CLUSTAL format seed alignment for MF_01395

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACCD_AGRVS        ------------------------------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        ------------------------------------------------------------
ACCD_RHILO        ------------------------------------------------------------
ACCD_AZOC5        ------------------------------------------------------------
ACCD_RHOPB        ------------------------------------------------------------
ACCD_BEII9        ------------------------------------------------------------
ACCD_METC4        ------------------------------------------------------------
ACCD_CAUSK        ------------------------------------------------------------
ACCD_PHEZH        ------------------------------------------------------------
ACCD_HIRBI        ------------------------------------------------------------
ACCD_HYPNA        ------------------------------------------------------------
ACCD_MARMM        ------------------------------------------------------------
ACCD_ERYLH        ------------------------------------------------------------
ACCD_NOVAD        ------------------------------------------------------------
ACCD_DINSH        ------------------------------------------------------------
ACCD_GLUDA        ------------------------------------------------------------
ACCD_GLUOX        ------------------------------------------------------------
ACCD_GRABC        ------------------------------------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        ------------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ------------------------------------------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        ------------------------------------------------------------
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        ----------MQNWIDNSFQAEFEQESYFGSLGENSTNPSS-------GGDRYPEALIIR
ACCD_BRANA        MEKSWFNLMFSKGELEYRGELSKAMDS-FAPIEKTTISKDR----FIYDMDKNFYGWGER
ACCD_CUCSA        MEKRWLNSMLSKGELEYRCRLSKSINS-LGPIE----SEGS----IINNMNKNIPSHSDS
ACCD_CALFG        MGKWWFNSI---EGLEHRCGLSKSMDSLGYLIGNTSGSEDP----TLNDTNKNIPSWGHS
ACCD_RANMC        MEKWRFNSMLSKEELEHQCGLSKSLKCTGS-IGNTNGGEDL----AINNMIR-----GWV
ACCD_COFAR        MERWWFNSMLFKKEFECRCGLNKSTES-LGSIENASEGDEP----DIKDRTKNIQSWGGR
ACCD_LACSA        MKRWWFNSMLFKKEFEHRCRLSKSMGS-LGPIENASESKDP----NRNDTDKNIQGWGGH
ACCD_SPIOL        MKKWWFNSMLSKKELEHGCGLSKSMDS-LGPIENTSTKEDP----SLNDPEKQIHSSRNS
ACCD_GOSBA        MEKSWFNLILSKGELEYRCGLSKSMDSRLGPVENTTVNEDP----TRNDTDKNIHDCSDS
ACCD_FAGEA        MEKWWFNSMLSKEELGHRCGLSKSMDS-LDPIDNINSNENM----ILNFTEKSIHSWSNG
ACCD_PHAAO        MKKYWFNSMLSNKKLEQKCGLSKSMDG-LDALGHTSGSEET----IRKDADKKIPSWDSY
ACCD_SOYBN        MEKWWFNSMLFNRKLEYRCELSKSMDS-LGPIENTSLREDPK---ILTDIEKKIH-----
ACCD_LOTJA        MEKWWLNSMLRNRELAYKCGLSKSTDR-FGPIENTSVSEDPP---ILTDMDKNIHSWNDI
ACCD_CICAR        MEKWWFNSMLFNKKLEYRCGLSKSIDS-FGPIEKKS--EEPS---IVTDNDSYSH-----
ACCD_EPIVI        MERWRFSLMVFNNKLKHEYGIKKSLDS-VSSIENTIENKDSNSKPNIKGRAQNIRSCGGR
ACCD_CUSRE        ---------MERREGGRDNSSCSNVNQLFGVKDSESLLYDDVFIVRDRNGDSYFAYWDIE
ACCD_IPOPU        ---------MEKW---RIYSFQKEFERRCGLNSSLGPIETTGEDPNRKDTVKNIQSWEDC
ACCD_MARPO        ------------------------------------------------------------
ACCD_PINTH        ------------------------------------------------------------
ACCD_AMBTC        MEKCGFNSMLSNEELEHKCELSKSMDS-LGLIGNTGAGGGPTLIFDVRDILSLIYDDTFK
ACCD_PEA          ---------MINEDPSSLTDMDNNIDSWKNNSENSSYSHADSL-ADVSNIDNLLSDKIFS
ACCD_OENEH        -MKPTKPEGPKKPNKSNEEAEELEGDNKEDLEGPKKPNKSNEEAEELEGDNKEDLEGPKK
ACCD_ACAM1        ------------------------------------------------------------
ACCD_NOSS1        ------------------------------------------------------------
ACCD_SYNE7        ------------------------------------------------------------
ACCD_SYNY3        ------------------------------------------------------------
ACCD_SYNP2        ------------------------------------------------------------
ACCD_TRIEI        ------------------------------------------------------------
ACCD_PROM1        ------------------------------------------------------------
ACCD_SYNR3        ------------------------------------------------------------
ACCD_CHLVU        ------------------------------------------------------------
ACCD_PORPU        ------------------------------------------------------------
ACCD_GLOVI        ------------------------------------------------------------
ACCD_SYNJB        ------------------------------------------------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        ------------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        ------------------------------------------------------------
ACCD_PROMH        ------------------------------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        ------------------------------------------------------------
ACCD_IDILO        ------------------------------------------------------------
ACCD_PSEHT        ------------------------------------------------------------
ACCD2_VIBCB       ------------------------------------------------------------
ACCD_VIBVU        ------------------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        ------------------------------------------------------------
ACCD_HAHCH        ------------------------------------------------------------
ACCD_MARHV        ------------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        ------------------------------------------------------------
ACCD_METCA        ------------------------------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ------------------------------------------------------------
ACCD_HALHL        ------------------------------------------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        ------------------------------------------------------------
ACCD_PSYWF        ------------------------------------------------------------
ACCD_ACIB5        ------------------------------------------------------------
ACCD_PELUB        ------------------------------------------------------------
                                                                              

ACCD_AGRVS        ------------------------------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        ------------------------------------------------------------
ACCD_RHILO        ------------------------------------------------------------
ACCD_AZOC5        ------------------------------------------------------------
ACCD_RHOPB        ------------------------------------------------------------
ACCD_BEII9        ------------------------------------------------------------
ACCD_METC4        ------------------------------------------------------------
ACCD_CAUSK        ------------------------------------------------------------
ACCD_PHEZH        ------------------------------------------------------------
ACCD_HIRBI        ------------------------------------------------------------
ACCD_HYPNA        ------------------------------------------------------------
ACCD_MARMM        ------------------------------------------------------------
ACCD_ERYLH        ------------------------------------------------------------
ACCD_NOVAD        ------------------------------------------------------------
ACCD_DINSH        ------------------------------------------------------------
ACCD_GLUDA        ------------------------------------------------------------
ACCD_GLUOX        ------------------------------------------------------------
ACCD_GRABC        ------------------------------------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        ------------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ------------------------------------------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        ------------------------------------------------------------
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        DITGKTSAIY-------------------------------------------FDITDDI
ACCD_BRANA        -SSYYNNVDLLVNSKDIRNFISDDT------FFVRDSNKNSYSIY--------FDIEKKK
ACCD_CUCSA        YNSSYSTVDDLVG---IRNFVSDDT------FLVRDSNSSSYSIY--------LDIENQI
ACCD_CALFG        GSYSCNNVDHFFSVRDIWSFISDGT------FLVRDNNGNCYSVY--------LDIENQV
ACCD_RANMC        DSDNSSNIDHLVGVSNIRSLISDDT------FLVRDSNGKNYSIY--------FDIENQI
ACCD_COFAR        DDSSYSKVDHLFVVKDIRNFISDDT------FLVKDSNGDNFSIY--------FDIENQI
ACCD_LACSA        DN--YSNVDLFFGVKDIRNFFSDDT------FLVKDSNGDSYSIY--------FDIENHI
ACCD_SPIOL        ESSSYSNVNHLVRGIDIQNFISDDT------FLLIDTKGDSYSIY--------FDIENQI
ACCD_GOSBA        SS-YYSKVDHLVDVKDIRNFISDDT------FLIRDSNQDRYSIY--------FDSENQI
ACCD_FAGEA        SS--YSNLDLLFIIGDIPNLISDET------FLIRDRKGETYSVY--------FDIENKI
ACCD_PHAAO        SFSNIHYLNSLFDRRNLWSLISDHT------FLVRNSNGDTYSVY--------FDIENQI
ACCD_SOYBN        -----RDLDYL-------------------------------------------------
ACCD_LOTJA        ENCSYNNVDYLVGVENIRNFLSNKS------FLVRDSKRNSYSIY--------FAIENQI
ACCD_CICAR        -------VDYLVDVSNRQN-----------------------------------------
ACCD_EPIVI        DNYSYNNIIYLFGVEYNRNLIPNDT------FLFRDNKGDSFYIS--------FNIENHI
ACCD_CUSRE        KNTFLSEPFYSYRSRNSSYLPKIKA------FMSEDR-----SQI--------HEVKNGF
ACCD_IPOPU        DNSSCSNVDHLFGVKDN------EN------FISDDT-----FVV--------FDIENQI
ACCD_MARPO        ------------------------------------------------------------
ACCD_PINTH        ------------------------------------------------------------
ACCD_AMBTC        LKDRNGDSYSVYFDIDNKIFEIDDDSDSLSGLDIENQNQIFFDIYNDSDSLSELDSENKN
ACCD_PEA          IRDSNSNIYDIYYAYDTNDTNITKY-------KWTNNINRCIESY----------LRSQI
ACCD_OENEH        PNKSNEEAEELEGDKQKDKKDGIFV------LNYDDEYEEDLEYD---------DEYEED
ACCD_ACAM1        ------------------------------------------------------------
ACCD_NOSS1        ------------------------------------------------------------
ACCD_SYNE7        ------------------------------------------------------------
ACCD_SYNY3        ------------------------------------------------------------
ACCD_SYNP2        ------------------------------------------------------------
ACCD_TRIEI        ------------------------------------------------------------
ACCD_PROM1        ------------------------------------------------------------
ACCD_SYNR3        ------------------------------------------------------------
ACCD_CHLVU        ------------------------------------------------------------
ACCD_PORPU        ------------------------------------------------------------
ACCD_GLOVI        ------------------------------------------------------------
ACCD_SYNJB        ------------------------------------------------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        ------------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        ------------------------------------------------------------
ACCD_PROMH        ------------------------------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        ------------------------------------------------------------
ACCD_IDILO        ------------------------------------------------------------
ACCD_PSEHT        ------------------------------------------------------------
ACCD2_VIBCB       ------------------------------------------------------------
ACCD_VIBVU        ------------------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        ------------------------------------------------------------
ACCD_HAHCH        ------------------------------------------------------------
ACCD_MARHV        ------------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        ------------------------------------------------------------
ACCD_METCA        ------------------------------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ------------------------------------------------------------
ACCD_HALHL        ------------------------------------------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        ------------------------------------------------------------
ACCD_PSYWF        ------------------------------------------------------------
