGLRLFGNMYAGELI
ATP6_AERHH       KGIGGFVKELTLQPFNH------PAAIPVNLILETVT-LISKPVSLGLRLFGNMYAGELI
ATP6_AERS4       KGVSGFVKELTLNPFNH------WALIPVNLALELVT-LLSKPISLGLRLFGNMYAGELV
ATP6_BAUCH       KGITGFIKELTMQPFNH------LIFIPLNFILESVS-LLSKPISLALRLFGNIYAGELV
ATP6_BLOFL       NGIIGFVSSLIYHPFNY------SLCIPINFLLEIIS-LCSKPVSLSLRLFGNMYSGELI
ATP6_BLOPB       NGVHGFIKGLMYHPFNH------PTCIPINFIIEVVS-LLSKPVSLSLRLFGNMYSGELI
ATP62_PHOPR      KGIVGFIKELTTQPFEH------PLLYPVNFLLELIT-LISKPISLGLRLFGNMYAGEMI
ATP62_VIBCB      KGVKGFIKELTTQPFSH------PLLYPVNLVLELVT-LISKPISLGLRLFGNMYAGEMI
ATP6_SHESW       KGIGGFTKELTLQPFN------HWSLIPVNFILESVT-LIAKPISLALRLFGNLYAGELI
ATP6_PSYIN       KGITGFVKELTLQPFN------HWAFIPVNFILETIA-LIAKPISLSLRLFGNLYAGELI
ATP6_SHEFN       KGVSGFVKELTFQPFN------HWAMIPVNLLLETVT-LVAKPISLALRLFGNLYAGELI
ATP6_ALIFM       KGLGGFAKELALHPFN------HPIMIPFNLLLEVIS-LLAKPLSLGMRLFGNMFAGEVV
ATP61_PHOPR      KGLGGFAKELALHPFN------HPIMIPFNLLLEVVS-LIAKPISLGMRLFGNMFAGEVV
ATP6_ALTMD       KGIGGFAKELTMQPFG------HPIFIPVNFILETVT-LLARPLSLALRLFGNLYASELI
ATP6_PSEHT       KGIGGFIKELTLHPFSSNNVFVQILLIPFNLLLELIA-LVSKPFSLALRLFGNLYAGELI
ATP6_COLP3       KGVGGFMKELTTQPFG------HWSLYPVNFILETVT-MLARPLSLALRLFGNLYAGELI
ATP6_PSEA6       KGFGGFMKELYAHPFN------TPWLYWFNFILELVS-LIAKPLSLSLRLFGNLYAGELI
ATP6_IDILO       KGVKGFAKEMTFTPFN------HWALIPVNFVLESIT-LLAKPASLALRLFGNMYAGELI
ATP6_MANSM       KGFGGLVKEYTLHPFN------HWSLIPVNFVLESVT-LLAKPISLAFRLFGNMYAGELI
ATP6_PASMU       KGMSGFVKEYTLHPFN------HPLLIPVNLALESVT-LLAKPVSLAFRLFGNMYAGELI
ATP6_HAEDU       KGFNGLAKEYTLHPFN------HWAFIPVNFILETVT-LLAKPISLAFRLFGNMYAGELI
ATP6_HISS2       KGLGGFVKEYTLHPFN------HWAFIPVNFLLEAVT-LLAKPISLAFRLFGNMYAGELI
ATP6_PSEAE       KGIGGFLGELTLHPFSSKNIVVQILLIPVNFLLEFVT-LIAKPVSLALRLFGNMYAGELI
ATP6_PSEPK       KGLGGFIGELTLHPFGSKNIFVQILLIPVNFLLEFVT-LIAKPISLALRLFGNMYAGELV
ATP62_HAHCH      KGVGGFLGELTLQPFGK-------WMLPFNLLLEGVG-LIAKPISLALRLFGNLYAGELL
ATP6_MARMS       KGISGFVGELTLQPFGK-------WMIPFNLLLEGVG-LLAKPVSLALRLFGNLYAGELI
ATP6_CHRSD       KGLSGFLAELTLHPFNASNPFVQALLIPVNFLLEAVT-LLAKPVSLALRLFGNLYAGELI
ATP6_ACIAD       KGIGGFVGELALNPFNPSNPVAKALLIPVNLILELVT-FLARPISLALRLFGNMYAGELI
ATP6_PSYWF       KGLGGFVGELTLHPFSAKNPIAKIILIPINFILEFVT-LIAKPISLGLRLFGNMYAGELI
ATP6_RUTMC       KGAGGFAAELTFHPFGK-------MMLPFNLFLEGVN-LIAKPVSLALRLFGNMYAGEMI
ATP6_THIDA       KGAGGFFSELAFQPFPK-------FLFPVNLLLEGVG-LIAKPISLALRLFGNMYAGEMI
ATP6_PSEMY       KGVGGFTKELSFTPFNH------WALIPFNLFLEIIG-LLTKPLSLALRLFGNMYAGEVV
ATP6_PSEU5       KGFGGFTKELAFTPFNH------WSLVPFNLFLEILG-LLTKPLSLALRLFGNMYAGEVV
ATP6_MARHV       KGVSGFSKELAFNPFNH------WIMIPFNLLLEILA-LIIKPISLALRLFGNMYAGEVV
ATP6_ALKEH       KGAGGFAKELLFHPFGPW-------LLPFNLILNIIE-LIAKPISLSLRLFGNMYAAELI
ATP6_HALHL       QGVGGWLKSWVTHPLGPW-------LAPANLILNIVE-FIAKPVSLSLRLFGNLYAAELV
ATP61_METCA      KGPGHFAMEFLFHPFSHWA------LVPFNLLLNTVE-YLAKPVSLGLRLFGNMYAGELI
ATP6_CHRVO       KGLGGWGKELLTAPFHSSNPVGAIILAPLNFAFQLVE-LAAKPISLSLRLFGNLYAGELI
ATP6_COXBR       KGAIGLGKEVLSRPFGW-------YLMPINVIFRLID-EGVKPISLALRLFGNLFAGELI
ATP6_MYCTU       RGIVGHPIKLLKGHVTL--------LAPINLVEE-----VAKPISLSLRLFGNIFAGGIL
ATP6_MYCLE       RGIVGHPVAVLKGHVAF--------LAPINLVEE-----ITKPISLSLRLFGNIFAGGIL
ATP6_AQUAE       NG-LAYLKHFMGPIPL----M-----APFFFVVEVIS-HIARPITLSLRLFANMKAGALL
ATP6_HYDS0       NG-LGYIKHFMGPIKA----L-----APFFFIIEIMS-HLGRVVSLSLRLFANMKGGAIL
ATP6_SULSY       NG-IGYFKHFLGPVPA----M-----APVFVIIELLS-HLSRPVTLALRLFANMTGGELI
ATP6_HELAH       QGFFKYFAHFAGPVKW----L-----APFMFPIEIIS-HFSRIVSLSFRLFGNIKGDDMF
ATP6_HELHP       QGVLKYFKHFMGPVWW----L-----APLMFPVEIIS-HFSRIISLSFRLFGNIKGDDMF
ATP6_CAMHC       KGFIKYFAGFCGPVKA----I-----APFMFVIEVIS-HLSRIISLSFRLFGNIKGDDLF
ATP6_CAMC5       NGFFKYFGHFMGPSKA----L-----APLMFPVEIIS-HLSRIVSLSFRLFGNIKGDDLF
ATP6_CAMFF       QGIIKYFAHFMGPNKI----L-----APLMFPIEIVS-HLSRIVSLSFRLFGNIKGDDLF
ATP6_CAMJD       QGFIKYFAHFMGPIKL----L-----APLMFPIEIVS-HLSRVVSLSFRLFGNIKGDDLF
ATP6_WOLSU       HGFIKYFAHFAGPVKA----L-----APLLFPIEIIS-HCSRVISLSFRLFGNIKGDDMF
ATP6_NITSB       NGVIHYFAHFAGPVKL----L-----APLMFPIEIVS-HISRIISLSFRLFGNIKGDDLF
ATP6_SULNB       HGVVHYFAHFAGPVKL----L-----APLMFPIEIVS-HLSRIISLSFRLFGNIKGDDLF
ATP6_SULDN       QGVVKYFKHFLGPVWW----L-----YWLMFPIEIVS-HFSRLVSLSFRLFGNVKGDDMF
ATP6_ARCB4       NGFVAYFKHFMGPMPV----L-----APLMFPIEIIS-HLSRIVSLSFRLFGSIRGDDMF
ATP6_DESOH       HG-PKYIKHFLGPVWW----L-----APLIFPIEIIG-HLARVLSLTFRLFGNMMGHESV
ATP6_SYNFM       HG-VKYIKHFMGPVWW----L-----TPLIMPIEIIG-HIARVLSLSIRLFGNVFGEELV
ATP6_DESPS       HG-LGYYKHFIGPMKW----L-----VPLMLPIELIS-NFARLLSLSIRLFGNIMAKEVL
ATP6_GEOUR       HG-FKYIKHFLGPILW----L-----APMMFFIEVIG-HFSRVISLTLRLFGNMNGHELV
ATP6_GEOSL       HG-FHYLQHFMGPIWW----L-----APLMFFIEIIG-HLSRPLSLSLRLFGNMNGHELV
ATP63_PELPD      HG-IGYIKHFCGPILW----L-----TPIMFFIEVIG-HLSRPVSLTLRLFGNMNGHELV
ATP6_GEOLS       HG-FHYLKHFMGPIWW----L-----APLMFFIEVIG-HLSRPVSLTLRLFGNMNGHELV
ATP62_PELCD      HG-IRYFKHFMGPVWW----L-----TPLILPIELIG-HLARPLSLSLRLFGNMYGHEIV
ATP61_PELCD      HG-LKYFKHFVGPVWW----L-----APLILPIEIIG-HLARPLSLALRLFGNMYGHEIV
ATP6_SYNAS       HG-GKYIKQFMGPVWW----L-----VPLMIPIELIS-HLVRPLSLSIRLFGNIEGGHIV
ATP6_DESVV       WG-PGYIKHFMGPMTW----L-----TPLMLPLEIIS-HCARPLSLTLRLFGNIRGEEIV
ATP6_DESAG       WG-AGYIKHFMGPMWW----L-----SPLMLPLELIS-HTARPLSLSLRLFGNIRGEEFV
ATP6_LAWIP       WG-FHYIHHFMGPSIV----L-----APFMIILECIS-HLARPLSLTLRLFGNIKGEEIV
ATP6_KORVE       NGVIGYLKHFLGPVWW----I-----SPLLFVIEICS-HFARIMSLTIRLYANMFAGDMV
ATP6_SOLUE       NGLGRYLAHFAGPMPL----L-----APLMIPIELVS-HMARPLSLTIRLFANMYAGEQV
ATP6_BDEBA       NGPVAYLKHFMGPVIF----L-----APLMFVIEIVS-HIVRPFSLGLRLANVMMGDHTV
ATP6_SORC5       NG-WSYVAHLAGPKWY----L-----APLIFPIEVIS-TCVRPVTLSIRLMLNIGVDHLV