ACCD_ACIB5        ------------------------------------------------------------
ACCD_PELUB        ------------------------------------------------------------
                                                                              

ACCD_AGRVS        ------------------------------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        ------------------------------------------------------------
ACCD_RHILO        ------------------------------------------------------------
ACCD_AZOC5        ------------------------------------------------------------
ACCD_RHOPB        ------------------------------------------------------------
ACCD_BEII9        ------------------------------------------------------------
ACCD_METC4        ------------------------------------------------------------
ACCD_CAUSK        ------------------------------------------------------------
ACCD_PHEZH        ------------------------------------------------------------
ACCD_HIRBI        ------------------------------------------------------------
ACCD_HYPNA        ------------------------------------------------------------
ACCD_MARMM        ------------------------------------------------------------
ACCD_ERYLH        ------------------------------------------------------------
ACCD_NOVAD        ------------------------------------------------------------
ACCD_DINSH        ------------------------------------------------------------
ACCD_GLUDA        ------------------------------------------------------------
ACCD_GLUOX        ------------------------------------------------------------
ACCD_GRABC        ------------------------------------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        ------------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ------------------------------------------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        ------------------------------------------------------------
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        LENDP-------------------------------------------------------
ACCD_BRANA        FEINN--D---LSDLEIFFYSYCS------------------SSYLNNRSKGDNDLHYDP
ACCD_CUCSA        FEIDN--DPSFVSELESSFYSFRN------------------STYQNNISKND-DSHYDR
ACCD_CALFG        FEIDN--DSSFLSELESSFSSYMN------------------SSYLNSGSKSDNRYYDRY
ACCD_RANMC        FEIEIEGDRSFLSELESFFSSYLNL----------------NYSYPNDGSKSDNHYYDRS
ACCD_COFAR        FEIDN--NHSFRSELKNTYW---N------------------SSYLNNGSTSEDTYYNHY
ACCD_LACSA        FEIAN--DHPFCSELESSFYR--N------------------SSDLNNGSKSKNPDHDRY
ACCD_SPIOL        FEIDN--DHSFLSKLQSSFSNYWN------------------SSYLNSRSKNGDTYNGHS
ACCD_GOSBA        FELNN--DHSFLSELESFFYSYHN------------------SSYMNNGSKNDEPHYHFN
ACCD_FAGEA        VEIDN----------YHSFSNYWN-------------------SSYGTGSKSNDTHYDLY
ACCD_PHAAO        FDIDN----------ASSFLSELP-------------------SYLKSGSNNSNYYYSYY
ACCD_SOYBN        -------------EMEGFFSSDLN------------------TVSKN-----DDDHYM--
ACCD_LOTJA        LEIDN--DHLFLSELESFFSRYTN------------------SIYLNNSSKGDGDHYM--
ACCD_CICAR        -----------FLSDKTFLVRDRN------------------SYSYSIFFAIENKILEID
ACCD_EPIVI        FEIDINFSCLSELEIERYFYSYHGF----------------DYFNFNNGSAIEDYLYNHY
ACCD_CUSRE        R--SEDHSKINK-INGVENLFHNYN----------------MNVLTDDYNFKMGMNGFHR
ACCD_IPOPU        FEIDNDHSFLNEPFSSYSDRNSSYL----------------TNVFTSEDPYYNRYMYDAQ
ACCD_MARPO        ------------------------------------------------------MSLMNW
ACCD_PINTH        ------------------------------------------------------MSIKEW
ACCD_AMBTC        FEIHN--ESDFMSKLESSFFSYLTYSCLKRRSSFSSYPTSLTSSNLNSGSKSYNPYYDPY
ACCD_PEA          CEDIDFNSDICDKVQRTIIILIRST----------------NDTNDISDTNDISDTNDTN
ACCD_OENEH        LEYDDEYEEDLEYDDEEYDDEYEE------------------DLEGDNKPHKEDLEGDNK
ACCD_ACAM1        ------------------------------------------------------------
ACCD_NOSS1        ------------------------------------------------------------
ACCD_SYNE7        ------------------------------------------------------------
ACCD_SYNY3        ------------------------------------------------------------
ACCD_SYNP2        ------------------------------------------------------------
ACCD_TRIEI        ------------------------------------------------------------
ACCD_PROM1        ------------------------------------------------------------
ACCD_SYNR3        ------------------------------------------------------------
ACCD_CHLVU        ------------------------------------------------------------
ACCD_PORPU        ------------------------------------------------------------
ACCD_GLOVI        ------------------------------------------------------------
ACCD_SYNJB        ------------------------------------------------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        ------------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        ------------------------------------------------------------
ACCD_PROMH        ------------------------------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        ------------------------------------------------------------
ACCD_IDILO        ------------------------------------------------------------
ACCD_PSEHT        ------------------------------------------------------------
ACCD2_VIBCB       ------------------------------------------------------------
ACCD_VIBVU        ------------------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        ------------------------------------------------------------
ACCD_HAHCH        ------------------------------------------------------------
ACCD_MARHV        ------------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        ------------------------------------------------------------
ACCD_METCA        ------------------------------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ------------------------------------------------------------
ACCD_HALHL        ------------------------------------------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        ------------------------------------------------------------
ACCD_PSYWF        ------------------------------------------------------------
ACCD_ACIB5        ------------------------------------------------------------
ACCD_PELUB        ------------------------------------------------------------
                                                                              

ACCD_AGRVS        ------------------------------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        ------------------------------------------------------------
ACCD_RHILO        ------------------------------------------------------------
ACCD_AZOC5        ------------------------------------------------------------
ACCD_RHOPB        ------------------------------------------------------------
ACCD_BEII9        ------------------------------------------------------------
ACCD_METC4        ------------------------------------------------------------
ACCD_CAUSK        ------------------------------------------------------------
ACCD_PHEZH        ------------------------------------------------------------
ACCD_HIRBI        ------------------------------------------------------------
ACCD_HYPNA        ------------------------------------------------------------
ACCD_MARMM        ------------------------------------------------------------
ACCD_ERYLH        ------------------------------------------------------------
ACCD_NOVAD        ------------------------------------------------------------
ACCD_DINSH        ------------------------------------------------------------
ACCD_GLUDA        ------------------------------------------------------------
ACCD_GLUOX        ------------------------------------------------------------
ACCD_GRABC        ------------------------------------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        ------------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ---MEMDTAVENPAVEKNGQPTPSSTSTATD-----------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        -----MTILAWIKDKKNKAILNTPEYSSQSS-----------------------------
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        ----------------HQTILLSPIENDIWTEKDVIIDTYRYIN------ELIFCDEKSQ
ACCD_BRANA        YIKD--TKYNCNN--HINSCIDSYFRSHICINSHFLSDSNNSNE---SYIYNFICSESGS
ACCD_CUCSA        YMYD--TKYSWNN--HINSCIDSYLRTQICIDSYILSGSHNYSD---SYIYSYICGEGGN
ACCD_CALFG        -TYD--IKYSWNN--HINSCIDSYLRSEINIDSYISSGSDNYRD---SYIYSYICSGESV
ACCD_RANMC        -MYD--TQYSWNN--YITSCIENYLRSEIHIDSYISSSSDNYSK---SYISNYVCSGGGL
ACCD_COFAR        -MYD--TQYSWNN--HINSCIDSYLQSQIWIETSIVSGGDNYSD---SYIYSSICGESRN
ACCD_LACSA        -MDD--TQYTWNN--HINSCIDSYLQYQICIDNYIVSGNDNSSNNNSSNENSSNENSSNE
ACCD_SPIOL        -LYY--TNDSWNN--HINNCIDSYLHSQIRSDSSILSGND-------SYILSYIFNESGN
ACCD_GOSBA        -LYDNDTNCGWNN--HINSCIDSYLRSQICIDSSILSGSDNSND---NYISNYICGEGGN
ACCD_FAGEA        -MYD--TKSSLNN--HINGCIDSYLHSQMRLDNYVLRDSDHYGD---NYIFDDIKTTTKT
ACCD_PHAAO        SMYD--TQSNWNN--HINSCIDSYLRFEISLNSDIYSDIDSYIS---SFICTESTSSIEN
ACCD_SOYBN        ----YETQFSFNN--NITSFIDS------CIESFNLGDIDKYND---IYFYSYIFLKGRN
ACCD_LOTJA        ----YDTESSWNN--NINSFIENYIRSQICIDNYILGDGDKYND---SYFYSYICSTIRK
ACCD_CICAR        ----YDSQFNWKN--IINSCIENYLRSQICIDSDILDNSFKYNDND-SDVYSYICGKVTN
ACCD_EPIVI        -----MYDTPSNN--HITSCIESYLQSQICVNPSIISDSSD------SYIFGCFDKRRTH
ACCD_CUSRE        --------PQSKI--HINRFIDSYLQSQICIATTPGSGSDNDSY-IHGSRVYGESESYTR
ACCD_IPOPU        --------YSWNN--HINGCIDSYLQSQICIDTTTVSGSDNDSYDIHGSVCDGE--SHNS
ACCD_MARPO        --------FEDKR--RFGGLIGAFIE--------------------------------KA
ACCD_PINTH        --------FEDKR--KITALLKNSVE--------------------------------RD
ACCD_AMBTC        ---MHDTRYSWNNDININSCIDSYIRCEI---DSISSGSDNCSD---SYIYSYICSEGVS
ACCD_PEA          DTNAIYDPFDISDTNDTNEIYDPFFILDINDTNDTNDIYGIYDP---DDIYETNIKDICE
ACCD_OENEH        ---PHKEDLEGDNKPHKEDLEGDKQKEEEEKQKEEEEKLKDCPWHWFHQIYPKHWGCPHR
ACCD_ACAM1        -----------------MSLFDWFANRRK-------------------------------
ACCD_NOSS1        -------MANNEESRGLKSLFDWFANRRK-------------------------------
ACCD_SYNE7        -----------------MSLLDWFANRRK-------------------------------
ACCD_SYNY3        -----------------MSLFDWFANREK-------------------------------
ACCD_SYNP2        -----------------MSLFDWFAANRQ-------------------------------
ACCD_TRIEI        -----------------MSLFDWFANRRK-------------------------------
ACCD_PROM1        -----------------MSLFDWFADRRK-------------------------------
ACCD_SYNR3        -----------------MSLLDWFADRRK-------------------------------
ACCD_CHLVU        -----------------MSILSWIENQRK-------------------------------
ACCD_PORPU        -----------------MSLSNWPLKKEQ-------------------------------
ACCD_GLOVI        -----------------MDLIEWFKDRRK-------------------------------
ACCD_SYNJB        -----------------MSLLDWFAERRRQTSLNLTG-----------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        ------------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        ------------------------------------------------------------
ACCD_PROMH        ------------------------------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        ------------------------------------------------------------
ACCD_IDILO        ------------------------------------------------------------
ACCD_PSEHT        ------------------------------------------------------------
ACCD2_VIBCB       ------------------------------------------------------------
ACCD_VIBVU        ------------------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        ------------------------------------------------------------
ACCD_HAHCH        ------------------------------------------------------------
ACCD_MARHV        ------------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        ------------------------------------------------------------
ACCD_METCA        ------------------------------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ------------------------------------------------------------