ATP6_TRIV2       KGLG-YFGNYVQP-------------VSFMLPFKIIE-DFTKPLSLSFRLFGNILADELV
ATP6_SYNE7       KGLG-YFGNYVHP-------------TPVMLPFKILE-DFTKPLSLSFRLFGNILADELV
ATP6_TRIEI       KGLG-YFAGYAEP-------------VPFMVPFKIIE-DFTKPLSLSFRLFGNILADELV
ATP6_NOSP7       RGLG-YFKKYIEP-------------TPVLLPIAILE-DFTKPLSLSFRLFGNILADELV
ATP61_ACAM1      KGLG-YFRKYIEP-------------TPVLLPIAILE-DFTKPLSLSFRLFGNILADELV
ATP6_MICAN       KGLG-YFAHYLEP-------------IPVLLPIKILE-DFTKPLSLSFRLFGNILADELV
ATP61_SYNP2      RGIG-YLKKYLEP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATP6_THEEB       RGLK-YFTKYIEP-------------TPVLLPIAILE-DFTKPLSLSFRLFGNILADELV
ATP6_PROMM       KGLR-YFEYYVHP-------------TPIMIPFKIVE-DFTKPLSLSFRLFGNILADELV
ATP6_PROMP       KGWR-YFEYYVHP-------------TPIMLPFKILE-DFTKPLSLSFRLFGNILADELV
ATP6_SYNS3       KGWR-FFELYVEP-------------TPIMLPFKIIE-EFTKPLSLSFRLFGNILADELA
ATP6_SYNR3       KGLK-FFEYYVEP-------------TPIMLPFKIIE-EFTKPLSLSFRLFGNILADELA
ATPI_PAUCH       KGLR-YFEYYVEP-------------TPIMLPFKIIE-DFTKPLSLSFRLFGNILADELV
ATPI_PSINU       KGLS-YFGRYIKP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_ADICA       RGFS-YFGKYIQP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_SPIOL       KGLG-YFGKYIQP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_WELMI       KGLS-FFGKYIQP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_CHAGL       KGLS-YFGKYIQP-------------TPVLLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_STAPU       RGLS-YFGKYLQP-------------TPVLLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_CHLAT       KGLS-YFGKYIQP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_CHAVU       KGLS-YFGKYIKP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_MESVI       KGLR-YFKRYISP-------------TPVLLPINLLE-DFTKPLSLSFRLFGNILADELV
ATPI_NEPOL       KGFG-YFSKYLKP-------------TPILLPINILE-DFTKPLSLSFRLFGNVLADELV
ATPI_TETOB       KGLR-YFNRYVQP-------------AAFLLPINVLE-DFTKPLSLSFRLFGNILADELV
ATPI_OLTVI       KGLG-YFKRYVEP-------------AAFLLPINVLE-DFTKPLSLSFRLFGNILADELV
ATPI_OEDCA       KGLG-YFKRYIQP-------------VVFLLPLNVLE-DFSKPLSLSFRLFGNILADELI
ATPI_STIHE       KGLG-YFKRYVQP-------------AVFLLPINVLE-DFSKPLSLSFRLFGNILADELV
ATPI_CHLVU       KGLG-YFKRYISP-------------AAFLLPINILE-DLTKPLSLSFRLFGNILADELV
ATPI_TUPAK       KGLG-YFKRYVSP-------------AAFLLPINVLE-DFTKPLSLSFRLFGNILADELV
ATPI_BIGNA       KGIS-YFGRYVQP-------------TPFLLPINVLE-DFTKPLSLSFRLFGNLLADELV
ATPI_EUGGR       KGLT-YFKKYVQP-------------TPILLPINILE-DFTKPLSLSFRLFGNILADELV
ATPI_CYACA       KGLR-YFLKYISP-------------TPILLPINILE-DFTKPLSLSFRLFGNIVADELV
ATPI_RHDSA       KGIG-YFARYVQP-------------TPILLPINILE-DFTKPLSLSFRLFGNVLADELV
ATPI_PYRYE       KGLG-YFARYIQP-------------TPVLLPINILE-DFTKPLSLSFRLFGNVLADELV
ATPI_TRICV       KGFG-YFKRYIQP-------------IPLLLPINILE-DFTKPLSLSFRLFGNVLADELT
ATP6_SYNJA       RGLS-YFKKYIEP-------------TPVLLPINVLE-DFTKPLSLSFRLFGNILAEELV
ATP6_GLOVI       SGFG-YFKHYFE--------------SPILAAVWVLE-FFTRPLSLSIRLFGNILAEELV
ATP61_CHLTE      SSLVGYLKTYAEP-------------TPIMLPFNIVG-ELTRTMALAVRLFGNMMSGDMI
ATP61_PELLD      SGLGGYLSTYVKP-------------TPIMLPFNIIS-ELSRTLALAVRLFGNIMSGSMI
ATP6_RHOFT       QGLGGYLKSYVEP-------------TVIMLPFNIIS-EISRTLALAVRLFGNMMSGAMI
ATP61_PROA2      VGFGAYLKSYMKP-------------TFIMLPFNIIS-EFSRTLALAVRLFGNMMSGVMI
ATP6_NITMU       QGLRRYLQSYLKP-------------VPLLLPFNILG-EFTRTLALAVRLFGNMMSGTMI
ATP62_ACAM1      KGVRGYLQQYLQP-------------NPIMLPFNIIG-DFSRIVALAVRLFGNVMSGTMI
ATP61_CROS5      VGITNYLRHYIQP-------------TPVMLPFNLIS-EISRTVSLAIRLFGNIMSTSLL
ATP62_SYNP2      RGILGYLKSYLQP-------------TPIMLPFQIIG-EFSRTLALAVRLFGNIMSGNLL
ATP62_METCA      QGLSAYLKHYLTP-------------NPVLLPFHLIG-EITRTLALAIRLFGNMMSMELI
ATP62_PELPD      QGLRPYLRHYLSP-------------SPFLLPFHVIG-EITRTLALAVRLFGNMMSLETA
ATP61_HAHCH      SGLG-YFKHYLSP-------------SPILLPFHIIS-EFTRTVALAIRLFGNIMSLEMA
ATP6_LEGPC       EGWREYLKHYIKP-------------TPFLLPFHLIS-EISRTLALAVRLFGNIMSLQLT
ATP62_BRASB      RGLRGYLASFAEP-------------KLIMLPLNILS-EITRTFSLMVRLFGNIMSGEFI
ATP6_MOOTA       LGLRGYIRHFFQP-------------APFLFPLNVIE-ELVKPVSLSLRLFGNLFGEEMV
ATP6_RICB8       HGMHFLSLFLPHGTPLWLAP--------LMIIIELFT-YLARPASLSLRLAANMMAGHIL
ATP6_RICCK       HSLRFLTLFLPHGTPLWLAP--------LMIVIELFT-YLARPISLSLRLAANMMAGHVL
ATP6_ORITI       HKLGFFSLFLPKNIPLWLAP--------IMVIIELCV-FISKPISLSLRLTANMVAGHIL
ATP6_ANAMM       QGLHFLRIFLPEGTPLWLAP--------MMVFIKLFA-YVARPVSLAIRLAANMIAGHTI
ATP6_ANAPZ       QGLHFLRIFLPEGTPLWLAP--------MMVFIKLFA-YLARPVSLAIRLAANMIAGHTI
ATP6_WOLPM       REVEFLRILLPKGTPSWLAP--------IIIIIKLFA-YLVRPVSLSIRLAANMIAGHTI
ATP6_WOLTR       KGINFLRILLPEGIPSWLAP--------MMVFIKLFA-YLARPISLSIRLAANMIAGHTI
ATP6_EHRRW       QGTHFLHILLPQGTPMWLAP--------MMVLIELFA-YCARPVSLSIRLAANMIAGHTI
ATP6_NEOSM       QGMGFFAMFLPDGTPNWIAP--------LMIFLEVCT-YLFRPISLAIRLTANMIAGHTI
ATP6_SINMW       HGFGFLKLFVPHGVPGALLP--------LVVAIEIIS-FLSRPISLSVRLFANMLAGHIT
ATP6_AGRFC       HGLHFFGIFAPSGVPKALLP--------LVASIEMIS-FLSRPISLSVRLFANMLAGHIT
ATP6_RHIL3       HGFKFLNVFVPSGVPGILLP--------LVVTIEIIS-FLSRPISLSVRLFANMLAGHIT
ATP6_CHESB       HGFGFLKLFVPEGVPGVLLP--------LVVLIEVIS-FLSRPISLSVRLFANMLAGHIT
ATP6_RHILO       HGLGFLKLFVPKGVPLVMMV--------LVVPIEVIS-FVSRPISLSVRLFANMLAGHIT
ATP61_OCHA4      HGLGFLKLFVPSGVPGIIVP--------LVVAIEIIS-FLSRPISLSVRLFANMLAGHIT
ATP6_BART1       HGISFLKLFVPSGVPVVVLP--------LVTMIEIIS-FLSRPISLSLRLFANMLAGHIT
ATP6_PARL1       HGPRFLKVFVPSGVPMALLP--------LVVAIEIIS-YFSRPISHSVRLFANMLAGHIM
ATP6_AZOC5       HGTHFLHLFVPSGVPAFLLP--------FIVLIEVIS-FLSRPISLSLRLFANMLAGHIA
ATP6_XANP2       HGTHFLHLFVPSGVPAFLLP--------FLVVIEVVS-FLSRPISLSLRLFANMLAGHIA