ACCD_HALHL        ------------------------------------------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        -----------------------------------------------MANNMTDTMTKFD
ACCD_PSYWF        --------------------------------------------MTKNNNDLSNSSSNPP
ACCD_ACIB5        -----------------------------------------------MNQEVKS------
ACCD_PELUB        ------------------------------------------------------------
                                                                              

ACCD_AGRVS        -------------------------MNWITNYVRPRINSMLGRR----------------
ACCD_LIBAP        -------------------------MNWITNFVRPRINSVFGRR----------------
ACCD_BARBK        -------------------------MNWITNYVRPKINSILGRR----------------
ACCD_RHILO        -------------------------MNWITNYVRPKINSMLGRRT---------------
ACCD_AZOC5        -------------------------MNWISNVVRPKIRSFLNRR----------------
ACCD_RHOPB        -------------------------MNWLTNVVRPKIRNIL-RR----------------
ACCD_BEII9        -------------------------MNWISNVVPPKIRSFL-RR----------------
ACCD_METC4        ---------------------MVEPMNWISEVVRPRIKTLF-KR----------------
ACCD_CAUSK        ---MAMAETPVPKKGDKTKVAAERRGGWLSRI-APGVRGAFAKR----------------
ACCD_PHEZH        ---MAMADQRNDKPG-RPAAQRERRG-WLSRI-APGVRN-FAKR----------------
ACCD_HIRBI        -------------------------MSWLTNL-PPGLKNVFGKK----------------
ACCD_HYPNA        -------------------------MNWINKVTPPGLKTMMSKK----------------
ACCD_MARMM        ------------------MTEKSNGMSWLSKITPPGMSKIFSKR----------------
ACCD_ERYLH        -------------------------MNWFTRV--RNSLGFGPKR----------------
ACCD_NOVAD        -------------------------MSWLNKV--RNALPFTPKR----------------
ACCD_DINSH        -------------------------MNWISNYVRPTINSLFSRR----------------
ACCD_GLUDA        -------------------------MSWLTEYVRPKIRGLL-KR----------------
ACCD_GLUOX        -------------------------MSWMTDYVRPKLRGLL-QR----------------
ACCD_GRABC        -------------------------MSWLTEYVRPKIRTLLGRR----------------
ACCD_METI4        ----------------------------MMSKDKPQIPSGE-------------------
ACCD_OPITP        ----------------------------MTHFDKPTYTVRK-------------------
ACCD2_ROSCS       ------------------------MKELIQRSRKSFTVVH--------------------
ACCD1_ROSS1       ------------------------MKDLFRRAPKRFTAAR--------------------
ACCD_CHLAD        ------------------------MKEFFRLSRKGFTGRDD-------------------
ACCD_HERA2        ------------------------MKDFFRRAPLPFTSSR--------------------
B9L1K0_THERP      ------------------------MRPFLRR-RNAQNQSSA-------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ----------------------MALERLFRRKRPSGGNRD--------------------
ACCD_WOLSU        ----------------------MGFADFFKTFTRERAKEG--------------------
ACCD_RHOBA        ------------------AAPTPNAPNRPAPNTAGNRKRGV-------------------
ACCD_SORC5        ----------------------MTWPEKTLPTTDASEKRSL-------------------
ACCD_HELSJ        ------------------LSWCFTHKEAASNKAVSFINLSK-------------------
ACCD_CYACA        ------------------------------------MPNGT-------------------
ACCD_CUSGR        QK-------------------QKDRTEFIKKEQLQLISNRN-------------------
ACCD_BRANA        GKI--------------RESKNDKIRTNSNRNNLMSSK----------------------
ACCD_CUCSA        S----------------SESESFSIRTSTHGNNLTITESSNDL-----------------
ACCD_CALFG        SNS---------------KSGSSSIRTGGNSSDFNRRGRSN-------------------
ACCD_RANMC        NST---------------DSESFSIQTSANGSTFDMIGKFK-------------------
ACCD_COFAR        NS----------------EGEVSDIQTHVKGSDFTIIESSN-------------------
ACCD_LACSA        NSSNENSSNDYISSSISSQSENSSQNEDITTSDQTIPESST-------------------
ACCD_SPIOL        RS------------------ESFSKRSITNGSNLTRRESSH-------------------
ACCD_GOSBA        SS----------------EGKNFDIITRENGNDLTLKESSN-------------------
ACCD_FAGEA        NG------------------------------------RDK-------------------
ACCD_PHAAO        CTES------------TSSIENGNSSIKTSSSYFNRIEKSN-------------------
ACCD_SOYBN        CSE-----------SDNSSTSIITSTNDTNDSDSTIGESSN-------------------
ACCD_LOTJA        KS------------SERERTSIITSTNNLNDSDFTKIEGSN-------------------
ACCD_CICAR        SS-------------QSTSTDVITITNDSEKESFNDDD----------------------
ACCD_EPIVI        NE-----------------SRRSGIRNRAQSSYLTIRESFN-------------------
ACCD_CUSRE        SEG-----------------RSSSIRTRTKGVELTLRERPG-------------------
ACCD_IPOPU        SEG-----------------ESSSRRTHTKGVDLTIRESSNENERESSNENERKSSN---
ACCD_MARPO        TKG-----------------YIFSEREKDRYIKIDTT-----------------------
ACCD_PINTH        SKD-----------------ANETEKNKNKSIDYAKI-----------------------
ACCD_AMBTC        YSDN-------------GSSSIRTRTSTSSGSSYHIRGRSN-------------------
ACCD_PEA          RYS------------------EIYPRNREKSTFVPIDYSDP-------------------
ACCD_OENEH        KHR---------------DRKSVPAKERELVPAQSTKRDTDPDS----------------
ACCD_ACAM1        -----------------------SHPVTKAQP---EREISD-------------------
ACCD_NOSS1        -----------------------AGATNPERQ---EREIAD-------------------
ACCD_SYNE7        -----------------------TEPVVHDYQ---EREIAD-------------------
ACCD_SYNY3        -----------------------AEPPVLQPQSPQEREVAD-------------------
ACCD_SYNP2        -----------------------NSETQLQPQ--QEREIAD-------------------
ACCD_TRIEI        -----------------------SSQDPQQRP---EREIAD-------------------
ACCD_PROM1        -----------------------GQFVGKVTQ---ESEESD-------------------
ACCD_SYNR3        -----------------------TAPALRPTP---EPDEGD-------------------
ACCD_CHLVU        -----------------------LKLLNAPKYNHPESDVSQ-------------------
ACCD_PORPU        -----------------------SKAHNIKSTKQ--ITIPD-------------------
ACCD_GLOVI        -----------------------NGRLSKEER---QREIAD-------------------
ACCD_SYNJB        -----------------------SSPFDKERQ---VREIAD-------------------
ACCD_STAAC        -----------------------MFKDFFNR-TKKKKYLTVQDSKNN-------------
ACCD_STACT        -----------------------MFKDFFNRGSKKKKYVTVQDSKQN-------------
ACCD_MACCJ        -----------------------MFKDIFKK-NKKKKYVTVKNMTDT-------------
ACCD_BACLD        -----------------------MLKDIFSK-KKKKYASVPAESAKQ-------------
ACCD_GEOKA        -----------------------MWKDLFVK-KKK-YAPLPSEQARH-------------
ACCD_BACHD        -----------------------MLKDFFSK-KKR-YATIPSERAKH-------------
ACCD_OCEIH        -----------------------MLKDLFGK-RKK-YASIPSEKAKM-------------
ACCD_LISIN        -----------------------MLGDLFTKPKKRKYATIPSDGTKA-------------
ACCD2_LYSSC       ----------------------MAIRSLFSGNRKK-----KEDGQEK-------------
ACCD_EXIS2        ------------------------MQAFFRK--PKKFVTLTSKEQRV-------------
ACCD_EXISA        ------------------------MTAFFKK--PKRYMPLRQREPKI-------------
ACCD_BREBN        -----------------------MLKDLFGK--KRKFATVPSETLARVPASTDI------
ACCD_PAESJ        ----------------------MQIKDLFSK--K-KYATIPSERPKR-------------
ACCD_DESRM        -----------------------MVLEIFRK--PK-YVTVRPEKTET-------------
ACCD_PELTS        -----------------------MILDLFRK--QK-YITVQPE-----------------
ACCD_DESAP        ---------------------------MFKK--SK-YFTVRPE-----------------
ACCD_CARHZ        ------------------------MFDFFRK--SK-YVTVKPE-----------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        -----------------------MLKDIFRK--KRKYATLSSLPPKNSEGGLAYFDEPSP
ACCD_HALOH        -----------------------MLKDLFGK--SR-YVTVKRE-----------------
ACCD_ALKOO        -----------------------MLKDIFGKK--KYATITLYKDNAGPAV----------
ACCD_PEPD6        -----------------------MIKKFLSSKESKYVTISLDDNFKKNSV----------
ACCD1_EUBE2       ----------------------MNINDIFLKRKKRWGIINRLRDSEE-------------
ACCD_FUSNN        -----------MSILKNLAKNLGLTNITQPKK--KYATVGEKKSDEEKERAKYKV-----
ACCD_SYNWW        -----------------------MIKNTFSRK--KYFALSRRMEKEEEEK----------
ACCD_CLOB6        -----------------------MLKNLFRKTKYITVSQKNIENYKRENT----------
ACCD_CLOK5        -----------------------MLNKFFKKTKYITVSQRALGDIHDDFTKK--------
ACCD_CLOAB        -------------------------MGLFKKRKYITVSSKNLDENNDVENQ---------
ACCD_CLONN        ---------------------MFKINPIFKKTKYITINTS-KDNNINKENI---------
ACCD_CLOPE        -----------------------MIKNLLNKRKYITVSSVELNDTELSEDEK--------
ACCD_CLOBA        -----------------------MLKDLFKKSKYATVNPSAYKSKVVE--EK--------
ACCD_CLOCE        ---------------------------MLKKISFKKLELKPELENKNESTII--------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        -------------------------MALFQKK-KYIKINPNRSIIEKQAEQ---------
ACCD_STRDG        -------------------------MALFRKKDKYIRITPNNSLKGSVSQVI--------
ACCD_ENTFA        -------------------------MALFKKK-NYIRINPNRAHANDASKK---------
ACCD_LACBA        --------------------------MLPAKF----KTPSQ----KSLNRRM--------
ACCD_LACH4        --------------------------MLQSRF----KMPSH----DELVKRM--------
ACCD_PEDPA        ---------------------------MQNKF----SLPTQ----DEIVKRL--------
ACCD2_LACPL       -------------------------MMPKRKF----QAPTE----RQLAVRR--------
ACCD_LACP3        --------------------------------------MSQPQLTQEALARE--------
ACCD_OENOB        -------------------------MTWFNRL----KDYSKQQTDKLLNRYL--------
ACCD_LEUMM        -------------------------MDLYN------NKNSDTSKIKRDASVN--------
ACCD_LACF3        -------------------------MKLYKAK----NTLSE-RHVQADRTAD--------
ACCD_LACRJ        ------------------MEEGADSVKLYDQN----NTLSE-RHIKADKNAD--------
ACCD_LACS1        -------------------------MQLFDEL----KTISK-KHIKANKKAG--------
ACCD_LACSS        -------------------------MQLFNAV----RNIGK-AHLKYNQEAR--------
ACCD_LACDA        -------------------------MRLFKKR----NTISE-RHVKANKRAE--------
ACCD_ACHLI        ------------------------MNHLLDERKRRLSQFHEIIKKRPIETRP--------
ACCD1_LACPL       ------------------------MSHYP-------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        -------------------------MGLFSRDKPKIKIQTTKKD----------------
ACCD_GEOBB        -------------------------MAWFKRDNPPQAKGPAHRV----------------
ACCD_PELPD        -------------------------MSWFHRERAGINRTQIKKS----------------
ACCD_PELCD        -------------------------MAWFKKSKAPIVPVESKKV----------------
ACCD_UNCTG        -------------------------------MKMTIDNISEKK-----------------
ACCD_AMOA5        -------------------------MAWFRRKQKGILTPTE-------------------
ACCD_GRAFK        -------------------------MAWFKRTQKGIQTPTE-------------------
ACCD_FLAB3        -----------------------MAFDWFKRKTKNITTSTE-------------------
ACCD_PEDHD        -------------------------MAWFKREKKGISTSTE-------------------
ACCD_CHLL7        -------------------------MVWFKRVKPFIRTTD--------------------
ACCD_PROA2        -------------------------MVWFKRAKPSIFTKD--------------------
ACCD_SALRD        ------------------------MPPWFRREKAGIRTTRE-------------------
ACCD_HYDS0        ----------------------MGILDFFRKKEKK-------------------------
ACCD_SULSY        ----------------------MGLKDFVDKLKNIKKSRIK-------------------
ACCD_ECOLI        -------------------------MSWI-ERI--KSNITPT------------------
ACCD_PROMH        -------------------------MSWI-EKILNKSNITSS------------------
ACCD_BLOFL        -------------------------MNWI-ERIINKNIVLTT------------------
ACCD_BLOPB        -------------------------MSWI-ERIFNKSTIIPT------------------
ACCD_WIGBR        -------------------------MSWI-ERILKKNTIT--------------------
ACCD_PASMU        -------------------------MSWI-DRIFNKDTSSTSS-----------------
ACCD_IDILO        -------------------------MSWI-ERILAKPKINK-------------------
ACCD_PSEHT        -------------------------MSWL-EKILPKTTKASG------------------
ACCD2_VIBCB       -------------------------MSWL-EKLLDKNNIINT------------------
ACCD_VIBVU        -------------------------MSWL-EKILEKSNIVSS------------------
ACCD_ALCBS        ----------------------MSNSNWL-EKILPAVRRPQES-----------------
ACCD_CHRSD        -------------------------MSWL-DKIVPSMSRTQRAD----------------
ACCD_HAHCH        ------------------------MSNWL-EKIIPGMGGAQSK-----------------
ACCD_MARHV        ------------------------MSNWL-DKIMPSKIRSESR-----------------
ACCD_CELJU        -------------------------MSWL-EKIIPSISRTETK-----------------
ACCD_PSEF5        ------------------------MSNWLVDKLIPSIMRSEVK-----------------
ACCD_METCA        -----------------------MTLSWF-HKLVPSKIRTEAS-----------------