ATP6_BEII9       HGTHFLGIFAPSGVSPLLLP--------FMIMIEVIS-FISRPISLSIRLFANMLAGHIT
ATP6_RHOP2       NGLKFFKLFVPSGVPIYILP--------LVVFIEVIS-FFLKPVSHSVRLFANMLAGHIA
ATP6_BRADU       NGLKFFSIFVPHGVPGYILP--------LVMFIEILS-FFLRPVSHSVRLFANMLAGHIA
ATP6_RHOPB       NGLGFFKIFVPSGVPVFILP--------LVVFIEVFS-FFLRPISHSVRLFANMLAGHIA
ATP6_BRASO       NGLKFFKLFVPSGIPAVILP--------LVVIIEIIS-FFSRPISHSVRLFANMLAGHVT
ATP6_NITWN       NGLRFFKLFVPSGIPVVILP--------LVVTIEVIS-FLSRPVSHSVRLFANMLAGHIT
ATP6_METS4       HGVHFLDLFVPPGVPGWLKP--------LIVAIEVVS-FISRPISLSVRLFANMLAGHIA
ATP62_OCHA4      HGFRFFRLFMPAGVPVVLAP--------IIVPIEIMS-YISRPVSHSVRLFAVMLAGHIT
ATP6_HYPNA       NGLGFFKLFAPSGAPLPIYI--------ILTPIEIIS-FLARPLTLGLRLFANMLAGHIM
ATP6_MARMM       NGFGFLKLFVPSGVPIFVLP--------LVVVIEIIS-FVSRPLSHSVRLFANMLAGHIL
ATP6_PELUB       HGLGYLKLFVPSGVPAVLLP--------LIVVIEIIS-YLSRPVSLSVRLFANMMAGHTM
ATP6_MAGSA       HGTHYLRMFFPHGAPIATAV--------ILIPIELIS-YFSRPFSLAVRLFANMTVGHII
ATP6_RHORT       HGFHYFRMFFPHGAPLLTAP--------LLIPIELIS-YLSRPFSLSVRLFANMTVGHIM
ATP6_ERYLH       HGFHFFSLFVPSGTPLPMIP--------IIFPIELIS-FLVRPFSLALRLFVAMMAGHVL
ATP6_NOVAD       HGLHFFSLFVPHGTPVPMIP--------IIFPIELIS-FMVRPFSLGLRLFVAMMAGHVL
ATP6_SPHWW       HGFHFFSLFVPHGTPGYMIP--------MIFVIELFS-FLIRPFSLGLRLFVAMTAGHIL
ATP6_SPHAL       HGLHFFSLFVPHGTPLPMIP--------IIAPIEFVS-FMVRPFSLGLRLFVAMTAGHVL
ATP6_ZYMMO       HGLGFFKLFVPHGTPMALIW--------LIPGIEAFS-FILRPFSLALRLFVAMTAGHVL
ATP6_ACICJ       HGIGFLKFFSPPGVPGWLLP--------LLIPIEIVS-FLSRPISLSVRLFANITAGHVM
ATP6_GRABC       HGLHFFSYFFPPGAPKALAP--------IIVPIEIIS-YLSRPVSLSIRLFANMVAGHVM
ATP6_GLUDA       QGPKFFAHFMPAGAPVALAP--------LLVPIEILS-FLSRPVSLSIRLFANMVAGHVM
ATP6_GLUOX       QGVGFLKHFLPAGTPVWLAP--------LLVPIEIIS-FLSRPVSLSIRLFANMVAGHVL
ATP6_DINSH       NGAGFLSLFWVASAPLALRP--------ILAVIEIIS-YFVRPVSHSIRLAGNMMAGHAV
ATP6_ROSDO       NGTAFLSLFWVSSAPLALRP--------VLAIIEIIS-YFVRPVSHSIRLAGNVMAGHAV
ATP6_RHOS5       NGPGFLKMFWVTSAPLAIRP--------VLAVIEVIS-YFVRPVSHSIRLAGNMMAGHAV
ATP6_MAGMM       HGTGFIGFFVPSGVPPMLLI--------LMVPIEIVS-YLSRPVSLSVRLFANMTAGHTV
ATP6_ANASK       MGMGGYVAHLTGGVPKSLAPL-----WLIMVPVEFLG-LFTKPFALTVRLFANMLAGHFV
ATP6_ANADF       VGVGGYFAHMTGGVPKSLWPL-----WFIMIPVEFLG-LFTKPFALTVRLFANMVAGHFV
ATP6_MYXXD       AGLGGYLKHLTGGVAPWLWP--------IMVPVEVLG-LFTKPFALTMRLFANMLAGHIV
ATP62_CHLP8      LGVGGYVKHLTAGTHWSLWI--------IMIPIEIIG-QFTKPVALTIRLFANMTAGHII
ATP62_CHLTE      QGVKGYLQHLTAGTHWALWI--------IMVPIEILG-QFTKPFALTIRLFANMTAGHII
ATP6_CHLPD       HGIKGYLAHLTGGTHPALWI--------IMIPIEFIG-LFTKPVALTIRLFANMTAGHIV
ATP6_PELPB       HGIKGYLAHLTGGTHPALWI--------IMIPIEFIG-LFTKPVALTIRLFANMTAGHIV
ATP6_CHLCH       HGIKGYLAHLTGGTHPALWI--------IMIPIEFIG-LFTKPVALTIRLFANMTAGHIV
ATP62_PELLD      HGLKGYLTHLTAGTHWSLWI--------IMIPIEVIG-LFTKPFALTVRLFANMTAGHIV
ATP62_PROA2      HGIKGYLAHLTAGTHWALWI--------IMIPIEIIG-LFTKPFALTVRLFANMTAGHIV
ATP6_CHLPB       NGIKGYLAHLTAGTHWALWI--------IMIPIEVIG-LFTKPFALTIRLFANMTAGHII
ATP6_CHLT3       HGIGGFLAHLTGGTHPLMWI--------IMVPVEFIG-LFTKPFALTVRLFANMTAGHIV
ATP6_ELUMP       NGLLGYLKHFVPEGTPWFLAP-------LLFFLEILG-LFTKTAALALRLFANMIAGHMV
ATP6_MYCGE       QRWNFFKEFAFGITVKG-----KKYSTFIPNPFSILS-GFAPLFSISLRLWGNILAGTVI
ATP6_MYCPN       QRWSFFKSFTFNITIKG-----KKYSTLIPNPLSFLG-EFAPLFSISLRLWGNILGGTLI
ATP6_MYCGA       QKLAYFRDFFVIIKIK------KKTIPLMINPLNVIG-YFAPLLSISLRLWGNVLAGSIF
ATP6_RUBXD       NGLVTYLKSWAPADLPAKPLM-----YPIMWFLHLIQ-EFTKPLTLALRLYANILAGHLI
ATP6_PARUW       MGIFGFLYHLAGSPKSMLEWL----LAPLMFSLEIIS-QLSRPLTLALRLFGNVLGEDIL
ATP6_FRACC       NGAGPYFKEMIDPAPTAPLWI-----RVLLAPIEILSTLIVRPFTLAVRLFANMFAGHIL
ATP6_PAEAT       NGLKYFKLATVPSGVPWYI-------LPIVVPIEIISNFLVRPVTHSLRLFATMLAGHLI
ATP6_DESRM       NGVGGHIGHYFQPFKP-------------FVVIHLIE-EIARPVTLAFRLYGNIFAGEVL
ATP6_CLOAB       IGVGGYIKSIFSQG-------------PIMVPMNLLE-KVTIPVSLCLRLFINMLVGAIV
                                                             :  .*:   :      

ATP6_STRA3       TGLLLQLAV--------------LSPFTGPLAFALNIVWTAFSMFIG------FIQAYVF
ATP6_STRMU       MALLVQFAD--------------FSPYATPIAFLLNMAWIGFSIFIS------GIQAYVF
ATP6_STRR6       TSLLLLLSH--------------QAIYWYPVAFGANLAWTAFSVFIS------CIQAYVF
ATP6_BACSU       LGLLAGLATSHY------SQSVALGLVGTIGAILPMLAWQAFSLFIG------AIQAFIF
ATP6_BUCAI       FILIAGLLPW------------WTQCFLNV-------PWAIFHILII------SLQAFIF
ATP6_BUCAP       FILIAGLLPW------------WSQFFLNV-------PWAIFHILII------SLQAFIF
ATP6_BUCBP       FILISGLLPW------------WLQWILSV-------PWAIFHILII------SLQSFIF
ATP6_WIGBR       FILISGLLPW------------WLQWILSV-------PWAIFHILII------ILQAFIF
ATP6_ECOLI       FILIAGLLPW------------WSQWILNV-------PWAIFHILII------TLQAFIF
ATP6_PROMH       FILIAGLLPW------------WSQWLLSL-------PWAIFHILII------TLQAFIF
ATP6_PECAS       FILIAGLLPW------------WSQWLLNV-------PWAIFHILII------TLQAFIF
ATP6_AERHH       FILIAGLLPW------------WSQWILSV-------PWAIFHILII------TLQAFIF
ATP6_AERS4       FILIAGLLPW------------WSQWLLSV-------PWALFHILVI------TLQAFIF
ATP6_BAUCH       FILIAGLLPW------------WSQWIISV-------PWALFHIIVI------TLQAFIF
ATP6_BLOFL       FILIAGFLPW------------WSQWMLSV-------PWAIFHILII------ILQAFIF
ATP6_BLOPB       FILISGLLPW------------WGQWVLNL-------PWAIFHILVV------TLQAFIF
ATP62_PHOPR      FILIA-LMPW------------WMQWALSV-------PWALFHILIV------FLQAFIF
ATP62_VIBCB      FILIA-LMPW------------WMQWALSV-------PWALFHILIV------VLQAFIF
ATP6_SHESW       FILIA-LMP-------------WWAQF------ALSVPWAIFHILII------VLQAFIF
ATP6_PSYIN       FILIA-LMP-------------WWSQA------ALSVPWAIFHILVI------VLQAFIF
ATP6_SHEFN       FILIA-LMY-------------GSNVALSALGVGLQLGWLIFHILVI------TLQAFIF
ATP6_ALIFM       FILIAAMLP-------------WYLQW------VGALPWAIFHILVI------LIQAFVF
ATP61_PHOPR      FILIAALMP-------------WWAQW------LGSVPWAIFHILII------TIQAFVF
ATP6_ALTMD       FILIA-TIG-------------YFQLP-------LHFMWAVFHILVL------PLQAFIF
ATP6_PSEHT       FILIG-AIG-------------FMQLP-------LHFVWAVFHILVI------TLQAFLF
ATP6_COLP3       FLLIA-TIG-------------VFQLP-------VHFLWAAFHLLVI------PLQAFIF
ATP6_PSEA6       FILIAGTLG-------------VWQLP-------IHFLWAAFHLLVI------PLQAFIF
ATP6_IDILO       FILIA-MIG-------------FWQLP-------AHFAWAVFHILVI------TLQAFIF
ATP6_MANSM       FILIAVMYS-------------ANA-AIAALGIPLHLAWAIFHILIV------TLQAFIF
ATP6_PASMU       FILIAVMYM-------------ANNFALNSMGIFMHLAWAIFHILVI------TLQAFIF
ATP6_HAEDU       FILIAVMYM-------------ADNFALQALGIPLHLVWAIFHILVI------TLQAFIF
ATP6_HISS2       FVLIAVMYM-------------ADNIIPQVLGIPLHLIWAIFHILVI------TLQAFIF
ATP6_PSEAE       FILIAVMFGSGM------FLLSALGVALNW-------AWAVFHILII------TLQAFIF
ATP6_PSEPK       FILIAVMFGSGL------LWLSGLGVVLQW-------AWAVFHILII------TLQAFIF
ATP62_HAHCH      FILIALM-------------PFWAQWALSV-------PWAIFHILVI------VLQAFIF
ATP6_MARMS       FILIAIL-------------PWGVQWALSV-------PWAIFHILII------VLQAFIF
ATP6_CHRSD       FILIAMI-------------GLW-QLPLHF-------AWATFHILII------TLQAFIF
ATP6_ACIAD       FILIALL-------------PFWIQWALSV-------PWAIFHILVI------TLQAFIF
ATP6_PSYWF       FVLIALM-------------PFWIQWALSV-------PWAIFHILII------TLQAFVF
ATP6_RUTMC       FILIALLP-------------FWVQWSLSL-------PWAIFHILIV------LLQAFIF
ATP6_THIDA       FILIALM--------------FGGGWVLALFGGALQWAWAVFHILII------TLQAFIF
ATP6_PSEMY       FILIALL-------------PFYVQWGLNV-------PWAIFHILVI------PLQAFIF
ATP6_PSEU5       FILIALL-------------PFYVQWTLNV-------PWAIFHILVI------PLQAFIF
ATP6_MARHV       FILIALL-------------PLWIQWTLNV-------PWAIFHILVI------PLQAFIF
ATP6_ALKEH       FILISLL-------------PWWIQWALGT-------PWAIFHILVI------PLQAFIF
ATP6_HALHL       FILISLL-------------PWWIQWALGT-------PWAIFHILVV------PLQAFIF
ATP61_METCA      FILIALL-------------PWWVQPALSF-------PWAVFHILII------TLQAFIF
ATP6_CHRVO       FILIALL-------------PWGLQWVLGA-------PWAIFHILII------TLQAFVF
ATP6_COXBR       FILIALLPW-------------WSQFTLGM-------VWTLFHLLVI------TVQAFIF
ATP6_MYCTU       VALIALFPP-------------YIMWAPNA-------IWKAFDLFVG------AIQAFIF
ATP6_MYCLE       VTLIALFPP-------------YIMWAPNA-------IWKSFDLFVG------AIQAFIF
ATP6_AQUAE       LLTLVSLVIKNP--------------------FTLVVSPVVLIFVIAIKFLAIFIQTYIF
ATP6_HYDS0       LISIIGVLIGNP--------------------FTLAVSPIVLVFLITIKVLAIVLQAFIF
ATP6_SULSY       SVVLIMLV---P--------------------F-LIPMPVMLIHLI-----AVFLQTYVF
ATP6_HELAH       LLIMLLLV---P--------------------WVIPVAPFMVLFFMG------ILQAFVF
ATP6_HELHP       LLVMLMLA---P--------------------WIVPVAPFAILTFMA------LLQAFVF
ATP6_CAMHC       LLVMLTLA---P--------------------VLVPMIPYALLSFMA------ILQAFIF
ATP6_CAMC5       LLVMLTLA---P--------------------WFAPLPAYALLTLMA------VLQTFIF
ATP6_CAMFF       LMVVLSLA---P--------------------WVAPLPAFALLTFMA------LLQTFIF
ATP6_CAMJD       LMVILALV---P--------------------YIAPLPAYVLLTFMA------FLQAFIF
ATP6_WOLSU       LLVMLMLA---P--------------------WIAPLPAFVILTFMA------FLQAFIF
ATP6_NITSB       VWVLLMLA---P--------------------WIVPLPGFALMTFSA------FLQTFIF
ATP6_SULNB       LWVLLMLV---P--------------------FVAPLPAYLLLTFSA------LLQTFVF
ATP6_SULDN       LMVILMLA---P--------------------WVLPMIPYALLTFMA------FLQAFIF
ATP6_ARCB4       LMVLLMLV---P--------------------WILPLPGFFLLTAFG------VLQAFIF
ATP6_DESOH       LVILFMLGGA----------------------FFAPLPIMALGIFVA------FVQAFVF
ATP6_SYNFM       LGILFFLAGF----------------------YLAPLPMMFLGLFTG------FIQAFIF
ATP6_DESPS       LGILFGLAGM----------------------FFAPLPIMVLGVLVS------LVQAMVF
ATP6_GEOUR       LMIFFGLAP-----------------------FLVPLPMMLMGVLVS------FIQAFVF
ATP6_GEOSL       LMIFFALAP-----------------------FLVPLPMMLMGVLVS------FIQAFVF
ATP63_PELPD      LIIFFGLAP-----------------------FLVPLPMMLMGVLVS------FIQAFVF
ATP6_GEOLS       LMIFFALAP-----------------------FLVPLPMMLMGVLVS------FIQAFVF
ATP62_PELCD      LMIFFSLVP-----------------------LLLPIPMMLMGILVA------FIQTFVF
ATP61_PELCD      LVIFFTLVP-----------------------LLLPIPMMLMGILVA------FIQTFVF
ATP6_SYNAS       VAVLFLLAP-----------------------FLVPVPILFLKVFIS------LIQTLVF
ATP6_DESVV       MVLFFLMAP-----------------------IVGTLPVYFLFLLGK------VLQAFIF
ATP6_DESAG       LILFFMLAP-----------------------IIGTIPIYFLFTLAK------VLQAFIF
ATP6_LAWIP       LLLFFLMAP-----------------------LVGTIPVYFLFLLAK------LLQAFIF
ATP6_KORVE       TLAFFSLVP-----------------------LGFPVVFMGLHIFVS------LIQTYIF
ATP6_SOLUE       TMVFLKLTF-----------------------LFVPAVFMGLHVFVS------FLQAYIF
ATP6_BDEBA       LSVFLDLVP-----------------------IGVPIPFYVMGLFVC------FVQAFVF
ATP6_SORC5       ASIFLGLVA-----------------------LFVPVPLMFLAIIVI------VVQTLVF
ATP6_TRIV2       VGVLVLLVP-----------------------LFVPLPVMALGLFTS------AIQALIF
ATP6_SYNE7       VAVLVLLVP-----------------------LFVPLPAMILGLFTS------AIQALIF
ATP6_TRIEI       VGVLVLLVP-----------------------LFIPLPLMVLGLFLS------AIQALIF
ATP6_NOSP7       VAVLVLLVP-----------------------LFVPLPVMALGLFTS------AIQALVF
ATP61_ACAM1      VAVLVLLVP-----------------------LIVPLPVMLLGLFTS------GIQALVF
ATP6_MICAN       VAVLVFLVP-----------------------LVVPLPLMALGLFTS------AIQALVF
ATP61_SYNP2      VGVLVFLVP-----------------------LIIPLPLMALGLFAS------AIQALIF
ATP6_THEEB       VSVLVLLVP-----------------------LFVPLPVMVLGLFTS------AIQALVF
ATP6_PROMM       VAVLVFLVP-----------------------LFLPVPVMFLGLFTS------AIQALIF
ATP6_PROMP       VGVLVFLVP-----------------------LVLPIPVMFLGLFTS------AIQALIF
ATP6_SYNS3       VGVLVYLVP-----------------------LIVPLPVMLLGLFTS------AIQALIF
ATP6_SYNR3       VAVLASLVP-----------------------LLVPLPVMLLGLFTS------AIQALIF