ACCD_HYDCU        -------------------------MSWF-EKILPS-IKQVTE-----------------
ACCD_ALKEH        -------------------------MSWFQKLMPSRIRTDASER----------------
ACCD_HALHL        -------------------------MSWFQKLMPRRIRTDAGPR----------------
ACCD_BURCA        -------------------------MSWLDKLLPPKIKQTD-PK----------------
ACCD_DECAR        -------------------------MSWLTKLLPPKIKREQGPQ----------------
ACCD_METFK        -------------------------MSWLQKLLPPKINRPA-GN----------------
ACCD_XANAC        -------------------------MSWLSKLMPSGIRTENTPA----------------
ACCD_COXBU        -------------------------MNWF-TKLLPKISTAN-------------------
ACCD_PSYA2        TN----NDSASLQ----QNGNKAGQS--WFERPIPGIKQQ-LIA----------------
ACCD_PSYWF        SNRPVAGKEAELEIQRETHAAQSGQSESWLSRPIPTVKRN-SLP----------------
ACCD_ACIB5        -------------------GKVLSPSTPWTQRPVPGIEVADEQQ----------------
ACCD_PELUB        -------------------------MNWIKKTLRFGEKIKTIIK----------------
                                                                              

ACCD_AGRVS        ---------DVPDNLWIKCP--ETGEMVFHKDLEENKWVVPASGYHMKMPAKARLADLFD
ACCD_LIBAP        ---------AIPENLWVKCP--ETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFD
ACCD_BARBK        ---------EIPENLWIKDP--TSGEMVFHKDLEANQYVIPASGHHMHISAKNRLMHFFD
ACCD_RHILO        ---------DMPENLWIKDP--ETGEMVFHKDLESNQFVIPSSGHHMKISAKERLKYFLD
ACCD_AZOC5        ---------DVPENLWVKCP--ETGQMVFHKDLEANQYVIPGSGFHMRMGPADRLKATFD
ACCD_RHOPB        ---------ETPENLWIKCP--DSGHLVFYKDVEANQFVIPGSNYHMRMGAAARLKSIFD
ACCD_BEII9        ---------DTPENLWIKCP--ESGELVFHKDLEANLFVIPGSGYHMYIAPKPRLDALFD
ACCD_METC4        ---------ETPENLWVKCP--DTGQMVFHKEVEQNHWVIPGSEHHLKMSATARLKMMFD
ACCD_CAUSK        ---------ETPENLWVKCP--DTGEMIYRSDLEAALWVTP-AGRHMRIGPELRFKFTFD
ACCD_PHEZH        ---------ETPENLWVKCP--ETGEMIYRPDLEAALWVTP-SGHHMRIGASQRLAVTFD
ACCD_HIRBI        ---------DTPENLWIKCP--KSGDLVYKDDLEASLFVTP-AGAHLRVGPDLRFKSMFD
ACCD_HYPNA        ---------DTPDDLWVKCP--ASGELIYRNDLEQSWYVTP-AGAHLRISPRMRFRILFD
ACCD_MARMM        ---------DTPDNLWVKCP--VSEEMVFHKDLEAGLFVTP-AGHHMRIAPAYRFQFTFD
ACCD_ERYLH        ---------TTDKDLWVKCP--SCAEMLFAQEYEENAQVCPRCDHHGRISADERLRQLLD
ACCD_NOVAD        ---------DTPDNLWIKCP--SCSEMLFTKEYEDNLSVCPHCDHHGRIGANARLEQLLD
ACCD_DINSH        ---------EVPENLWRKCP--ECGTMLFHRELSDNLFVCISCDHHMAITPRQRFEALFD
ACCD_GLUDA        ---------EVPDNLWTNCE--SCSQMILVKDLQKAMNVCPHCGHHMRASVAERFGWTFD
ACCD_GLUOX        ---------DVPDNLWTNCE--SCGQMMLTKELERSEKVCPHCGHHMRATAKERLGWTFD
ACCD_GRABC        ---------DVPDNLWVQCP--ACQQMIFARDLEKNQRVCTHCDHHMRGTALERLKWTLD
ACCD_METI4        -----K-MLDIPEGLWTKCP--GCNRFLYTKELELNQSVCHYCQHHFPLKAPERIACITD
ACCD_OPITP        -----TRKKEIPQGVYTKDP--VSGEAVFTKDIADNQMVVPASGHHFPIGARERLGYLLD
ACCD2_ROSCS       -----PIESDVPDNVWVKCP--SCRELIYHKQLAERMKVC-RCGYHMRLTAREWLALLDE
ACCD1_ROSS1       -----IENQAIPDNMWVKCP--SCGDLIYTRQFSDNLKVC-KCGYHMRLTAREWLGLLDD
ACCD_CHLAD        -----VDSAQIPDDLWVKCS--ACRELIYKKQLNDNLKVCPKCGHHMRMSAHEWIGLLDV
ACCD_HERA2        ------REQQIPDNVWAKCA--NCGELTYQKQFNDALKVCPKCSYHSRISSREWIEVLAD
B9L1K0_THERP      -----HESPSVPDGLWLKCS--RCRDLLYAREFERNQRVCPRCGFHARLSARERITVTVD
ACCD_RUBXD        ----------MDATVFTKCE--RCKQPVYEKDLRARFNVCPNCEFHYPLPAPERVRLLTD
ACCD_THET2        -----------VPELWTKCE--ACGAQIYKKEFQENLHVCPKCGHHHRLPAQERVAMLAD
ACCD_WOLSU        ----------ESPSHWIKCP--SCSALMYYKEVIAQHHVCPKCNFHMRIALEDRIEMLCD
ACCD_RHOBA        -----------PEGVWRKCD--SCGASLFYKEVQQRLNVCPQCDHHFYVSAWERVAQVLD
ACCD_SORC5        -----------GAGVFRRCD--GCSHTHDAAELARTFEVCSQCGHHHKLDADGWRRLLLD
ACCD_HELSJ        -----------RRALWTRCE--KCGMIQFMRFFKENANLCLSCSYHHIMTSDERIALLVE
ACCD_CYACA        --------KLAKSFLWKKCD--SCNILISKFDFYKHDKVCPECNYHFPMYSSERINHIID
ACCD_CUSGR        --------PDHYRNLWNQCE--NCFIPNYKKVLKSNMQICEECGSYFKMTSSDRIDLLID
ACCD_BRANA        ----DFDITKNYNQLWIQCD--NCYGLKYK---KVEMNVCEECGHYLKMTSSERIELLID
ACCD_CUCSA        ----DNDRTTNYSDFWVICE--NCHKFNYKRLFKSKMNICEECGYHLKMNSSDRIELLID
ACCD_CALFG        ----DFDLNKKYRHLWVQCE--NCYGLNYKKFVSFKMHICEQCGYHLKMSSSERIELSID
ACCD_RANMC        ----NFDISPKYSHLWVQCE--NCYGLNYKKFFRLKLHICEQCGYHLKMSSSERIEILID
ACCD_COFAR        ----DLDVTQKYRHLWVQCE--NCYGLNYKKFLKSKMNICEQCGYHLKMNSSERIELSID
ACCD_LACSA        ----HMGVTQQYRHLWVQCE--NCYGLNYKKFFKSKMHLCEQCGYHLKMSSSDRIELLID
ACCD_SPIOL        ----NLDVTQKYRHLWVQCE--SCYALNYKKLLKSKMGICEQCGYHLKISSSDRIELLID
ACCD_GOSBA        ----DLDL---YKDLWVQCECENCYGVNYKKSLNSKMNICEQCGYHLKMRSSDRIELSID
ACCD_FAGEA        ----NLEVTKKYRNLWIQCE--NCYELNYKKLLKSKMRICDECGYHLKMSSSERIELSID
ACCD_PHAAO        ----DFDLNTKYKQLWVQCE--NCYGLNYKKFFSSKMNICEYCGYHLKMSSSDRIELFID
ACCD_SOYBN        ----NLDESQKYKHLWLECE--NCYGLNYKKFFKSKMNICEYCGYHLKMGSSDRIELLID
ACCD_LOTJA        ----DLDETQKYKHLWIECE--NCYGLNYKKILKSKMNICEHCGYHLKMSSSDRIELSID
ACCD_CICAR        ------DFTQKYKHLWVQCE--SCYGLNYKKFFKSKMNICEHCGDHLKMSSSDRIELLID
ACCD_EPIVI        ----NLDSTKKYKHLWVQCE--NCYGLNYKKFLKSKINLCEQCGYHFKMSSSERIEVLVD
ACCD_CUSRE        ----ILDRTKKYMYLWLQCD--NCYGLNYKKVLKSKMTICEQCGYHLQMSSSDRIELLID
ACCD_IPOPU        ----DLDRTKKYRDLWLQCE--NCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLID
ACCD_MARPO        ------------KGLWTRCD--NCENMLYVRFLRQNKRICEECGYHLQMSSTERIELLID
ACCD_PINTH        ------------KKLWAQCD--NCENLLYLRFLRENQSVCKECGYYLQMNSSDRIELLID
ACCD_AMBTC        ----NFEKNKKLKKLWVQCE--NCYALNYNKLFRSKMNVCEQCGYHLKMSSSDRIELSID
ACCD_PEA          ------NCMEKLARLWVQCE--TCYGLNFKQFFRPKMNICEHCGEHLKMSSSDRIDLLID
ACCD_OENEH        ----EASLKSNYAHLWVHCK--LCSGFNYKKILKSKNNVCEQCGSHLKMHSSDRIDLMLD
ACCD_ACAM1        -------------GLWSKCE--SCGALTYTKDLRANQMVCLECGHHLRVTSDERIAQLID
ACCD_NOSS1        -------------GLWHKCS--KCGVLTYTKDLRANQMVCVECGHHNRVDSDERIRQLID
ACCD_SYNE7        -------------GLWTKCE--SCDALTYTKDLQANLMVCLQCGHHLRIYSDERIRQLID
ACCD_SYNY3        -------------GLWTKCP--ACGVLTYTKDLQGNWMVCVECGHHLRVDSDERIRQLID
ACCD_SYNP2        -------------GLWTKCK--SCDALTYTKDLRNNQMVCKECGFHNRVGSRERVRQLID
ACCD_TRIEI        -------------GLWIKCE--ACGTLTYTKDLQANQMVCPECTHHIRVSSEQRIQQLID
ACCD_PROM1        -------------GLWEKCP--ECGQVVYRKDLIDNCSVCSNCGHHNRIDSKERIRIISD
ACCD_SYNR3        -------------GLWSKCP--ECGEVVYRKDLIANASVCASCGYHHRIHSEERLRILLD
ACCD_CHLVU        -------------GLWTRCD--HCGVILYIKHLKENQRVCFGCGYHLQMSSTERIESLVD
ACCD_PORPU        -------------GLWVKCF--DCGLLMYSKVLKRNLKVCPQCSYHFQASSNERIDQLID
ACCD_GLOVI        -------------GLWTKCV--SCAALHYTKDFQLNLCVCPACGHHERVGAPERIPQLVD
ACCD_SYNJB        -------------GLWQKCP--ACDTLTYTKDLQQNWQVCPSCGHHHRITAPERLEQLLD
ACCD_STAAC        ---------DVPAGIMTKCP--KCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISD
ACCD_STACT        ---------DVPTGIMTKCP--KCKKIMYTKELSENLNVCFNCDHHLSLTAYKRIEAISD
ACCD_MACCJ        ---------EVPEGIMAKCP--KCQKIMYTKELQENLNVCFNCDHHMAMNAYDRIDALMD
ACCD_BACLD        ---------DVPEGIMTKCP--DCKKIMLTKELDKNLRVCMNCGYHLQMNAKQRIKSLLD
ACCD_GEOKA        ---------EVPEGVMTKCP--QCKKIMYTKELIKNLRVCLSCGYHHPMPARERIASLLD
ACCD_BACHD        ---------DIPEGIMTKCP--SCRTIMYTKELKKNLYVCDSCGFHHRMNAFDRIESLLD
ACCD_OCEIH        ---------DVPEGLMQKCS--NCKKIYYRKEMVKALQVCPNCDYHHPMTAWDRIDSLFD
ACCD_LISIN        ---------DVPEGIMTKCP--ECKKIMYTKELQKNLMVCNYCGFHHPIGATARIDMLVD
ACCD2_LYSSC       ---------AFPEGLMTKCP--ECRHIQLTKELEKNHKVCTKCSHHFKMTAQERVDYFLD
ACCD_EXIS2        ---------DVPVGLMTKCP--KCKLIQYTKQLEANLKVC-VCGYHHPLTATERFEQLFD
ACCD_EXISA        ---------DAPQGLMTKCP--SCKYMHYTKQLNENHKVC-DCGYHFPLHAQERIDMLVD
ACCD_BREBN        SKEAGTKEKEVPEGLMNKCP--HCGTIHYSKDLEKNLRVCKGCQFHYSMSAPERLQALLD
ACCD_PAESJ        ---------DIPEGLMNKCS--KCGTIQYSKELDKNLKVCSSCGHHYRLSAWERIGMTLD
ACCD_DESRM        TQGNERRDIP--EGLWVKCS--RCNEILYTKELDKNFKVCHKCNFHFRLNAQERIHMTLD
ACCD_PELTS        ---SETREIP--EGVWVKCE--RCGEILFKKELDKNYKVCLKCGFHFRLSAFERIAMTVD
ACCD_DESAP        ----TKREIP--EGLWIKC---QCGAILFAKDLERNLKVCQKCAHHFRLTARERIRITLD
ACCD_CARHZ        ---TKQKEIP--DGLWQKCP--RCGEIIFNKELEKNFKVCPKCGYHFKISAWERIKLLCD
ACCD_HELMI        ---------M--DGLWVKCK--QCQQILLTKELEKNLKVC-RCGYHFRMTAQERIVMLVD
ACCD_DESHD        EQESTRKELP--DGLWVKCP--KCGEALFNKDLVENQRVCLTCSYHFRIPARERLEHLVD
ACCD_HALOH        EHTSSKKKAPGDDRLWTKCK--KCKEIIFNKKLVENLMVCPKCGYHFRLTARDRLAITID
ACCD_ALKOO        -----------PSNTHSS---------------KSNGNPVSEMKENKRMGARSRIAALID
ACCD_PEPD6        -----------DDKFWTYCK--GCDSHVFRKDIEENSFVCPKCSRHYGLRARKRINLLID
ACCD1_EUBE2       -------------------------------------------QADGSLTPSRRIALISD
ACCD_FUSNN        -----KNIDNLKEDEVTKCP--SCGVLSHKSEIRANMKMCSNCNHYFNMSARERIELLID
ACCD_SYNWW        -----------KVALPINCP--SCSARIAAEALQRNLKVCPKCQHHFSLSARERIDLMVD
ACCD_CLOB6        --------PTIPDGMWVKCN--KCGEILYQNDLEKNYMVCNLCGNHFRIGAKERIKYLFD
ACCD_CLOK5        --------PSIPNGMWVKCD--GCGKVLYKNDMEKNNKVCYHCGYHFRMNALERLELILD
ACCD_CLOAB        --------PTIPDGMWIKCS--KCGKILYKSDVDDNFKVCPKCNAHLRMNARERIEFIID
ACCD_CLONN        --------PNIPEGMWVKCD--RCGKTLYKKDLDENLKVCKFCNKHYRMNAWERIDLIVD
ACCD_CLOPE        --------PNIPSGMWSKCE--KCAKILYTEDLRENFNVCPNCGHHFKLGAYERIKYLTD
ACCD_CLOBA        --------PNIPSGMWTKCS--NCNSMIYYEDLENNKYVCTKCNQHFRISPKERIKQIFD
ACCD_CLOCE        --------PCAPKELLLICP--KCKKTLLKSELADNLDVCRECGYHFRISARKRIGITVD
ACCD2_EUBE2       --------------MTVKCN--KCKEEINKEDLEKNYYICPLCGKLNRMPAKNRLQMLTE
ACCD_LACLM        --------PEVPDELFAKCP--ACKHTIYQKDLG-KNKVCPNCDYNFRITAKERLAIVAD
ACCD_STRDG        --------PEVPDELFAKCP--ACKHMIYKKDLG-LAKICPTCSYNFRISAQERLTLTVD
ACCD_ENTFA        --------PSVPDNMWAKCP--SCKRTLYTKEMG-AEKICPHCGYSFRIGAWERLAITVD
ACCD_LACBA        --------ASIPDGLVRRCP--VCHTTFLTDHWE-PTRLCPACGYGFRLTAMQRIKLTMD
ACCD_LACH4        --------DAIPDHVMRECP--ICHAKFLSMRLG-RDHTCPKCGYGFRILAKRRVKITFD
ACCD_PEDPA        --------KKIPEGLWRECS--NCHEKFYYRRAG-VYEVCPNCGYGARLGSRKRIKLLCD
ACCD2_LACPL       --------DNIPDALLTRCP--VCHEDCYTQDLG-EFKVCPHCDYGFRLPAWQRVQQLTA
ACCD_LACP3        --------AALPENLWIQCP--YCKQGSYRESLG-NAQVCPHCHYGFRITAKKRLSLIAT
ACCD_OENOB        --------TQIPSGIWRECP--RCHSRFYYRRFG-NFDVCPECGYGFRLTARKRLRMLTK
ACCD_LEUMM        --------DRIPDGLFLACP--YCGAQMYNKQLG-KYRVCAKCNYGFRLQAWERVELLTK
ACCD_LACF3        --------AKVPDDLWRTCP--KCQRTLFAAQMD-EYATCPGCGYGFRISANQRLSWLVD
ACCD_LACRJ        --------ERVPDQMWLRCP--HCHQLLFAKQLT-QYAVCPNCDYGLRIPARHRLSWLVD
ACCD_LACS1        --------EKVPSGLWISCP--KCQQSIYHKDLG-KYKTCPNCYYGFRIHARERLEWLVD
ACCD_LACSS        --------QKVPDGLWVACP--KCQQSIYHKDLG-YYRTCPVCQYGFRTRAKVRLDWLVD
ACCD_LACDA        --------DLVPSGLMKRCP--NCGLEFFARRLD-KYKTCPDCDYGFRLTARERLAWLCE
ACCD_ACHLI        --------VDIPDGVFSQCE--QCNSAIYNKDLEHNYEVCPYCSYHFKINAVKRLKYTLD
ACCD1_LACPL       -----------ASGTWQACP--KCGRHVHQRQWG-TYQQCPYCHYWQRLTTAQRLEQLVD
ACCD_TREDE        ----------------MDCP--SCKVSYDEEVFTDNLMVCPHCNCHLRIEPRQRITYLTD
ACCD_PARUW        -----------GFSGWLKCT--HCNELIHANELEQNSNCCPKCDYHYRLSTEDRIKSLSN
ACCD_GEOBB        ---------KVPEGLWTKCV--SCGETIYTKDIENNLNVCPKCNHHYRVSSKKRLELLLD
ACCD_PELPD        ---------RVPQGMWVKCP--GCSATLLAKDLDANLNVCPTCGHHHRIGARRRLESLLD
ACCD_PELCD        ---------KMPEGVWRKCP--HCNEIIYAKEIERNLNVCPKCDYHFRISARERIALVLD
ACCD_UNCTG        ---------GVPEGIWTKCK--KCDYILLQKDFEENLMVCPKCGYCTRLSARKRIEFTVD
ACCD_AMOA5        ------HKKEIPDGLWYKSP--K-GKIIQIKELKENVYVSPEDGYHVRIGSKEYFELLFD
ACCD_GRAFK        ------HKKDVPKGLWYKSP--T-GKIVDAEQLESNFYVSPEDGYHVRIGSNEYFKILFD
ACCD_FLAB3        ------DKKDVPKGLWHQTP--T-GKIIEHEELKANNYVSPEDGFHVRIGSREFFSILFD
ACCD_PEDHD        ------EKKEAPDGLWNKCP--NCKKALHSADLLENKYVCQYCNYHLRVGSKEYFQVLFD
ACCD_CHLL7        -------RRDVPEGLWSKCE--DCGAMLHRRQLEENLNTCNECGHHFRISPYRYFSILFD
ACCD_PROA2        -------KRDMPEGLWWKCE--SCGAMLHKKQVEDHFYTCCECGYHFRLSPYQYFSLLFD
ACCD_SALRD        ------EQNEMPEGQWVKCP--ETGEITNRRELEENLLVFPGSGYHFGMDSHQYFGFLFD
ACCD_HYDS0        ------------ENLWTKCE--ECKNILLAQELETNFYVCPKCGHHHQMNPYLWASMLLD
ACCD_SULSY        ----------IEEGAWIKCD--KCKNILYIEDLLKNLKICPHCGYTFRMNAKERVDSLLD
ACCD_ECOLI        ------RKASIPEGVWTKCD--SCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLD
ACCD_PROMH        ------RKANIPEGVWTKCD--SCGQVLYRAELERNLEVCPKCDHHMRISARRRLETFLD
ACCD_BLOFL        ------KKMHVPEGIWTKCS--GCVQLLYTKELERNLQVCPKCDFHMKISARSRLLAFLD
ACCD_BLOPB        ------RKIDIPKGIWTKCD--NCGQLLYKKELERNLEVCPKCDHHMRIAARVRLFSFLD
ACCD_WIGBR        ------KKTNIPEGIWVKCN--NCNQMIYKIELEKNLEVCPKCNFHMRISARKRLEKFLD