ATPI_PAUCH       VGVLAFLVP-----------------------ILVPLPAMFLGLFTS------AIQALIF
ATPI_PSINU       VAVLISLVP-----------------------LVVPIPMMFLGLFTS------AIQALIF
ATPI_ADICA       VAVLVSLVP-----------------------LIVPVPMMLLGLFTS------GIQALIF
ATPI_SPIOL       VVVLVSLVP-----------------------LVVPIPVMFLGLFTS------GIQALIF
ATPI_WELMI       VAVLVSLVP-----------------------LVVPIPVMLLGLFTS------GIQALIF
ATPI_CHAGL       VAVLVSLVP-----------------------LVIPVPMMFLGLFTS------GIQALIF
ATPI_STAPU       VAVLVSLVP-----------------------LVVPIPMMFLGLFTS------GIQALIF
ATPI_CHLAT       VAVLISLVP-----------------------LVIPVPMMLLGLFTS------GIQALIF
ATPI_CHAVU       VAVLVSLVP-----------------------LVVPIPMMFLGLFTS------AIQALIF
ATPI_MESVI       VGVLITLVP-----------------------LVVPMPLMLLGLFTS------AIQALIF
ATPI_NEPOL       VAVLISLVP-----------------------LVVPIPMMLLGLFAG------AIQSLIF
ATPI_TETOB       VGVLVSLVP-----------------------LIIPIPIMLLGCFTS------AIQALVF
ATPI_OLTVI       TGVLVALVP-----------------------LVIPIPLMLLGLFTS------AIQALVF
ATPI_OEDCA       VGVLVALVP-----------------------LFVPIPLMLLGVFTS------AIQALVF
ATPI_STIHE       VGVLVALVP-----------------------LIVPIPVMLLGVFTS------AIQALVF
ATPI_CHLVU       VGVLVSLVP-----------------------LVVPIPIMLLGLFTS------AIQALVF
ATPI_TUPAK       VGVLVALVP-----------------------LVVPIPIMLLGLFTS------GIQALVF
ATPI_BIGNA       IAVLVSLVP-----------------------LFVPVPLMLLGLFTS------AIQALVF
ATPI_EUGGR       VAVLVSLVP-----------------------LIVPVPLIFLGLFTS------GIQALIF
ATPI_CYACA       VAVFNLLFP-----------------------LFLPLPVMVLGLFAS------SIQALIF
ATPI_RHDSA       VSVFALLVP-----------------------ILIPLPVMTLGLFAS------SVQALIF
ATPI_PYRYE       VSVFTLLIP-----------------------ILIPLPVMILGLFAS------SIQALIF
ATPI_TRICV       ITVLTSLVP-----------------------LVIPLPIMALGIFAG------SVQALIF
ATP6_SYNJA       IAVLVLLVP-----------------------LLIPVPVMILFLFTG------AIQALIF
ATP6_GLOVI       VAVLILLVP-----------------------ILVPVPLMILFLLTG------AIQALVF
ATP61_CHLTE      LVILLTISP-----------------------LVFPVLMNILGLLTG------MVQAYIF
ATP61_PELLD      LAILLTVTP-----------------------FVFPVLMSVLGLLTG------MVQAYIF
ATP6_RHOFT       IGILLTITP-----------------------FIFPIVMTALGLLTG------MVQAYIF
ATP61_PROA2      IGILLGIAP-----------------------LFFPVLMSVLGLLTG------MVQAYIF
ATP6_NITMU       LAIMLIITP-----------------------FIFPVVMGVLHLLIG------GVQAYIF
ATP62_ACAM1      VGILLSVAP-----------------------LFFPVMMQVLGLLTG------VIQAYIF
ATP61_CROS5      VAILISIVP-----------------------LFFPAVMTLFGLLVG------VIQAYVF
ATP62_SYNP2      AAILLALVP-----------------------LFVPVAMNLLGLVFG------VIQAYVF
ATP62_METCA      GLLLLIIGG-----------------------LFVPVPVLLLHVVEG------LVQAYIF
ATP62_PELPD      ALLVLLVAG-----------------------LFAPIPLLMLHIVEA------LVQAYIF
ATP61_HAHCH      ALLILLVAG-----------------------FLAPVPILMLHIIEA------LVQAYIF
ATP6_LEGPC       ALIVLMIAG-----------------------FLVPIPILILHIIEA------IIQAYIF
ATP62_BRASB      IGLVVALAG-----------------------LFVPIPLMALEILVG------LVQAYIF
ATP6_MOOTA       VTILFLMIP-----------------------FLLPTPIMLLGVLMG------TIQAFVF
ATP6_RICB8       LKVIASFVITLM-------------IYLKFLPIPLMVILIGFEIFVA------ILQAYIF
ATP6_RICCK       LKVIASFTISLM-------------IYLKFISIPLMVILIGFEIFIA------VLQAYIF
ATP6_ORITI       LKIIAWSIVSLT-------------WLFKPLPIALVIVLIGFELFIS------ILQAYIF
ATP6_ANAMM       IAVIADFVLKMH-------------LVLAPLPFAFIMGLIAFEIFVA------ILQAYIF
ATP6_ANAPZ       IAVIAEFVLKMH-------------PVLAPLPFAFIMVLIAFEIFVA------ILQAYIF
ATP6_WOLPM       IKVIAGFIVNMN-------------IFFTPAPFLFIIALIGFEVFVA------ILQAYIF
ATP6_WOLTR       IKVVAGFIMNMH-------------LILTPIPFLFIIALIGFEVFVA------ILQAYIF
ATP6_EHRRW       IKVIAGFVINMN-------------IFLTPLPIAFIIILIGFEIFVA------ILQAYIF
ATP6_NEOSM       LKVIAGFVYPTS-------------LLISPLSFLFVVVLIVFEVFIA------MLQAYIF
ATP6_SINMW       LKVFAGFVASLS-AFGALG------IGGAILPLIMTVALTGLEFLVA------FLQAYVF
ATP6_AGRFC       LKVFAGFVASMG-ALGALG------VGGAVLPLIMTVAMTALEFLVA------FLQAYVF
ATP6_RHIL3       LKVFAGFVASLG-ALGAVG------VGGAVLPLIMTVALTGLEFLVA------FLQAYVF
ATP6_CHESB       LKVFAGFVTSLG-ALGVAG------AAGAVLPLAMTVALTGLELLVA------FLQAYVF
ATP6_RHILO       LKVFSGFVVSLS-ALGAVG------VAGSILPLAMAVALTALELLVA------FLQAYVF
ATP61_OCHA4      LKVFAGFVVSLA-ALGPIG------IGGAVLPLIMTVAITALEFLVA------FLQAYVF
ATP6_BART1       LKVFAGFIVSMI-GVGIVG------VGGAVLPLIMTVAITALEFLVA------FLQAYVF
ATP6_PARL1       LKVFAGFVLTFM-TMGVVG------WAGMILPLFMIVALTALEFLVA------ALQAYVF
ATP6_AZOC5       LKVFAFFVVGLG-SAGFLG------WLGATLPFFMIVALTALELLVA------ILQAYVF
ATP6_XANP2       LKVFAFFVVGLA-SAGVVG------WFGATLPFFMIVALYALELLVA------MLQAYVF
ATP6_BEII9       LKVMGGFVAGLL-GAGSVY------ALVAPLPLAMVVIFTAFELLVA------FLQAYVF
ATP6_RHOP2       LKVFASFIAMLG-ALGVVG------WVGAVLPLGLTIALTALELLVA------FLQAYVF
ATP6_BRADU       LKVFAGFVAMLGFSLGALG------WVGGVLPLALTVALYALEILVA------FLQAYVF
ATP6_RHOPB       LKVFASFIPLLA-GLGIAG------YFGAVLPLGMVIALTALELLVA------FLQAYVF
ATP6_BRASO       LKVFASFVTMLG-ALGFVG------KVGALLPLGLTVALTGLELMVA------FLQAYVF
ATP6_NITWN       LKVFASFVTMLG-AMGIVG------VFGAVLPLALVVALTALELLVA------FLQAYVF
ATP6_METS4       LKIFAGFVPALL-AAGIWG------ILSP-LPLALSVAITALEMLVA------VLQAYVF
ATP62_OCHA4      LKVFAGFVIGLG-SLGTLG------MLTAVLPLAMTVALTALELLMA------VIQAYVF
ATP6_HYPNA       LKLFAGFTVMLIGAGAIYI------PVAALA-FAMGVALNALEFLVA------GLQAYVF
ATP6_MARMM       LKVFAGFVVTLAAAWGGFG------YLAGIAPLAMAVSLTALEFLVA------FLQAYVF
ATP6_PELUB       MKVFGGFVISLG-------------IVGGWLPLSFSVALTGLEILVA------FLQAYVF
ATP6_MAGSA       LKVMGGFVVSLGA----FY------LIPGAVPFAFLSAITVLEFGIA------LLQAYVF
ATP6_RHORT       LKVLAGFVIMLG-------------VVGGVVPFAVVLGVTVLEFFIA------ALQAYVF
ATP6_ERYLH       LKVLSSFVIDGINAGAGFG------LLVGAPSFILMIGISALEILVA------GIQAYVF
ATP6_NOVAD       LEVLSGFVISGTNAGVGTF------FLAAVPSFLLMIGICALELLVA------GIQAYVF
ATP6_SPHWW       MKVLAGFVINGINAGALTV------AIVSIPSFILMIGITLLELLVC------AIQAYVF
ATP6_SPHAL       LKVLSGFVINGFNAETLWLG-----SIVSVLSFTLMIGISALELLVA------GIQAYVF
ATP6_ZYMMO       LEVLANFIVNPPVQSASPAFLAGYYTLVGIPTFLLMIGISALEFLVC------AIQAYVF
ATP6_ACICJ       WEVFAGFMLMLVSGLGAVG------VVAAIIPLGLNIALTALEFLVA------FLQAYVF
ATP6_GRABC       FEVFATFMFLLIGALGTFG------YFAALLPMTLNVTLVGFELLVA------FLQAYVF
ATP6_GLUDA       LEMFAAFTIML-AGLGLFG------DVLAVGPVVINVALMALELLVG------ALQAYVF
ATP6_GLUOX       LEVFAGFTIML-AGLGAFG------HVLAIAPIAINIALTALELLVG------VLQAYVF
ATP6_DINSH       LKVFAGFAQVAA---------------VAPIAIIGVMAIYGLEVLVS------AIQAYVF
ATP6_ROSDO       IKVFAGFAALTL---------------VSPVAILGITAMYGLEVLVS------FIQAYVF
ATP6_RHOS5       IKVIAGFASIAV---------------VSPVVVGAVTAIYALELLVA------VVQAYVF
ATP6_MAGMM       LAIMFFFAATLP-------------LGGLLMPAAFATVFTGFELFIG------FIQAYIF
ATP6_ANASK       ILALLGLIFALGTP-----------WVA-FGSVPMALSIFLLELFVA------FVQAYIF
ATP6_ANADF       ILALLGLIFALNSQ-----------WIA-IASVPMALSIYMLELFVA------FVQAYIF
ATP6_MYXXD       YFFLLGLIFLLGHP-----------AVA-AVSVPFAFAIFLLELFVA------FVQAYVF
ATP62_CHLP8      ILSLIFISFILESY-----------IVAAAVSVPFAIFIYLLEIFVA------FLQAFVF
ATP62_CHLTE      ILSLFFISFILKSY-----------IVAVAVSIPFAIFIYLLELFVA------FLQAYVF
ATP6_CHLPD       ILSLIFISFILKSY-----------IVAVAMSVPFSIFIYLLEIFVA------FLQAYIF
ATP6_PELPB       ILSLIFISFILQSY-----------IVAVVMSVPFSIFIYLLELFVA------FLQAFIF
ATP6_CHLCH       ILSLIFISFILKSY-----------IVAVVMSVPFSIFIYLLELFVA------FLQAFIF
ATP62_PELLD      ILSLIFISFILKSY-----------VVAAAVSVPFSIFIYLLEIFVA------FLQAFIF
ATP62_PROA2      ILSLIFISFILKSY-----------IVAMFVSVPFSIFIYLLEIFVA------FLQAFIF
ATP6_CHLPB       ILSLIFISFILKSY-----------IVAIFVSVPFSIFIYLLEIFVS------FLQAFIF
ATP6_CHLT3       IISLLGLIFVFKTY-----------MIA-PVSVAFALFIYLLEILVA------FLQAYIF
ATP6_ELUMP       IICFICLIFIMTAINKYAG------IFTAIPSTGLSLFVNLLEVLVI------LIQTYVF
ATP6_MYCGE       LALFYNFWIFIFSSINNQ--PLALSLGTVFAGLITPVLHIYFDVIAG------VLQGYVF
ATP6_MYCPN       LALFYNFWFFAFSTLSNK--PLALSLGAIFAGILTPALHVYFDVVVG------TLQGYVF
ATP6_MYCGA       IALLYSLFRTFFTLWSPSSFSVGLVFGTLAGGLVIPAFHVYFDILVS------AIQAFVF
ATP6_RUBXD       IFVFLSLILYFG-------------LPTAFVSVPFAVVFYAFEIFVA------VIQAYIF
ATP6_PARUW       IGTFALMGVVMI------------SSVETFVGIPLQLPFMFLGLLTS------FMQALVF
ATP6_FRACC       LLVFSLGADYLLPK---------PPYVFGAASLLVAIILTAFELVID------ALQAYII
ATP6_PAEAT       VMLAGSGIEFLVMQENVLL------KGASVLVLVGAVAMYMLEALIM------ALQAYVF
ATP6_DESRM       IAVLLGLININA---------------YVFGGFIPSVIWLAFSVFVG------FVQAFVF
ATP6_CLOAB       MSLIYSTPA---------------------------------------------------
                                                                             

ATP6_STRA3       IILSSSYIGHKVHGDEEE---------------------------------
ATP6_STRMU       VLLTTTYIGKKVNIDTKGN--------------------------------
ATP6_STRR6       TLLTSVYLGNKINIEEE----------------------------------
ATP6_BACSU       TMLTMVYMSHKISHDH-----------------------------------
ATP6_BUCAI       MVLTIVYLSMASQSHKD----------------------------------
ATP6_BUCAP       MVLTIVYLSMASQSH------------------------------------
ATP6_BUCBP       MVLTIVYLSMASTKH------------------------------------
ATP6_WIGBR       MILTIIYLEMSLEKPDKNTI-------------------------------
ATP6_ECOLI       MVLTIVYLSMASEEH------------------------------------
ATP6_PROMH       MVLTIVYLSMASEEH------------------------------------
ATP6_PECAS       MVLTVVYLSMASEEH------------------------------------
ATP6_AERHH       MVLTIVYLSMAQEDHG-----------------------------------
ATP6_AERS4       MVLTIVYLSMASEDH------------------------------------
ATP6_BAUCH       MVLTVVYIAMAYEQHK-----------------------------------
ATP6_BLOFL       MVLTIIYLSESHYEYKP----------------------------------
ATP6_BLOPB       MVLTVIYLSTAHDSC------------------------------------
ATP62_PHOPR      MVLTIVYLAMATEEH------------------------------------
ATP62_VIBCB      MVLTVVYLGMAVEEH------------------------------------
ATP6_SHESW       MMLTIVYLSMAHEEH------------------------------------
ATP6_PSYIN       MMLTIVYLSMAHEDH------------------------------------
ATP6_SHEFN       MMLTIVYLSMAHEDH------------------------------------
ATP6_ALIFM       MMLTIVYLSMAHEDSDH----------------------------------
ATP61_PHOPR      MMLTIVYLAQAHEDNH-----------------------------------
ATP6_ALTMD       MMLTIVYLSLACEDH------------------------------------
ATP6_PSEHT       MMLTIVYLSMASSDNH-----------------------------------
ATP6_COLP3       MMLTIVYLSLAHEDH------------------------------------
ATP6_PSEA6       MMLTIVYLSLASEEH------------------------------------
ATP6_IDILO       MMLTIVYLSMASSEH------------------------------------
ATP6_MANSM       MMLTVVYLSIAYNKAEH----------------------------------
ATP6_PASMU       MMLTVVYLSMGYNKAEH----------------------------------
ATP6_HAEDU       MMLTIVYLSIAYNKADH----------------------------------
ATP6_HISS2       MMLTVVYLSIAYNKSDH----------------------------------
ATP6_PSEAE       MMLTIVYLSMAHEDNH-----------------------------------
ATP6_PSEPK       MMLTIVYLSMAHEDNH-----------------------------------
ATP62_HAHCH      MMLTIVYLSMAHEDH------------------------------------
ATP6_MARMS       MMLTIVYLSMAHENH------------------------------------
ATP6_CHRSD       MMLTIVYLSMATEKH------------------------------------
ATP6_ACIAD       MMLTIVYLSMASEKH------------------------------------
ATP6_PSYWF       MMLTIVYLSLASQTEH-----------------------------------