ACCD_PASMU        ------RKANVPEGVWTKCT--SCEQVLYRDELRRHLEVCPKCGHHMRIDARERLLALLD
ACCD_IDILO        -------RRGVPEGVWSKCT--ACGNIIYKADLERSLNVCPKCDHHMRVTGRSRLDIFLD
ACCD_PSEHT        -------RKEIPEGVWAKCT--SCDSILYKAELEKALNVCPKCDHHMRISGRKRLEYFLD
ACCD2_VIBCB       ------RKTSIPEGVWTKCP--SCEQVLYRIALKENLEVCPKCNHHMRMTARDRLDSFLD
ACCD_VIBVU        ------RKASIPEGVWTKCT--SCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLD
ACCD_ALCBS        ------RRNNIPEGLWRKCP--RCEGVVYRPELDRNMDVCPKCDHHLRISARRRLKLFLD
ACCD_CHRSD        ------RRKSVPDGLWRKCP--NCEAVLYLPELERHQSVCPKCDHHLRLTARKRLNWFLD
ACCD_HAHCH        ------HKSNVPEGLWKKCP--KCSAVLYRPELEKNLDVCPKCQHHMRISARRRIDIFLD
ACCD_MARHV        ------QRTGVPEGLWKKCP--KCGAFLYKPELEKNLDVCPKCNHHLRVSARRRLDIFLD
ACCD_CELJU        ------RSNKVPEGLWEKCV--KCDAVLYKPELEKNLDVCPKCDHHMRIGARSRLNIFLD
ACCD_PSEF5        ------KSS-VPEGLWHKCP--SCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLD
ACCD_METCA        ------TKSTVPEGLWCKCP--SCNAILYKSEVERNLEVCPKCSHHMRISARKRLHLFLD
ACCD_HYDCU        ------RKKNVPEGLWTKCP--KCESTLYRAEVRRNLEVCPKCDHHMRLGGRDRLEAFFD
ACCD_ALKEH        ------SR-SVPEGLWTKCG--HCSAVLYRPELERNQEVCPKCGDHMRIGARRRLAGFLD
ACCD_HALHL        ------SR-SVPEGLWTKCE--SCQGILYRPDLERNLEVCPKCGAHMRISARQRLRLFLD
ACCD_BURCA        ------SRKGIPEGLWVKCP--SCEAVLYRNDVDANLHVCPKCDHHMRIGARERLDGLLD
ACCD_DECAR        ------RRGNLPEGLWSKCP--SCEAVLYATDLENNLQVCPKCGHHNRLNSRQRLDLLLD
ACCD_METFK        ------SRKTVPEGLWSKCP--SCESVLYRTDLESNSEVCPKCSYHNRISARTRLNFLLD
ACCD_XANAC        ------KKRSVPEGLWEKCS--NCGSALYGPELEENLEVCPKCDHHMAIRARARLNSLFD
ACCD_COXBU        -------KKGVPEGVWHKCP--SCTAVLYRVELERNLEVCPKCYYHIRLDPRKRLAQFLD
ACCD_PSYA2        ------QLTAVETEPSTKCS--SCHSVITNTALIFNCYVCPHCDHHLPMSARERLNWLLD
ACCD_PSYWF        ------QLTAVETEPSTECP--QCHSMITNTALIFNAYVCPHCDHHLAMTARERLTGFLD
ACCD_ACIB5        ------TLKATFTEPTIECP--ECHALVTRTAISFNAYVCPQCDEHLRMKARDRLNWFFD
ACCD_PELUB        -------ARATKTEIANSDWTSCCKGPILKKDLEENLWVCPSCNKHHRISPRQRFDIIFG
                                                                              

ACCD_AGRVS        GGKYEAFAQPKVA---QDPLKFRDSKK---------------------------------
ACCD_LIBAP        NAKYCLLDQPQVC---QDPLKFRDNKK---------------------------------
ACCD_BARBK        DGVYTPIENPKVV---TDPLKFRDAKR---------------------------------
ACCD_RHILO        DGRYEQLENPKVV---LDPLKFRDEKR---------------------------------
ACCD_AZOC5        DGAYEEVALPDVP---IDPLKFRDERR---------------------------------
ACCD_RHOPB        NETWYDIALPEVT---PDPLKFRDERK---------------------------------
ACCD_BEII9        EGVYETIPTPEVP---LDPLKFRDVKR---------------------------------
ACCD_METC4        EGTWIDVPLPEVP---ADPLKFRDEKR---------------------------------
ACCD_CAUSK        DGEHEVLPTPAVF---EDPLRFSDGKP---------------------------------
ACCD_PHEZH        DGQFEKIDCPQVV---EDPHKFPDDRA---------------------------------
ACCD_HIRBI        GSEYEELELPEVV---KDPLKFKDDRK---------------------------------
ACCD_HYPNA        DERWEPISLPQVP---LDPLKFKDDKP---------------------------------
ACCD_MARMM        GD-YTEIETPEVV---KDPLKFRDDKP---------------------------------
ACCD_ERYLH        EG-YEVLPQPEVA---EDPLKFRDSKK---------------------------------
ACCD_NOVAD        AG-YELLPAPKVK---EDPLKFRDTKK---------------------------------
ACCD_DINSH        GGVFSEVKVPAPI---ADPLQFKDQKK---------------------------------
ACCD_GLUDA        EGTFTRIELPKVP---VDPLSFRDRKR---------------------------------
ACCD_GLUOX        GGEYTTIELPKMP---VDPLGFKDSKR---------------------------------
ACCD_GRABC        EG-YTRIELPKAP---QDPLRFRDSKR---------------------------------
ACCD_METI4        PGSFIECEKHLH---SVDILGFNGEK----------------------------------
ACCD_OPITP        PGSFVESNIEVR---SADPLQFVDSA----------------------------------
ACCD2_ROSCS       G-SFVEYDAHLR---PTDPLGFVSPKE---------------------------------
ACCD1_ROSS1       G-SFVEFDAALA---SVDALGFVSPRH---------------------------------
ACCD_CHLAD        G-SFREMDSNLL---PTDPLGFVAADE---------------------------------
ACCD_HERA2        ADSFVEYDADLQ---GIDILGFVSPKD---------------------------------
B9L1K0_THERP      SGSFAEWDAHVV---TDDPLHFVALGE---------------------------------
ACCD_RUBXD        AGSFEERDGELA---AGDPLGFEG------------------------------------
ACCD_THET2        PGTFQE-TTRLR---PLDPLGFVDTK----------------------------------
ACCD_WOLSU        EGTLIEHDASLE---PTDPLTFVDKK----------------------------------
ACCD_RHOBA        DGTFEPMNEHLR---PTDPLEFRD------------------------------RRS---
ACCD_SORC5        DGELAAWDEHLV---PNDPLRFSD------------------------------GKS---
ACCD_HELSJ        KGTWYPLNETIS---PKDPIKFTD------------------------------TQS---
ACCD_CYACA        LKSWIPLYNNLL---SGDPLGFCDKK----------------------------------
ACCD_CUSGR        EGTWNPLDQDMV---SLDSSEFDSEAELECYEDNIKEWNEEMCQAFMRKLSKDLKEGQAL
ACCD_BRANA        PGSWNGMDEDMV---SADPIKFHS-----------------------------REEP---
ACCD_CUCSA        PGTWEPMDEDMV---SVDPIEWDS-----------------------------EVDPIQ-
ACCD_CALFG        SGTWDPMDEDMV---SMDPIQFHS-----------------------------EEEP---
ACCD_RANMC        PGTWDAMDEDMV---SVDPIEFHS-----------------------------EEEP---
ACCD_COFAR        PGTWDPMDEDMA---SLDPIEFHS-----------------------------EEEP---
ACCD_LACSA        PGTWEPMDEDMV---SLDPIEFHS-----------------------------EEEP---
ACCD_SPIOL        PGTWNPMDDDMV---SMDPIGFHS-----------------------------EEEA---
ACCD_GOSBA        PGTWGPMDEDMI---SLDPIEFQS-----------------------------EEEL---
ACCD_FAGEA        PGTWEPMDEDMV---STDPIEFHS-----------------------------QEEP---
ACCD_PHAAO        PGTWEPMDEDMV---SIDPIEFHSI---------------------DPIEFHSEEEP---
ACCD_SOYBN        SGTWNPMDEDMV---SLDPIEFH-----------------------------SEEEP---
ACCD_LOTJA        PGTWNPMDEDMI---SVDPIEFH-----------------------------SEEEP---
ACCD_CICAR        PGTWNPRDEDMV---SLDPIEFDPIELDPIEL--------------DPIELDSEDEP---
ACCD_EPIVI        PDTWYPMDEDMS---SLDPIEFHS-----------------------------EEEP---
ACCD_CUSRE        PGTWDPMDEDMV---SRDPIKFDSGGG----------------------------EA---
ACCD_IPOPU        PGTWDPMDEYMV---SQDPIEFDSEGEQEQE----------------QEQEQEEEET---
ACCD_MARPO        RGTWYPMDEDMT---ARDVLKFSDE------------------------------DS---
ACCD_PINTH        RDTWRPMDEDMY---TLDVLQFYSENEPSH-----------------SDNLNSEDES---
ACCD_AMBTC        PGTWHPMDEDMV---STDPIEFHS-----------------------------EEEP---
ACCD_PEA          RDTWNPMDEDMV---SVDPIKFDSIKELGSEEESSKDRLDEDMLSPDPIELDSEEESSKD
ACCD_OENEH        PKTWAPMHEGLL---SLDPIEFHS-----------------------------EKDP---
ACCD_ACAM1        AETWVAMDNNLV---ACDPLQFRD------------------------------RKA---
ACCD_NOSS1        QNTWRPMDENLR---ATDPLQFRD------------------------------RKA---
ACCD_SYNE7        PGTWQFLDEAVS---PTDPLGFRD------------------------------RKS---
ACCD_SYNY3        AKTWQPINEHLR---PTDPLKFKD------------------------------RKS---
ACCD_SYNP2        EGTWTEISQNVA---PTDPLKFRD------------------------------KKA---
ACCD_TRIEI        FNTWVPIDPELR---ATDPLKFSD------------------------------RKP---
ACCD_PROM1        PNTFKSINNNLT---PVDPLGFKD------------------------------RRA---
ACCD_SYNR3        PGSFIPVDGELS---PTDPLAFKD------------------------------RRA---
ACCD_CHLVU        ANTWRPFDEMVS---PCDPLEFRD------------------------------QKA---
ACCD_PORPU        QGSWEPMDVHLI---STDPLGFKD------------------------------QKL---
ACCD_GLOVI        PDSWVSTDDHLL---ANDPLGFND------------------------------IKS---
ACCD_SYNJB        PGSWQPLDEHLA---PTDPLHFFD------------------------------QKP---
ACCD_STAAC        EGSFTE-FDKGM--TSANPLDFPS------------------------------------
ACCD_STACT        EGTFKE-FDKGM--TSANPLDFPG------------------------------------
ACCD_MACCJ        KGTFKE-LDKHV--EPVNPLNFPN------------------------------------
ACCD_BACLD        DGSFEE-FNQDM--MSENPLEFPG------------------------------------
ACCD_GEOKA        DGSFRE-YDADM--ISVNPLGFPG------------------------------------
ACCD_BACHD        PGTFVE-LDKGM--TTEDPLSFPT------------------------------------
ACCD_OCEIH        NGTFEE-WDKEI--TSANPLDFPE------------------------------------
ACCD_LISIN        EGSFEE-LDANL--TTANPLGFEN------------------------------------
ACCD2_LYSSC       EGSFVS-MDDHL--QTSNPLNFPA------------------------------------
ACCD_EXIS2        AGTITY-FDLPA--VKADPLDFQD------------------------------------
ACCD_EXISA        EGSFER-FAGPS--VKANPLDFPD------------------------------------
ACCD_BREBN        DGVLREEFDANL--ITANPLGFPG------------------------------------
ACCD_PAESJ        DGRLYE-YDADM--ESVDPLEFPG------------------------------------
ACCD_DESRM        EGSFQE-RDNEL--ITLNPLNFPD------------------------------------
ACCD_PELTS        EGSFKE-LDAAL--LPVNPFNLPD------------------------------------
ACCD_DESAP        TEDFEE-LDAGL--APRDLLGFPG------------------------------------
ACCD_CARHZ        ENSFVE-FGREI--SGGNPLNFPG------------------------------------
ACCD_HELMI        ENSFIE-WDREL--VSKDPLQFPG------------------------------------
ACCD_DESHD        PGSFAE-WDREL--QTTNPLSFPD------------------------------------
ACCD_HALOH        EGSFKE-FGQDI--KTVDPLEFPG------------------------------------
ACCD_ALKOO        KDTFIEYDSEL---ESCNPLSFPK------------------------------------
ACCD_PEPD6        KGTFMEFNSDV---EFQNPLNFPK------------------------------------
ACCD1_EUBE2       DKSFRELYAQV---KTGNPNSFPG------------------------------------
ACCD_FUSNN        EGTFKEEDVTL---TSANPINFPE------------------------------------
ACCD_SYNWW        KDSFQEFDADL---SSFNLLDFPG------------------------------------
ACCD_CLOB6        KDTFKEWDYKV---KTENPLNFKG------------------------------------
ACCD_CLOK5        KESFYEFDKDI---TAANPIEFKG------------------------------------
ACCD_CLOAB        EGTFIEFDKNM---MAANPLEFPN------------------------------------
ACCD_CLONN        TGTFREFGENI---TSKNPLDFSG------------------------------------
ACCD_CLOPE        ENTFVEFDKKM---IGRNPLDFNG------------------------------------
ACCD_CLOBA        KDTFKEMWKSL---KTNNPIDFED------------------------------------
ACCD_CLOCE        NETFVEYDRELR--S-KNILNFPG------------------------------------
ACCD2_EUBE2       KFDVMFNDQEF-----TDPIDFPS------------------------------------
ACCD_LACLM        KDSFIEMFTGI---ESKNPLDFPG------------------------------------
ACCD_STRDG        EGSFQELFTSI---ETKDPLRFPG------------------------------------
ACCD_ENTFA        EKSFHNWDSEL---VTKDPLNFPG------------------------------------
ACCD_LACBA        --TFQETNAQL---TVPDRYTDAA------------------------------------
ACCD_LACH4        --KFTEIDQNI---TVPDRYTDEK------------------------------------
ACCD_PEDPA        --EFEEWDKAMA--TDPTNIDDEK------------------------------------
ACCD2_LACPL       --SFEERDADL---SAPVSFDDPA------------------------------------
ACCD_LACP3        --ATEEWDADL---VTSDPLDFPG------------------------------------
ACCD_OENOB        --DAVEWDADL---VTKDPLSFPG------------------------------------
ACCD_LEUMM        --NFEEMDSDI---QMDHP-EFPG------------------------------------
ACCD_LACF3        --SAVPMDTAL---QTQDPLNFPG------------------------------------
ACCD_LACRJ        --SFKEFDKDL---QTKNPLHFPG------------------------------------
ACCD_LACS1        --TFQEFDTDL---ETKDPLNFPG------------------------------------
ACCD_LACSS        --SFEPAGDLA---QTPNPLHFPK------------------------------------
ACCD_LACDA        --ESEEWFKDI---QPSDPLHFPN------------------------------------
ACCD_ACHLI        EDTFKPLFENI---TSKNPLGMPE------------------------------------
ACCD1_LACPL       EGSFQPLTMTE---RPVNQLGFPD------------------------------------
ACCD_TREDE        ENSFQELYPNLK---TCNPIEMEG------------------------------------
ACCD_PARUW        PNTFKPLFQNLQPVDTLNFVDTEP------------------------------------
ACCD_GEOBB        EGSFTEFDAGVVSVDFLEFKDSKS------------------------------------
ACCD_PELPD        AATWQELDSGMTSVDFLQFKDSKS------------------------------------
ACCD_PELCD        EGSFVERDAGMKSVDFLEFKDGKR------------------------------------
ACCD_UNCTG        KGSFKEMDEAIQPVNFLCFP---G------------------------------------
ACCD_AMOA5        NNQFTEIAANLT---SADPLEFIDNKP---------------------------------
ACCD_GRAFK        DNKYKELDKGMT---SKDPLDFEDTKK---------------------------------
ACCD_FLAB3        DNKFTELDANVE---SVDMLGFKDTKA---------------------------------
ACCD_PEDHD        NNQFTELFPNLT---SGDPLNFTDSKP---------------------------------
ACCD_CHLL7        NEEFTEFDDCLR---AADPLTFVDTKK---------------------------------
ACCD_PROA2        EKKYDEFDDNLR---AADPLHFSDTRK---------------------------------
ACCD_SALRD        DGDYDLHDTDLR---SVDALNFEDRKP---------------------------------
ACCD_HYDS0        YNYNV-LFEYIL---PTDFLSFKDTKR---------------------------------
ACCD_SULSY        KVYSYDLFPKIK---PVDIIGFKDTKR---------------------------------
ACCD_ECOLI        EGSL-VELGSELE--PKDVLKFRDSKK---------------------------------
ACCD_PROMH        TGST-TELGSELE--PKDILKFRDSKK---------------------------------
ACCD_BLOFL        QGSV-CELGQELL--PKDIFKFKDRKK---------------------------------
ACCD_BLOPB        KGST-SELGSEFE--PKDVLKFRDSKR---------------------------------
ACCD_WIGBR        KNNI-LELGKNLE--PKDILKFKDTKK---------------------------------
ACCD_PASMU        KDSS-QELSAELE--PKDILKFKDLKK---------------------------------
ACCD_IDILO        KDNR-EEIGTDLE--PKDVLRFKDSKK---------------------------------
ACCD_PSEHT        EGDR-VELGTQHE--PKDVLKFRDSKK---------------------------------
ACCD2_VIBCB       KEKQ-SEIACEYE--PKDVLNFKDKKR---------------------------------
ACCD_VIBVU        EGNR-VELGGELE--PQDKLKFKDSKR---------------------------------
ACCD_ALCBS        EGVQ-TEIGTELS--PVDRLKFKDSKK---------------------------------
ACCD_CHRSD        TEGR-EEIAADLQ--PVDRLKFRDSKK---------------------------------
ACCD_HAHCH        GADR-MEIAPELE--PADRLKFKDTKR---------------------------------
ACCD_MARHV        KDGR-EELAAHLE--PSDRLKFKDSKR---------------------------------
ACCD_CELJU        PQNR-QELATDVE--PVDRLKFKDIKK---------------------------------
ACCD_PSEF5        AEGR-AELGADLE--PVDRLKFRDGKK---------------------------------
ACCD_METCA        PGNR-LEIGEGLA--PLDPLKFKDSKK---------------------------------
ACCD_HYDCU        EGTG-VEISAEVT--PVDALKFKDIKP---------------------------------
ACCD_ALKEH        AEGQ-VEIGADVQ--PVDALRFRDSKK---------------------------------
ACCD_HALHL        ESCEAVEIGAELQ--PSDFLRFRDSKR---------------------------------
ACCD_BURCA        PEGR-YEIGQEIV--PVDTLKFKDSRK---------------------------------
ACCD_DECAR        SEGR-FEIGAEVL--PVDSLKFKDSKK---------------------------------
ACCD_METFK        AEGR-SEIGMEVQ--PVDPLKFKDSKR---------------------------------
ACCD_XANAC        PDTATTEIAAQLG--PVDALKFKDQKR---------------------------------
ACCD_COXBU        EGEQ-EELAEDIL--PVDRLKFRDSKK---------------------------------
ACCD_PSYA2        QVEG--ELGQEFT--AKDPLKFVDSKP---------------------------------
ACCD_PSYWF        HIEA--ELGQEFS--ASDPLKFVDSKP---------------------------------
ACCD_ACIB5        NVVA--ELGQEFS--AKDPLKFVDSKP---------------------------------
ACCD_PELUB        KNNYEVLKTPIPQ---DDPLNWNDAKP---------------------------------
                                                                              

ACCD_AGRVS        ------------------------------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        ------------------------------------------------------------
ACCD_RHILO        ------------------------------------------------------------
ACCD_AZOC5        ------------------------------------------------------------
ACCD_RHOPB        ------------------------------------------------------------
ACCD_BEII9        ------------------------------------------------------------
ACCD_METC4        ------------------------------------------------------------
ACCD_CAUSK        ------------------------------------------------------------
ACCD_PHEZH        ------------------------------------------------------------
ACCD_HIRBI        ------------------------------------------------------------
ACCD_HYPNA        ------------------------------------------------------------
ACCD_MARMM        ------------------------------------------------------------
ACCD_ERYLH        ------------------------------------------------------------
ACCD_NOVAD        ------------------------------------------------------------
ACCD_DINSH        ------------------------------------------------------------
ACCD_GLUDA        ------------------------------------------------------------
ACCD_GLUOX        ------------------------------------------------------------
ACCD_GRABC        ------------------------------------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        ------------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ------------------------------------------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        ------------------------------------------------------------
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        ERTANLIEEPWLPEYIQP-EEKVEEWTKPDLDEGEESQDEERWIWELDKGEESQEIEDSE
ACCD_BRANA        ------------------------------------------------------------
ACCD_CUCSA        ------------------------------------------WKSQVDPIEGDSEVDLIE
ACCD_CALFG        ------------------------------------------------------------
ACCD_RANMC        ------------------------------------------------------------
ACCD_COFAR        ------------------------------------------------------------
ACCD_LACSA        ------------------------------------------------------------
ACCD_SPIOL        ------------------------------------------------------------
ACCD_GOSBA        ------------------------------------------------------------
ACCD_FAGEA        ------------------------------------------------------------
ACCD_PHAAO        ------------------------------------------------------------
ACCD_SOYBN        ------------------------------------------------------------
ACCD_LOTJA        ------------------------------------------------------------
ACCD_CICAR        ------------------------------------------------------------
ACCD_EPIVI        ------------------------------------------------------------
ACCD_CUSRE        ------------------------------------------------------------
ACCD_IPOPU        ------------------------------------------------------------
ACCD_MARPO        ------------------------------------------------------------
ACCD_PINTH        ------------------------------------------------------------
ACCD_AMBTC        ------------------------------------------------------------
ACCD_PEA          RVDSEEEKDQSYIDRLDSYQEKTGLPETVQTGTDQREEIHPLFEDIMNQLDLYLQTAKNR
ACCD_OENEH        ------------------------------------------------------------
ACCD_ACAM1        ------------------------------------------------------------
ACCD_NOSS1        ------------------------------------------------------------
ACCD_SYNE7        ------------------------------------------------------------
ACCD_SYNY3        ------------------------------------------------------------
ACCD_SYNP2        ------------------------------------------------------------
ACCD_TRIEI        ------------------------------------------------------------
ACCD_PROM1        ------------------------------------------------------------
ACCD_SYNR3        ------------------------------------------------------------
ACCD_CHLVU        ------------------------------------------------------------
ACCD_PORPU        ------------------------------------------------------------
ACCD_GLOVI        ------------------------------------------------------------
ACCD_SYNJB        ------------------------------------------------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        ------------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        ------------------------------------------------------------
ACCD_PROMH        ------------------------------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        ------------------------------------------------------------
ACCD_IDILO        ------------------------------------------------------------
ACCD_PSEHT        ------------------------------------------------------------
ACCD2_VIBCB       ------------------------------------------------------------
ACCD_VIBVU        ------------------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        ------------------------------------------------------------
ACCD_HAHCH        ------------------------------------------------------------
ACCD_MARHV        ------------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        ------------------------------------------------------------
ACCD_METCA        ------------------------------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ------------------------------------------------------------
ACCD_HALHL        ------------------------------------------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        ------------------------------------------------------------
ACCD_PSYWF        ------------------------------------------------------------
ACCD_ACIB5        ------------------------------------------------------------
ACCD_PELUB        ------------------------------------------------------------
                                                                              

ACCD_AGRVS        ----------YSDRLKDS-RTKTE---------------QEDTIVAGLGTVEGLKLVAVV
ACCD_LIBAP        ----------YIDRLKEN-RSKTG---------------LIDSIVSAVGNVRDFKLVAVV
ACCD_BARBK        ----------YIDRLKEY-RAKLG---------------VDDNILSARGTIEGLPIIATV
ACCD_RHILO        ----------YTDRLKDA-KAKTG---------------LEDAIVNALGTIEGLPVVVTV
ACCD_AZOC5        ----------YIDRLKDA-RAKTG---------------AQDAVKVAHGLLEGLPVTVAV
ACCD_RHOPB        ----------YVDRIKDA-RAKTG---------------MNDAIKVGYGKLEGGAVVVAV
ACCD_BEII9        ----------YTDRIKEY-RQKTG---------------APDAVKLAYGKLQGLDAVVAV
ACCD_METC4        ----------YVDRLKEA-RAKTG---------------MPDAFKIGFGRVGSLPMTIAA
ACCD_CAUSK        ----------YKERLAAA-RKATG---------------EQDAMAIGYGKVGGAPAVVLV
ACCD_PHEZH        ----------YPDRLKAA-RKQTG---------------EQDSIAAAYGHIRGQPAVVMV
ACCD_HIRBI        ----------YVDRLKSS-RAKTG---------------REDCMAAAIGKIGKQNAVVLV
ACCD_HYPNA        ----------YPARLKAA-KAKILNRDIKETEDGGAPLLQEDCMVAAYGKIGGVPAVVLV
ACCD_MARMM        ----------YTAKLAAA-RKKTG---------------RDDSMAIATGTIGGLDAVVLV
ACCD_ERYLH        ----------YTDRLKQA-RAKNP---------------HADAFTVGSGAIDGHHAVVGV
ACCD_NOVAD        ----------YVDRIKAA-RAANP---------------HPDALTNAFGRIEGQKAVVGV
ACCD_DINSH        ----------YPERMKSA-VKATG---------------EPEAMLVAEGEIGRTPIVAAA
ACCD_GLUDA        ----------YTERLKDE-RSKSQ---------------LDESMAVAHGRIGGHDAVVAV
ACCD_GLUOX        ----------YTDRLKDA-RHKSH---------------LDEALVVAHGMIKGQKAVVAV
ACCD_GRABC        ----------YTDRLRDA-REKTH---------------LDDAIVVAHGTIEGQKAVVAA
ACCD_METI4        ---------SYQERLDYY-RNKTA---------------LDEAVVCGSCTIGSIPVFLCV
ACCD_OPITP        ---------PYPARIKKY-EKESG---------------LPEAVVTGAGKIHGVPVSLAV
ACCD2_ROSCS       ---------AYADKLRET-QRRTG---------------LADVVVSGVGSIEGYRLSIAV
ACCD1_ROSS1       ---------VYEQKLIES-RQQTG---------------LNDALITSSGAINGMLLCLAV
ACCD_CHLAD        ---------SYATKLAKT-QQRTG---------------MTDAVISGVGAISGIRLCIAV
ACCD_HERA2        ---------NYEAKLAAT-SERTG---------------TNDVVMSGSASIEGLPFEIAA
B9L1K0_THERP      ---------PYPAKISEA-RTRSG---------------EREALVTGAATIESIPVAIAV
ACCD_RUBXD        ----------YPDRLRSA-RKKTG---------------LGDAILSGVGEIGGRRVALAV
ACCD_THET2        ---------PYVERLKAY-QAETG---------------RPDAILGGTCQIGGVPAVLLV
ACCD_WOLSU        ---------SYKKRIEEG-KQKTG---------------RASSVLSGECRINGVSTQIVL
ACCD_RHOBA        ----------YAERLVGE-QKRTG---------------LTDAVLTGTGMIRARRVAFAV
ACCD_SORC5        ----------YRDRVAAL-HKKGR---------------AKEAIEIGRGRLGGRDIAYGA
ACCD_HELSJ        ----------YAQRIQST-QEKLG---------------MQDAVQTGTGLINGIPFAIGI
ACCD_CYACA        ---------PYITRLAEN-QKITG---------------LDEAVQTGIGRINNISASVAV
ACCD_CUSGR        ANDEDDDDAPYVERLAFY-KKETG---------------LLDAVQTGVGQLNGRPVALGV
ACCD_BRANA        ----------YKKRIASA-QKKTG---------------LTDAIQTGTGQLNGIPVALGV
ACCD_CUCSA        GDSEEYKDSSYKDRISSS-QIETG---------------LPEAIQTGTGKLNGIPVAIGV
ACCD_CALFG        ----------YRDRIDSY-QRKTG---------------LTEAVQTGIGQLNGIPVAIGV
ACCD_RANMC        ----------YKDRIDSY-QKKTG---------------LTEAVQTGIGQLNGISIAIGV
ACCD_COFAR        ----------YKDRIDSY-QKKTG---------------LTEAVQTGIGQLNGIPVAVGV