ATP6_RUTMC       MTLVIVYMDMAHQKKH-----------------------------------
ATP6_THIDA       MTLTIVYLDMAHAEHH-----------------------------------
ATP6_PSEMY       MVLTVVYLSAAHEDHH-----------------------------------
ATP6_PSEU5       MVLTVVYLSSAHEDHGHAELTP-----------------------------
ATP6_MARHV       TVLTVVYLSAAHEDH------------------------------------
ATP6_ALKEH       MMLTVVYLSMANEHEEH----------------------------------
ATP6_HALHL       MMLTVVYLAMAYEEH------------------------------------
ATP61_METCA      MVLTIVYLSLAHESH------------------------------------
ATP6_CHRVO       MMLTIVYLSLAVEAH------------------------------------
ATP6_COXBR       MMLTVVYISLAAESH------------------------------------
ATP6_MYCTU       ALLTILYFSQAMELEEEHH--------------------------------
ATP6_MYCLE       SILTILYFSQAMEVEDHHD--------------------------------
ATP6_AQUAE       MILSVVYIAGAVAHEEH----------------------------------
ATP6_HYDS0       MILSTIYIAGAVVHEEH----------------------------------
ATP6_SULSY       VVLTTVYIAGAITHAEH----------------------------------
ATP6_HELAH       MILTYVYLAGAVLTDEGH---------------------------------
ATP6_HELHP       MILTYVYIHGAVVVDEEH---------------------------------
ATP6_CAMHC       MVLSYVYLAGAVVVDEEH---------------------------------
ATP6_CAMC5       MMLTYVYLAGAVAIEEH----------------------------------
ATP6_CAMFF       MILTYVYLAGAVVVSEEH---------------------------------
ATP6_CAMJD       MILTYVYLAGATVVEKGH---------------------------------
ATP6_WOLSU       MILTYVFLAGAVLAEEEAGH-------------------------------
ATP6_NITSB       MILTYVYLAGAVLLHEESL--------------------------------
ATP6_SULNB       MILIYVYLAGAVAIDEEHEKAPAPAIDTMGAV-------------------
ATP6_SULDN       MMLTYVYLGSAIAVEEH----------------------------------
ATP6_ARCB4       SILTYVYIAGSIMMEHEEH--------------------------------
ATP6_DESOH       FLLSVMYFAGAMEHAH-----------------------------------
ATP6_SYNFM       CLLSMMYFAGAIEHAH-----------------------------------
ATP6_DESPS       VLLTVVYFAQAQEHAH-----------------------------------
ATP6_GEOUR       MLLAMIYIQGSLEEGH-----------------------------------
ATP6_GEOSL       MLLAMIYIQGSLEEAH-----------------------------------
ATP63_PELPD      MLLTMIYIQGSLEEAH-----------------------------------
ATP6_GEOLS       MLLAMIYIQGSLEEAH-----------------------------------
ATP62_PELCD      MLLSMIYIAGALEEAH-----------------------------------
ATP61_PELCD      TLLAMIYIAGALEEAH-----------------------------------
ATP6_SYNAS       MLLSMMYIAGAMEEAH-----------------------------------
ATP6_DESVV       FMLTMVYLKGAFEHAH-----------------------------------
ATP6_DESAG       FMLATIYLKGSLEHAH-----------------------------------
ATP6_LAWIP       YILTLIYLKGALESAH-----------------------------------
ATP6_KORVE       ITLAAVYLAEATAHGHD----------------------------------
ATP6_SOLUE       MLLTMMYVAGAVAHEH-----------------------------------
ATP6_BDEBA       TLLSMVYVAFAIAHDH-----------------------------------
ATP6_SORC5       CLLSCIYIGLATEKADHH---------------------------------
ATP6_TRIV2       ATLAAAYIGEAMEDHHGEEHEEHH---------------------------
ATP6_SYNE7       ATLAASYIGEAVEEH-GEEHAE-----------------------------
ATP6_TRIEI       ATLAANYIGEALEEHGAEDHD------------------------------
ATP6_NOSP7       ATLAGAYIHEAMEGHGGEEHEEH----------------------------
ATP61_ACAM1      ATLAGAYIHESLEGHG-EEEEAH----------------------------
ATP6_MICAN       ATLAGAYIHEALESEHEEEHA------------------------------
ATP61_SYNP2      ATLAAAYIAEAMEGHH-----------------------------------
ATP6_THEEB       ATLAATYIGEAMEGHGGDHEAAHS---------------------------
ATP6_PROMM       ATLAAYYIGEAVEEHH-----------------------------------
ATP6_PROMP       ATLAAYYIGEAVEEHH-----------------------------------
ATP6_SYNS3       ATLAAFYIGEGLHEAH-----------------------------------
ATP6_SYNR3       ATLAAFYIGEAVHEEAH----------------------------------
ATPI_PAUCH       ATLAANYIGEAVHEEHH----------------------------------
ATPI_PSINU       ATLAAAYIGESMEGHH-----------------------------------
ATPI_ADICA       ATLAAAYIGESMEGHH-----------------------------------
ATPI_SPIOL       ATLAAAYIGESLEGHH-----------------------------------
ATPI_WELMI       ATLAAAYIGESLENHH-----------------------------------
ATPI_CHAGL       ATLAGAYIGESLEGHH-----------------------------------
ATPI_STAPU       ATLAAAYIGESMEGHH-----------------------------------
ATPI_CHLAT       ATLAAAYIGESLEGHH-----------------------------------
ATPI_CHAVU       ATLAAAYIGESIEDHH-----------------------------------
ATPI_MESVI       ATLAAAYIGEAVEDHH-----------------------------------
ATPI_NEPOL       ATLAGAYIGEALEGH------------------------------------
ATPI_TETOB       ATLAGAYIGEAVEDHH-----------------------------------
ATPI_OLTVI       STLAGAYIGESLEDHH-----------------------------------
ATPI_OEDCA       ATLAGAYIGESIEDHH-----------------------------------
ATPI_STIHE       ATLAGAYIGESVEDHH-----------------------------------
ATPI_CHLVU       ATLAGAYIGESVEDHH-----------------------------------
ATPI_TUPAK       ATLAGAYIGESIEDHH-----------------------------------
ATPI_BIGNA       STLAGAYIGESVEDHH-----------------------------------
ATPI_EUGGR       ATLSGSYIGEAMEGHH-----------------------------------
ATPI_CYACA       ATLSASYIGESLADHH-----------------------------------
ATPI_RHDSA       STLSAAYIGEALEDHH-----------------------------------
ATPI_PYRYE       STLSAAYIGEAMEGHGEE---------------------------------
ATPI_TRICV       STLAAAYIAEALE--------------------------------------
ATP6_SYNJA       STLSAAYIGEALEGHGGGDHHD-----------------------------
ATP6_GLOVI       STLTASYVGEAVEDHDDHH--------------------------------
ATP61_CHLTE      SILATVYIAAATRTR------------------------------------