ACCD_LACSA        ----------YKNRIDSY-QRNTG---------------LTEAVQTGRGQLNGITVAIGV
ACCD_SPIOL        ----------YKDRIDSY-QIKTG---------------LTEAVQTGIGQLNGIPVAIGV
ACCD_GOSBA        ----------YKDRIDFY-QRKTG---------------LTEAIQTGTGQLNGIPIAIGV
ACCD_FAGEA        ----------YKDRINSY-QKETG---------------LTDAVQTGIGQLNGIPVAIGV
ACCD_PHAAO        ----------YIDRISFY-QTKTG---------------LTEAVQTGVGQLNSIPIAIGV
ACCD_SOYBN        ----------YKDRIDSY-QRKTG---------------LTEAVQTGTGQLNGIPVAIGI
ACCD_LOTJA        ----------YKDRIDSY-QKTTG---------------LTEAVQTGTGHLNGIPVAIGI
ACCD_CICAR        ----------YKTRLDSY-QKRTG---------------LSEAVQTGTGQINGIPVAIGI
ACCD_EPIVI        ----------YKDRIYSY-QKRTG---------------LTEAVQTGLGQLNGIPIAIGV
ACCD_CUSRE        ----------YKDRLYFY-QRKTG---------------LTEAVQTGIGQLNGIPVAIGV
ACCD_IPOPU        ----------YKDRIDFY-QTKTG---------------LTEAVQTGIGQLNGIPVAIGV
ACCD_MARPO        ----------YKNRIAFY-QKRTG---------------LTDAIQTGIGQLNGIPIALGV
ACCD_PINTH        ----------YKDHITFY-QIETG---------------LTDAIQTGIGQLNGLTIALGV
ACCD_AMBTC        ----------YRDRIDSY-QRQAG---------------LTDAVQTGIGQLEGIPIAIGV
ACCD_PEA          VDSEEEKDQSYIDRLDSY-QEKTG---------------LPEAVQTGTGQLNGIPLALAV
ACCD_OENEH        ----------YKDRVASY-KRKTG---------------LSEAIQTGRGYLKRIHLGIGL
ACCD_ACAM1        ----------YCDRIQEY-QSKTG---------------LQDAVQTGVGELDGLPLALGV
ACCD_NOSS1        ----------YSDRLREM-EDKLG---------------LLDAVKTGLGQINSSPVALAV
ACCD_SYNE7        ----------YSDRLKET-QANTG---------------LSDAVRTGVGLLEGQPVALGV
ACCD_SYNY3        ----------YKDRIRDT-QKATD---------------LTDAVQTGHGRLDGLPIALGV
ACCD_SYNP2        ----------YSDRLKDY-QEKTN---------------LTDAVITGTGLIDGLPLALAV
ACCD_TRIEI        ----------YSDRLLEY-QRKTG---------------LPDAVQTGIGNIETEPVALGV
ACCD_PROM1        ----------YADRLRES-QASTG---------------LKDGVLTGTCEVNSIPMALAV
ACCD_SYNR3        ----------YADRLRDS-QRQTG---------------LRDAVVCGTGTIEGQGIALAV
ACCD_CHLVU        ----------YTERLKDA-QERTG---------------LQDAVQTGTGLLDGIPIALGV
ACCD_PORPU        ----------YSQRLKDT-AFKTS---------------LQDAVQTGVGTMLGQKVCLGI
ACCD_GLOVI        ----------YPERLAQA-REKTG---------------LSDAIVTGLATLEGRPIALGV
ACCD_SYNJB        ----------YSERLATY-QERTQ---------------LKDAVLTGLGSLEGIPVAIGV
ACCD_STAAC        ----------YLEKIEKD-QQKTG---------------LKEAVVTGTAQLDGMKFGVAV
ACCD_STACT        ----------YEEKIKKD-QEKTG---------------LDEAVVTGTAELGGIEYGVAV
ACCD_MACCJ        ----------YEEKIEKD-RAKTE---------------IDEAVVTGWGTINGYKTGIAV
ACCD_BACLD        ----------YLEKLQKD-REKTS---------------LNEAVVTGKGTIDGSPAVVAV
ACCD_GEOKA        ----------YIEKLEED-RRKSG---------------LNEAVVTGEGALDGHPLVIAV
ACCD_BACHD        ----------YREKVEAD-RKKTN---------------LNEAIVTGEGTMNGFPLVIGV
ACCD_OCEIH        ----------YESKIAKD-REKTS---------------LSEGVVTGKGKVNNVQIAFAV
ACCD_LISIN        ----------YMDRIEKD-KQKSG---------------LNEAIVTGHATIDGNPLVIAV
ACCD2_LYSSC       ----------YVEKISAD-QEKTG---------------LNEAVLTGVGTLDGEEIVVAI
ACCD_EXIS2        ----------YPEKLKGD-QVRTG---------------LEEAIVCGVGQVNGYPLVACV
ACCD_EXISA        ----------YEEKLTKD-RKRTG---------------IEEAVVCGKATIDGLPLVVCV
ACCD_BREBN        ----------YLEKLEQD-MANTN---------------LNEAIITGEGFLGGNRIVIGV
ACCD_PAESJ        ----------YKGKLEQQRQKNPN---------------LREAVVTGEGTINGHPVVVAV
ACCD_DESRM        ----------YQEKIQSA-QKATE---------------LKEAVVTGEGTIGGNPVVIGV
ACCD_PELTS        ----------YESKLVSA-RQSTG---------------LNEAVLTGEAAIEGYPAVVVV
ACCD_DESAP        ----------YAERLAAN-QKQTG---------------LNEAAISAEGTIGGHRVVLVV
ACCD_CARHZ        ----------YEEKLAEA-REKTG---------------LKEAVVTGLGKINGREVVLAI
ACCD_HELMI        ----------YAQKIQKC-QIETS---------------MSEAITTGQGRICDIPVVLGV
ACCD_DESHD        ----------YEEKLAEA-YQKSD---------------VSESVLTGQASIEGMPVVLAF
ACCD_HALOH        ----------YQQKIGKY-KVKTG---------------MEEAIITGEATIEGYPVVIAV
ACCD_ALKOO        ----------YAEKILAA-METSM---------------EKDAVITGEGTIRGESCVLCV
ACCD_PEPD6        ----------YKEKVDSY-KEKTK---------------ESEAVVTGYGRINGIKTVICV
ACCD1_EUBE2       ----------YEQKVEAN-RLKTG---------------QQDAVVTGTCRIGGVKTAVAV
ACCD_FUSNN        ----------YVEKIEKA-QHDSG---------------MNEGVISGLGEINGLKVSIAC
ACCD_SYNWW        ----------YQEKLEKA-QELSG---------------SREGIITGLASIDGHKLVLGV
ACCD_CLOB6        ----------YDEKIENI-KEETN---------------LSEAVTTGKGKIAGMEVVVCI
ACCD_CLOK5        ----------YEDKIKNM-QNKTN---------------IKEAVITGKGTIGREEAVVCI
ACCD_CLOAB        ----------YEAKIKSM-QEKTG---------------LKDGVVTGLGNINGYKTVIAV
ACCD_CLONN        ----------YEDKLKGI-KEKTK---------------LKEGVITGKGKIYGKNVVIAV
ACCD_CLOPE        ----------YEEKIKGY-QKKSH---------------VIEGVVTGEAYIAQRKVVLCV
ACCD_CLOBA        ----------YEEKINKS-QSNTG---------------SKEAVVTGVGRINDLEVACAI
ACCD_CLOCE        ----------YDEKLKTA-IKENG---------------ENEAVICGIGKIEGFECAIFA
ACCD2_EUBE2       ----------YKEKYESA-REKSG---------------ETEGVVCGRGTIGGNDTCIFI
ACCD_LACLM        ----------YPEKLAAT-KARTG---------------LDEAVMTGTATIKGQKTALAI
ACCD_STRDG        ----------YQEKLQKA-KETTG---------------LHEAVLTGKAMVKEQKIALAI
ACCD_ENTFA        ----------YLEKIEKM-QEKTG---------------LDEAVLTGEATIEGQAVAIGI
ACCD_LACBA        ----------YQAKVARG-RQLTG---------------LNESVLTGFGTIDHQSTAIGV
ACCD_LACH4        ----------YRAKIAKA-KKVTG---------------LNESVLTGIGSLNKQQVAVGI
ACCD_PEDPA        ----------YKKKLATG-IKTTH---------------VNESVLTGKAKIGNNEFAIGV
ACCD2_LACPL       ----------YLEKLQRA-KAASH---------------LNESVLTGIGTLATYQFGLGV
ACCD_LACP3        ----------YTEKLAAG-QAATG---------------LKDSVWTGQATIGGQSCALGI
ACCD_OENOB        ----------YSEKLQRA-QKITK---------------LNESVWTGLALLDKRSVALGI
ACCD_LEUMM        ----------YAEKLKRA-QSQTE---------------LAESVLTGTADIEGEQVALGI
ACCD_LACF3        ----------YEGKLKKA-QEKSG---------------LNDSVWTGRARIGDVDFNLGI
ACCD_LACRJ        ----------YQEKISKL-QRQTK---------------LNDSVLTGEASINDQLFSLGI
ACCD_LACS1        ----------YKEKLIKA-QQDSK---------------LNDSVLTGIAMIDDVEFALGI
ACCD_LACSS        ----------YPQKLRKA-QQITG---------------LEDSILTGVATIKQQKFALGI
ACCD_LACDA        ----------YEAKVAAG-KKKTG---------------LNEAVWTGLAKIGGQETALAI
ACCD_ACHLI        ----------YEEKLDKG-MRMAK---------------MNEAFLAGTGKIDGQNLAIGV
ACCD1_LACPL       ----------YMNKLRRA-QRQTG---------------LNEAVVCGTALIEQQPCILAV
ACCD_TREDE        ----------YEEKISAA-EEKAS---------------LNEAVITGSCKIKGRDALLAL
ACCD_PARUW        ----------YPKRLANA-QEKST---------------SNEAVVVGTCMINKHKIALGV
ACCD_GEOBB        ----------YQDRIDQA-LAKGG---------------SKDAIICGSGRIEGTPVQICV
ACCD_PELPD        ----------YQERIDSA-LSKGG---------------SRDAVVCVEGSIEGTAVQVAV
ACCD_PELCD        ----------YRDRISAA-IKKSG---------------LNDAVIWGEGAIEAQPVVVAV
ACCD_UNCTG        ----------YSDKIK-----KSE---------------MSDAVVTGEAKINGYSVVIAV
ACCD_AMOA5        ----------YTQRLQQA-QQDTQ---------------LKDSIQVGYGPVNGNSMVIAC
ACCD_GRAFK        ----------YTDRLKAA-QEKTG---------------LKDAVRCAVGKSKGNDLVIAC
ACCD_FLAB3        ----------YVDRLKEV-KAKTK---------------LTDSIRNAVGRVNGEQMVISC
ACCD_PEDHD        ----------YTERLIES-MAKTG---------------LKDAIRAAHGKIEGEDLVVAC
ACCD_CHLL7        ----------YPDRVHDT-IEKSG---------------KTEACRNAFGKSAGADLVISA
ACCD_PROA2        ----------YPDRVHDI-LEKTG---------------KTEACRNAIGRVSGHDLVISA
ACCD_SALRD        ----------YSQRLESA-VEETG---------------QNEAVQAATGSVGGHPVSMAG
ACCD_HYDS0        ----------YKDRLKTL-KETSN---------------TSEAMTVFDGKLSDYPVVLSV
ACCD_SULSY        ----------YKDRLKEA-QEKTG---------------LNDAIIIAHGNIYDREVVLAS
ACCD_ECOLI        ----------YKDRLASA-QKETG---------------EKDALVVMKGTLYGMPVVAAA
ACCD_PROMH        ----------YKDRIAAA-QKQTH---------------EKDALVVMKGTLKEMPVVAAS
ACCD_BLOFL        ----------YKDRLIDA-QKKTQ---------------EKEALIVMQGTIYSMQVVVAA
ACCD_BLOPB        ----------YKDRLISA-QKITK---------------EKDALIVMQGTLYGMKIVAAS
ACCD_WIGBR        ----------YKDRLYIA-QKLTK---------------EKDAIIVMKGSLYKMPIVAAA
ACCD_PASMU        ----------YKDRISAA-QKETG---------------EKDALISMFGTLYGMPIVAAA
ACCD_IDILO        ----------YKDRIAAA-QKSTG---------------ENDALIAEKGTVKGVPLVAVA
ACCD_PSEHT        ----------YSDRITAA-QKSSG---------------EKDALVAMKGHLKGIPVAAVA
ACCD2_VIBCB       ----------YKERIALA-QKSTG---------------EKDALVAMKGELLGLPIVACA
ACCD_VIBVU        ----------YKERIAAA-QKSSG---------------EKDALVAMKGELLGMPIVACA
ACCD_ALCBS        ----------YKDRLVAA-QKATD---------------EKDALVVLKGALHGEPLVACA
ACCD_CHRSD        ----------YKDRLAAA-QKETD---------------ENDALIAMRGKLDGLPVVAVA
ACCD_HAHCH        ----------YKDRLVSN-QKATG---------------EKDALVAFKGTVAGVPVVAVA
ACCD_MARHV        ----------YKDRLAAA-QKSTG---------------EKDALIAMRGTTMGVPLVACA
ACCD_CELJU        ----------YKDRLSSA-QKDTG---------------EKDALIAMRGELKGMPVVAVA
ACCD_PSEF5        ----------YKDRLTAA-QKQTG---------------EKDALISMSGTLLGMPVVVSA
ACCD_METCA        ----------YKDRLQQA-QKATG---------------EKDALIVVAGQLLGLPVVAGA
ACCD_HYDCU        ----------YKTRIAQA-QKATG---------------EKDSFITMTGKIQGLEVVAGA
ACCD_ALKEH        ----------YRDRLAQA-QKGTG---------------ERDALVAMQGRLRGMPVVAVA
ACCD_HALHL        ----------YRDRLNQA-QKATG---------------ENDALVAMRGAVHQRPVVVCA
ACCD_BURCA        ----------YPDRLKEA-MDETG---------------ETDAMVVMGGAIHTLPVVAAC
ACCD_DECAR        ----------YPDRLMEA-NESTG---------------ESDSLVVLQGAIKTMPVVAAA
ACCD_METFK        ----------YIDRLKTT-QAEVG---------------ETDALIVMQGSIKAVGVVAAA
ACCD_XANAC        ----------YGERIKAS-QKASG---------------EYDALIAMRGTLKGNPLVAAA
ACCD_COXBU        ----------YKDRLSAA-QKATE---------------EKEALVVYKGNIYGNPIVAAA
ACCD_PSYA2        ----------YPDRMAEA-QDKTK---------------ESEALIVLYGKLRNLDIVTCA
ACCD_PSYWF        ----------YPQRMEQM-QTKTG---------------ETEALIVLQGKLRDMDVVACA
ACCD_ACIB5        ----------YPDRMREA-QTKTG---------------ETEALIAMQGNLNGVDMIACA
ACCD_PELUB        ----------YKDRLKAA-RKKTG---------------MDCGMMVVNTNILNLKITAIA
                            *  :                                              

ACCD_AGRVS        HEFNFMGGSLGIAAGEAIVKAFERAIAEKCPLVMFPASGG-ARMQEGILSLMQLPRTTVA
ACCD_LIBAP        HEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGG-ARMQEGILSLMQLPRTTIA
ACCD_BARBK        QDFAFMGGSLGMASGEAIIEAFHTAIADKCPLVLFAASGG-ARMQEGTLSLMQMPRTTVA
ACCD_RHILO        QDFAFMGGSLGMAAGDAIVHAFEVALQRKRPLILFAASGG-ARMQEGILSLMQLPRTTVG
ACCD_AZOC5        QDFGFMGGSLGMAAGEAVVTGLFTAAEKKTPFIMFAASGG-ARMQEGILSLMQMPRTTVA
ACCD_RHOPB        QDFDFMGGSLGMAAGEAIVRGIELAVEKQSPFILFAASGG-ARMQEGILSLMQMPRTTVG
ACCD_BEII9        QDFAFLGGSLGMAAGEAVITGMQQALERQAPFIIFTASGG-ARMQEGMFSLMQMPRTTLM
ACCD_METC4        QEFGFMAGSLGMAGGEAFVRGAETALEKRTPYVLFAASGG-ARMQEGILSLMQMPRTTVA
ACCD_CAUSK        QDFAFMGGSLGMAAGEGFIAAAEAAIARQVPLVAFTAAGG-ARMQEGALSLMQMARTTLA
ACCD_PHEZH        QDFAFMGGSLGMGAGEAFIAAAKEAVKRQVPLVIFTASGG-ARMQEGTLSLMQMARTTLA
ACCD_HIRBI        QDFAFMGGSLGMAAGEAFITAAEKALETKSALIICTASGG-ARMQEGALSLMQMPRTTVA
ACCD_HYPNA        QDFEFMGGSLGMAAGEAFITAAQLALARKSAFVVCTASGG-ARMQEGTLSLMQMPRTTLA
ACCD_MARMM        QNFAFMGGSLGMAAGESFIKAAETALARKAPMIVFTAAGG-ARMQEGALSLMQMPRTTLA
ACCD_ERYLH        QDFGFMGGSMGMAVGTAFCAGAERALRRKCGYIVVTAAGG-ARMQEGILSLMQMPKATVM
ACCD_NOVAD        QEFAFMGGSMGMAVGNAFVAGTERAIKEKCPYVAVTAAGG-ARMQEGILSLMQMPRSTVA
ACCD_DINSH        QDFSFMGGSMGMYVGNAIIAAAERAVALKRPLILFSAAGG-ARMQEGILSLMQMPRTTVA
ACCD_GLUDA        MAFEFIAGTMGAALGEAFLAAARLAILQKAPLVVFTASGG-ARMQEGMVSLMQMPRTTVA
ACCD_GLUOX        MAPEFLLGTMGAALGEAFVAACRLAVLQKAPLVVYTASGG-ARMQEGVVSLMQMPRTTIG
ACCD_GRABC        MAFEFMGGSMGAAVGEGIVAAAQLAVLQKAPFIIFTASGG-ARMQEAAISLMQMPRTTIA
ACCD_METI4        MDFGFLGGSMGSVVGEKITRMIEKSLSAKTPLLIISASGG-ARMYEGMFSLMQMAKTAAA
ACCD_OPITP        MDFRFCGGTLGSAAGEKITRAIETAIAQKIPCIIFSTSGG-ARMQEGILSLMQMAKTSAA
ACCD2_ROSCS       CDFNFIGGSMGSVFGEKMARAAERAATLGIPLLTINTSGG-ARMQEGVIALMQLAKVNMA
ACCD1_ROSS1       TEFEFIGGSMGSAYGERLARVIERAADARLPLLTINASGG-ARQEEGTLALLQMAKVNMA
ACCD_CHLAD        ADFSFMGASMGSVYGEKMARAAERAAELGIPLLTINTSGG-ARQQEGVIGLMQMAKITMA
ACCD_HERA2        CNFEFMGGSMGSVFGEKVARAVERAADRGVPVLTINASGG-ARMHEGIFALMQMAKVSVA
B9L1K0_THERP      AEFGFLGASMGSVFGEKFARAAERAAMERRAFVVFASSGG-ARMHEGIFSLFQLPKTIVA
ACCD_RUBXD        MDFRFIGGSMGSVVGERVARTVELARAEGLPLVTVSASGG-ARMFEGIYSLMQMAKTSVA
ACCD_THET2        MDYAFAGGSMGSVVGEEIARGAERAAEEGRALVIVAASGG-ARMQEAALSLMQMAKTVMS
ACCD_WOLSU        FNFAFMGGSLGSVEGEKIVRAVNRALEKHQGLVILSTSGG-ARMQESTYSLMQMAKTSAA