ATP61_PELLD      SILATVYISAATRARKE----------------------------------
ATP6_RHOFT       SILAAVYIAAATRGRKPKPEPGEKH--------------------------
ATP61_PROA2      SMLATVYIAAATKSRDE----------------------------------
ATP6_NITMU       SILATVYIAAATSDNGENAGASDDEGGEDAKSACAAGGKICKHKP------
ATP62_ACAM1      AILAMVFIAAASQVDQHNYQTDSEVSHG-----------------------
ATP61_CROS5      TILAMVYIASGMNLQQRKTGNHHA---------------------------
ATP62_SYNP2      AILALVYIASAATVQEKKQSISMEENS------------------------
ATP62_METCA      GILALVYIAGGIQSGPQQENHSP----------------------------
ATP62_PELPD      GMLTLVYIAGAIQSLEARRSPKEEET-------------------------
ATP61_HAHCH      GMLALIYVAGAMQQTTESPITSSSRSTSGAP--------------------
ATP6_LEGPC       GMLALIYIAGGIQAHELKSQGESL---------------------------
ATP62_BRASB      TVLATVFIGAAVGSVAKG---------------------------------
ATP6_MOOTA       TLLTITYIANFVHGH------------------------------------
ATP6_RICB8       TILSCVYLNDAVNLH------------------------------------
ATP6_RICCK       TILSCMYLNDAINLH------------------------------------
ATP6_ORITI       TILSCVYLRDVVNLH------------------------------------
ATP6_ANAMM       TVLTTVYLSDAVAGH------------------------------------
ATP6_ANAPZ       TVLTTVYLSDAVAGH------------------------------------
ATP6_WOLPM       TILTCVYLSDAVK--------------------------------------
ATP6_WOLTR       TILTCIYLSDAVK--------------------------------------
ATP6_EHRRW       TVLTCVYLSDAVNKH------------------------------------
ATP6_NEOSM       VMLTCVYLNDSLFKH------------------------------------
ATP6_SINMW       AVLTCMYLNDAVHPGSH----------------------------------
ATP6_AGRFC       AVLTCMYLNDAVHGGH-----------------------------------
ATP6_RHIL3       AVLTCMYLNDAIHPGGH----------------------------------
ATP6_CHESB       AVLTCMYLNDALHPGH-----------------------------------
ATP6_RHILO       AVLTCMYLNDALHPSH-----------------------------------
ATP61_OCHA4      TVLTCMYINDAVHPGH-----------------------------------
ATP6_BART1       TVLTCMYLNDAIHPGH-----------------------------------
ATP6_PARL1       TILTCMYLHDALHPGH-----------------------------------
ATP6_AZOC5       AVLTSIYLNDAVHPGH-----------------------------------
ATP6_XANP2       AVLTSIYLNDAIHPGH-----------------------------------
ATP6_BEII9       TILTCVYLNDAVHPGH-----------------------------------
ATP6_RHOP2       AILTCIYLNDAIHPGH-----------------------------------
ATP6_BRADU       AILTCIYLNDAIHPGH-----------------------------------
ATP6_RHOPB       AILTCIYLNDALHAGH-----------------------------------
ATP6_BRASO       TILTCIYLNDAIHPGH-----------------------------------
ATP6_NITWN       TILTCIYINDAIHPGH-----------------------------------
ATP6_METS4       ATLTSIYLSDALHPGH-----------------------------------
ATP62_OCHA4      TMLTCMYLNDALHPSH-----------------------------------
ATP6_HYPNA       AILTCVYLNDALHADAH----------------------------------
ATP6_MARMM       AMLTCIYLNDALHPGH-----------------------------------
ATP6_PELUB       AILTCIYLNDALNLHH-----------------------------------
ATP6_MAGSA       TILSCIYLHDAIHMH------------------------------------
ATP6_RHORT       TILTCIYLNDAINMH------------------------------------
ATP6_ERYLH       ALLTSLYINDAENLH------------------------------------
ATP6_NOVAD       ALLTCVYLNDAENLH------------------------------------
ATP6_SPHWW       ALLTSLYLNDAINLH------------------------------------
ATP6_SPHAL       ALLTSLYINDAVNLH------------------------------------
ATP6_ZYMMO       ALLTSLYLNDAINLH------------------------------------
ATP6_ACICJ       AILTCLYLHDAIHMH------------------------------------
ATP6_GRABC       AILTCIYLHDAVHLH------------------------------------
ATP6_GLUDA       AILTCIYLREAVAH-------------------------------------
ATP6_GLUOX       AILTCIYLREAVAH-------------------------------------
ATP6_DINSH       TILTCVYLKDALHPHH-----------------------------------
ATP6_ROSDO       TILTCVYLKDALHPHH-----------------------------------
ATP6_RHOS5       TILTCVYLRDAVGDAHH----------------------------------
ATP6_MAGMM       TILTCVYINDALHLH------------------------------------
ATP6_ANASK       TMLSSLFIGAGLVHHGDDHGHAEEHGHAGPGMGSEHGSH---VAGASPGHG
ATP6_ANADF       TMLSSLFIGSVVAHHGHEDEH-EEHGHGAAATGGAHGSHGSHVAGASPGHG
ATP6_MYXXD       AMLSALFIGMSVAMGHHHDDHGHDHPEAGPSHDQGKAHHA-----------
ATP62_CHLP8      TMLSALFIGLATAH-ESHDSHELEASGHH----------------------
ATP62_CHLTE      TMLSALFIGLATAHSDSHDGHELEATARHGDGLTV----------------
ATP6_CHLPD       TMLSALFIGLASAHEE-HADHEAGAAHH-----------------------
ATP6_PELPB       TMLSSLFIGLASAHEG-HEEHEAGVAHH-----------------------
ATP6_CHLCH       TMLSALFIGLASAHEGGHDEHEASAAHH-----------------------
ATP62_PELLD      TMLSALFIGLATAHEG----GEAEAAHH-----------------------
ATP62_PROA2      TMLSALFIGLATAHEG----HEGEAAH------------------------
ATP6_CHLPB       TMLSALFIGLGSAHEG----HEAEGAH------------------------
ATP6_CHLT3       TLLSALFIGMAVAHEDHGDEAHGHAPSH-----------------------
ATP6_ELUMP       TLLTAIFAGEAYAHH------------------------------------
ATP6_MYCGE       VMLTYNYWAKMRNQGLENNNASELHFKGIKVIQENI---------------
ATP6_MYCPN       VMLTYNYWAKMRNIGLEESQEAAQRLQNLEVAKEIIN--------------
ATP6_MYCGA       VSLMLTYWSQPIKAAENAAEEKGQQMIENQRLNVK----------------
ATP6_RUBXD       AILTQVYIELAMFAEEAH---------------------------------
ATP6_PARUW       TLLSTVYILLSMHKEGEKN--------------------------------
ATP6_FRACC       TILTAAYIGGAMVHGEHEVAPSEELASPAPAGVPVSARA------------
ATP6_PAEAT       TLLTAIYIEGALHADSH----------------------------------
ATP6_DESRM       SMLTIAYVSQFAAHEADHH--------------------------------
ATP6_CLOAB       KILLPVPLHGFFDMFDGVLQVYVFVLLTMIFTKLGIEH-------------
                   *