ACCD_RHOBA        TDSAFIMGSMGSVVGERLTRLIERATEQNLALIIISASGGGARMHEGILSLMQMAKVSAA
ACCD_SORC5        FVFAFMGGSMGSVVGEKITRLFERATREELPVVLLQASGG-ARMQEGILSLMQMAKSVSA
ACCD_HELSJ        MDFRFMGGSMGSVVGEKLTRLIEYATKQGLFLLIVSASGG-ARMQEGIYSLMQMAKISAA
ACCD_CYACA        MDFNFMGGSMGSAVGEKITRLVEFSTKEELPIVIISASGG-ARMQEGILSLMQMAKISAA
ACCD_CUSGR        MDFRFLAGSMGCVVGEKITRLIEYATNNLLPLIILSASGG-ARVHEGSLSLMQMAKISAA
ACCD_BRANA        MDFQFMGGSMGSVVGDKITRLIEYATNQCLPLILVCSSGG-ARMQEGSLSLMQMAKISSV
ACCD_CUCSA        MEFEFMGGSMGSVVGEKITRLIDYASNQFLPLILVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_CALFG        MDFQFMGGSMGSVVGEKITRLIEYATNRSLPVIMVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_RANMC        MDFQFMGGSMGSVVGEKITRLIEYATNGFLPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_COFAR        MDFQFMGGSMGSVVGEKITRLIEYATKELLPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_LACSA        MDFQFMGGSMGSVVGEKITRLIEYATKEFLPLIIVCASGG-ARMQEGSVSLMQMAKISSA
ACCD_SPIOL        MDFQFMGGSMGSVVGEKITRLIEYASNKFIPLIIVCASGG-ARMQEGSLSLMQMAKISSV
ACCD_GOSBA        MDFQFMGGSMRSVVGEKITRLIEYATNNFLPLILVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_FAGEA        MDFQFMGGSMGSVVGEKITRLAEYATNQNLPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_PHAAO        MDFQFMGGSMGSVVGEKITRLIEYATNRSLPVIIVCASGG-ARMQEGALSLMQMAKISSA
ACCD_SOYBN        MDFQFMGGSMGSAVGEKITRLVEYATNQLLPLILVCASGG-ARMQEGSLSLIQMAKISSA
ACCD_LOTJA        MDFEFMGGSMGSVVGEKITRLVEYATNQLLPLIVVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_CICAR        MDFQFMGGSMGSVVGEKITRLIEYATNQLLPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_EPIVI        MDFQFMGGSMGSVVGEKITRLIEYATNKILPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_CUSRE        MDFKFMGGSMGSVVGEKITRLIEHATNKFLPLIIVSASGG-ARMQEGSLSLMQMAKISSA
ACCD_IPOPU        MDFHFLGGSMGSVVGEKITRLIEHATNNFLPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_MARPO        MDFQFMGGSMGSVVGEKITRLIEYATRASMPLIIVCSSGG-ARMQEGTLSLMQMAKISSV
ACCD_PINTH        MDFQFMGGSMGSVVGEKITRLIERATAESLPLIMVCASGG-ARMQEGSFSLMQMAKIASA
ACCD_AMBTC        MDFQFMGGSMGSVVGEKITRLIEYAIDRSLPVVIVCASGG-ARMQEGGLSLMQMAKISSA
ACCD_PEA          MDSEFIAGSMGCVVGEKITRLIEYATNLLLPLIIVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_OENEH        MDFQFMGGSMGSVVGERITRLVEYATNRVLPLILVCASGG-ARMQEGSLSLMQMAKISSA
ACCD_ACAM1        MDFRFMGGSMGSVVGEKLTRLIEHATQNRLPLVIVCASGG-ARMQEGMLSLMQMAKTSAA
ACCD_NOSS1        MDFRFMGGSMGSVVGEKITRLIEQATQRRYPVVIICTSGG-ARMQEGMLSLMQMAKISAA
ACCD_SYNE7        MDFRFMGGSMGSVVGEKLTRLIEKGTEQRSPVIIVCASGG-ARMQEGMLSLMQMAKISGA
ACCD_SYNY3        MDFRFMGGSMGSVVGEKLCRLIEYATLERLPVVIICASGG-ARMQEGMLSLMQMAKISGA
ACCD_SYNP2        MDFGFMGGSMGSVVGEKICRLVEHGTAEGLPVVVVCASGG-ARMQEGMLSLMQMAKISGA
ACCD_TRIEI        MDFGFMGGSMGSVVGEKLTRLIEKATQESLPVIIICASGG-ARMQEGLLSLMQMAKISGA
ACCD_PROM1        MDFRFMGGSMGSVVGEKITRLIEHSTKEKLPLLIVCASGG-ARMQEGMLSLMQMAKISGA
ACCD_SYNR3        MDFRFMGGSMGSVVGEKITRLIETATEQQLPVLVVCASGG-ARMQEGMLSLMQMAKISGA
ACCD_CHLVU        MDFHFMGGSMGSVVGEKITRLIEYATQEGLPVILVCASGG-ARMQEGILSLMQMAKISAA
ACCD_PORPU        MDFRFMGGSMGSVVGEKLTRLLEKATQERLPAIILCASGG-ARMQEGMLSLMQMAKISSA
ACCD_GLOVI        MDFRFMGGSMGSVVGERITRLVERATAERRAAILVCASGG-ARMQEGVLSLVQMARTSAA
ACCD_SYNJB        MDFRFMGGSMGSVVGEKIARLTERATCDHLPLILFSASGG-ARMQEGILSLMQMAKTSAA
ACCD_STAAC        MDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGG-ARMQEGIISLMQMGKTSVS
ACCD_STACT        MDARFRMGSMGSVVGEKICRIIDYCTEHRLPFILFSASGG-ARMQEGIISLMQMGKTSVS
ACCD_MACCJ        MDSRFRMGSMGTVVGEKITRAIEYATKQQMPFIIFTASGG-ARMQEGILSLMQMAKVSVA
ACCD_BACLD        MDSSFRMGSMGSVVGEKITLAIEKAREEKVPFIIFTASGG-ARMQEGLLSLMQMAKTSSA
ACCD_GEOKA        MDSSFRMGSMGSVVGEKITRAVERAREQQMPFLIFTASGG-ARMQEGVLSLMQMAKTSAA
ACCD_BACHD        MDARFRMGSMGSVVGEKITRAIERAIENKQPFLLFSASGG-ARMQEGVLSLMQMAKTSAA
ACCD_OCEIH        MDSHFRMGSMGSAIGEKITRAIEAAREESIPFVIFTASGG-ARMQEGVLSLMQMAKTSFA
ACCD_LISIN        MDSRFRMASMGSVVGEKILRGVEEADKTNKPFVIFTASGG-ARMQEGMLSLMQMAKTSAA
ACCD2_LYSSC       MDSHFRMGSMGSVVGEKITRAVEKATELGVPFIIFTASGG-ARMQEGVLSLMQMAKTSVA
ACCD_EXIS2        MDARFRMGSMGAAVGAAISEAIRYATKERLPVTIFSASGG-ARMQEGMVSLMQMAKSSLF
ACCD_EXISA        MDARFRMGSMGAYVGEAIASAVRTATSLGLPVVLFTASGG-ARMQEGMVSLMQMANTSIA
ACCD_BREBN        MDSRFRMASMGSVVGEKITRAIEQAIERRLPFILFSASGG-ARMQEGVLSLMQMAKTSAA
ACCD_PAESJ        MSFDFFSGSMGSVVGEKITRAIEAAHEKKLPLLIFSTSGG-ARMQESILSLMQMAKTSAA
ACCD_DESRM        MDSHFIMGSMGSVVGEKIARAIERAIEKKLPVVLFSTSGG-ARMQEGILSLMQMAKTAAA
ACCD_PELTS        MDARFMMASMGTVVGEKITRAAEAAAAGRRPLIIFSASGG-ARMQEGILSLMQMAKTVAA
ACCD_DESAP        MDSHFIMGSMGTVVGEKVARAAEHAVRNRLPLIVFSASGG-ARMQEGILSLMQMAKTAAA
ACCD_CARHZ        MDPNFIMASMGTAVGEKICLAMEKALEKKLPLVVFTASGG-ARMQEGIFSLMQMAKTVQL
ACCD_HELMI        MDPRFIMASMGAVVGEKIVRAAERALKLRLPLVLFSASGG-ARMQEGVLSLMQMARTSAA
ACCD_DESHD        NEGNFMMGSMGSVTGEKITRAIERAIELRCPVIIFSTSGG-ARMQEGILSLYQMAKTSAA
ACCD_HALOH        MDFHFMGGSMGSVVGEKVTRAIEKAISTRKPLVIFSTAGG-ARMQEGMLSLMQMAKTSAA
ACCD_ALKOO        MNPDFMMGSMGSVVGEKITRAIEKAIEKKLPVIIFCASGG-ARMQEGILSLMQMAKTSAA
ACCD_PEPD6        MNPDFMMGSMGSIVGEKITYSIEYAAENNLPIIICSASGG-ARMQEGMVSLMQMAKTSQA
ACCD1_EUBE2       MDKRFLMGSMGIAVGEKITRLTEYAMKRKLPLIIFAASGG-ARMQEGLFSLMQMAKTTAA
ACCD_FUSNN        MDFNFMGGSMGSVVGEKITAALERAIEHKIPAVVVAISGG-ARMQEGLTSLMQMAKTSAA
ACCD_SYNWW        MESGFMMASMGSVVGEKVCRAVEQAMELSCPLLICSCSGG-ARMQEGMVALMQMAKTSAV
ACCD_CLOB6        MDSKFMMGSMGSVVGEKITRAIERAIELRMPVIIFTVSGG-ARMQEGILSLMQMAKVSSA
ACCD_CLOK5        MDSNFMMGSMGSVVGEKITRAVEKSIELKLPLIIFTTSGG-ARMQEGIFSLMQMAKVSGA
ACCD_CLOAB        MDSNFMMGSMGSVVGEKITRAIEEATERKLPVIIFTTSGG-ARMQEGMFSLMQMAKTSAA
ACCD_CLONN        MDSRFMMGSMGSAVGEKITRAVEKATEERLPIIIFTTSGG-ARMQESMFSLMQMAKTSAA
ACCD_CLOPE        MDSNFMMGSMGTAVGEKITRAIEYATKNRLPLIIFTCSGG-ARMQEGIYSLMQMAKVSGA
ACCD_CLOBA        MDSFFMMGSMGTVVGEKITRIVEYATENNLPILIFTASGG-ARMQEGIFSLMQMAKISAA
ACCD_CLOCE        MEPFFMMGSMGCVVGEKIARLFELATDKSIPVIGFTVSGG-ARMQEGIMSLMQMAKISGA
ACCD2_EUBE2       MEPNFMMGSMGTVVGDRITALFEYATKNRLPVIGYTVSGG-ARMQEGALSLMQMAKVSAA
ACCD_LACLM        MDSTFIMASMGTVVGEKLTRLFEYATTEKLPIIVFTASGG-ARMQEGIMSLMQMAKTSAA
ACCD_STRDG        MDSHFIMASMGTVVGEKITRLFELAIEENLPVVIFTASGG-ARMQEGIMSLMQMAKVSAA
ACCD_ENTFA        MDANFIMGSMGTIVGEKITRLFERATEKHLPVVIFTASGG-ARMQEGIFSLMQMAKISAA
ACCD_LACBA        MDAFFVMGSLGTATGEKITRLFDEATAKRLPVILFTASGG-ARMQEGIHSLMQMAKVSAA
ACCD_LACH4        MDPFWIMGSLGSATGEKITRLFELATRKDLPVVMFTSSGG-ARMQEGIHSLMQMAKVSSA
ACCD_PEDPA        MDSRFIMGSLGQVTGSKIARMFQEATRQHLPVIMFTASGG-ARMQDGIHSLMQMARVSDE
ACCD2_LACPL       METKFMMGSLGAATGEKITRLFETCTTQKLPVVMVTASGG-ARMQEGARALMQMAKVSTA
ACCD_LACP3        MDPKFMMGSLGTVTGERLTRLFEKATSANLAVVLFCASGG-ARMQEGIHSLMQMAKVSAA
ACCD_OENOB        MDPYFIMGSLGMITGEKLARLFERATLHELPVILFTASGG-ARMQEGIHSLMQMSKVTAA
ACCD_LEUMM        MDSYFMMGSLGSMTGEKITRLFEYATAHTLPVVLFTASGG-ARMQEGIDSLMQMAKVSAA
ACCD_LACF3        MDPTFIMGSLGTITGEKITRLFEDATKNQRPVVLFTASGG-ARMQEGIMSLMQMAKVSTA
ACCD_LACRJ        MDPTFIMGSLGTVTGEKITRLFEYATTHRQAVVLFTASGG-ARMQEGIMSLMQMAKVSQA
ACCD_LACS1        MDPYFIMGSMGTVTGEKITRLFERATQKNLPVILFTASGG-ARMQEGISSLMQMSKISQA
ACCD_LACSS        MDPYFIMGSMGSATGEKITRLFELATEKGLPVILIAASGG-ARMQEGIFSLMQMAKTSAA
ACCD_LACDA        MDPFFIMGSLGQMTGEKLTRLIEAATEKRLPVVVFTASGG-ARMQEGIYSLMQMAKVVNA
ACCD_ACHLI        LDSYFMMGSMGSVVGERITRLIEHAAKHNLPLVIFSASGG-ARMQEGILSLMQMAKTSGA
ACCD1_LACPL       MDSHFMMGTLNTAVTRRLLHASEQARAQRLPLIIVTASGG-ARMQEGVYALVGMNLILAE
ACCD_TREDE        MSFHFMGGSMGSVVGEKISRLMLKGATERIPVIIYATSGG-ARMQEGLFSLMQMAKTSSA
ACCD_PARUW        LDFSFMGGSMGSVVGERLTRLIEHALKEKLPLIIVSTSGG-ARMQESILSLMQMAKTSGA
ACCD_GEOBB        FDFSFMGGSMGSVVGEKITRGIERALSDRTPCIIVSASGG-ARMQESILSLMQMAKTSAA
ACCD_PELPD        FDFSFMGGSMGSVVGEKITRAIERGVQKRQPVIIVSASGG-ARMQESILSLMQMAKTSAA
ACCD_PELCD        FDFSFMGGSMGSVVGEKITRAVEKALENRCPCLVFSSSGG-ARMQESIMSLMQMAKTSAA
ACCD_UNCTG        MDFEFMGGSMGSVVGEKIVRAIEKALKKKRHVIIISASGG-ARMQEGTISLMQMGKTSAA
ACCD_AMOA5        MDFNFIGGSMGSVVGEKIAKAVDHALEHKAPLLIISKSGG-ARMMEAGLSLMQMAKTSAK
ACCD_GRAFK        MDFKFVGGSMGSVVGEKIARAADYALKNKLPFMIISKSGG-ARMQEAALSLMQLAKTSVK
ACCD_FLAB3        MDFAFIGGSLGSVMGEKIRRAVDYCIANRLPYMIICQSGG-ARMQEATYSLMQLAKVQAK
ACCD_PEDHD        MDFNFIGGSMGSVVGEKIARSIDYSIKHKIPFLMISKSGG-ARMMEAAFSLMQMAKTSAK
ACCD_CHLL7        MDFGFIGGSMGSVVGEKISRAADKAIELNAPLIVISQSGG-ARMMEGAFSLMQMAKTAAR
ACCD_PROA2        MDFGFIGGSMGSVVGEKISRAVSKSIEHNAPLLIISQSGG-ARMMEGAFSLMQMAKTSAR
ACCD_SALRD        MDFSFIGGSMGSVVGETVARAIKRAYTEGMPLITIAQSGG-ARMMEGALSLMQMAKTSAH
ACCD_HYDS0        MDFSFIGGSMGSVVGERFKLASLKAVQDKKPHISVVTSGG-ARMQESVISLMQMAKTSIA
ACCD_SULSY        MDFNFMGGSMGSVVGAKFVRGVEFAIEKSIPFISVAASGG-ARMQESIVSLMQMAKTAIA
ACCD_ECOLI        FEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGG-ARMQEALMSLMQMAKTSAA
ACCD_PROMH        FEFAFMGGSMASVVGARFVRAVEQALEDNCPLICFSASGG-ARMQEALMSLMQMAKTSAA
ACCD_BLOFL        FEFDFIGGSMSSAVGSRFVQAVNQSLKLKCPFVCFSSSGG-ARMQEAFVSLMQMAKTSAA
ACCD_BLOPB        FEFAFIGGSMSSVVGARFVHAVNQALKIKCPLVCFTASGG-ARMQEALMSLMQMARTSAA
ACCD_WIGBR        FEFSFIGGSMSSVVGERFVFGVNESIKCNCPMVCFSASGG-ARVQEALISLMQMAKTSAA
ACCD_PASMU        SNFSFMGGSMGSVVGAKFVQAAEKAIAENCPFVCFSASGG-ARMQEALFSLMQMAKTSAV
ACCD_IDILO        FDFNFMGGSMASVVGAKFVLAAEVCLKHRIPLVCFSASGG-ARMQEALMSLMQMAKTSAA
ACCD_PSEHT        FEFSFMGGSMASVVGARFVDAVDQCLEHNMPLICFSASGG-ARMQEALISLMQMAKTSAA
ACCD2_VIBCB       FEFSFMAGSMGSVVGAKFVEAVDIAIEENRGLVCFSACGG-ARMQESLMALMQMAKTSAA
ACCD_VIBVU        FEFSFMGGSMGSVVGARFVRAVEAAMENNCALVCFSASGG-ARMQEALMSLMQMAKTSAA
ACCD_ALCBS        FEFSFMGGSMGSVVGERFVRAVNVCLEQKLPLVCFAASGG-ARMQEALFSLMQMAKTSAA
ACCD_CHRSD        FEFSFMGGSMGAVVGEKFVRAATQAREEGVPLVCFAASGG-ARMQEALFSLMQMAKTSAA
ACCD_HAHCH        FEFNFLGGSMGAVVGEKFVRAVNVCLEENRALICFSASGG-ARMQEALISLMQMAKTAAA
ACCD_MARHV        FEFNFLGGSMGQVVGEKFVQAANVALEHRIPLVCFSASGG-ARMQEAILSLMQMAKTAAV
ACCD_CELJU        FEFAFHGGSMGYVVGERFTRAATVALNENIPLVCFSATGG-ARMQEALISLMQMAKTSAV
ACCD_PSEF5        FEFSFMGGSMGAIVGERFVRAANYALEKRCPMICFSASGG-ARMQEALISLMQMAKTSAV
ACCD_METCA        FNFEFMGGSMGSVVGERFVRGVNHSLEHGAPFVVFSASGG-ARMQESLLSLFQMAKTSAA
ACCD_HYDCU        FEFKFMGGSMGSVMGEKFVRAVNEAIERRCPLIVFSASGG-ARMQEALFSLMQMAKTSAA
ACCD_ALKEH        FEFSFMGGSMGSVVGERFVRAADTAREQRVPLVCFSASGG-ARMQEGLFSLMQMAKTSAA
ACCD_HALHL        FEFGFMGGSMGTIVGERFCRAAEEARANDIPLVCFSASGG-ARMQEALFSLMQMAKTSAA
ACCD_BURCA        FEFSFMGGSMGSVVGERFARGAQNALEQHVPFICFTASGG-ARMQESLLSLMQMAKTTAM
ACCD_DECAR        FEFDFMGGSMGSVLGERFVRGVQAAVEQKMPFICITASGG-ARMQEGLFSLMQMAKTTAA
ACCD_METFK        FEFKFMGGSMGSVVGERFVRGVQAAIDNNTPFICVSASGG-ARMQEGMFSLMQMAKTSAA
ACCD_XANAC        FDFAFMGGSMGSVVGERFARAAEVALEVGCPFVCFSASGG-ARMQEGLFSLMQMAKTSAA
ACCD_COXBU        FNFFFVGGSMGAAVGERFAAGVEAAISERLPFVCFSTSGG-ARMQEGLFSLFQMAKTSAV
ACCD_PSYA2        FDFRFMGGSMGSVVGDRFVQAAEKALADKVPLVCFAASGG-ARMQEGLLSLMQMARTAAA
ACCD_PSYWF        FDFRFMGGSMGSVVGDRFVQAAEVALTNKAPLICFAASGG-ARMQEGVLSLMQMARTSAA
ACCD_ACIB5        FEFDFMGGSMGTVVGDRFVKAAELAIEKRQPLICFAASGG-ARMQEGMLSLMQMARTSAA
ACCD_PELUB        SDFDFVGGSIGAAEGEAFLYGIQHAIENEQPFVVFTSGGG-MRMMESLISLSQMTRTTLA
                      :  .::       .                    **  *  :.  .*  :      

ACCD_AGRVS        VDLLKE---AGLPYIVVLTNPTTGGVTASYAMLGDLHIAEPGAEICFAGKRVIEQTI-RE
ACCD_LIBAP        INMLKD---AGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTV-RE
ACCD_BARBK        IEMMKE---ARLPYIVVLTNPTTGGVTASYAMLGDVHIAEPGAMIGFAGPRVIQQTI-RE
ACCD_RHILO        VDRLKE---AGLPYIVVLTNPTTGGVTASYAMLGDVHIAEPGALIGFAGPRVIEQTI-RE
ACCD_AZOC5        IQELRE---ARLPYIVVLTNPTTGGVTASYAMLGDVQIAEPGALIGFAGPRVIEQTI-RE
ACCD_RHOPB        VQMLRD---AKLPYIVVLTNPTTGGVTASYAMLGDVQIAEPGALIGFAGARVIEQTI-RE
ACCD_BEII9        VQALRE---ARLPYIVVLTHPTTGGVSASYAMLGDIQVAEPGAVIGFAGARVIEQTI-HE
ACCD_METC4        VRRLRA---ARLPYIVVLTNPTTGGVTASYAMLGDVHLAEPGALICFAGPRVIEQTI-RE
ACCD_CAUSK        INMLKD---AGLPYVVVLTDPTTGGVTASYAMLGDVHLAEPGALIGFAGPRVIEQTI-RE
ACCD_PHEZH        LNEVKD---AGLPYVVVLTDPTTGGVLASYAMLGDVHLAEPNATIGFSGRRVIEQTI-RE
ACCD_HIRBI        ITELKD---ASLPYIVVLTDPTTGGVAASYAMIGDIHIGEPEAMVAFAGARVIEQTI-RE
ACCD_HYPNA        INDLAD---AKLPYVVVLTDPTSGGVSASYAMLGDVHIAEPGAMIAFSGPRVIEQTI-RE
ACCD_MARMM        VEMLRE---AGLPYIVVLTDPTTGGVTASYAMLGDVHIAEPGALIGFAGPRVIEQTI-RE
ACCD_ERYLH        TRRLRE---AGLPYIVVLTDPTTGGVTASYAMLGDVHIAEPGALIGFAGQRVIQDTI-RE
ACCD_NOVAD        ISRLHA---AGLPYIVVLTDPTTGGVTASYAMLGDVQIAEPGALIGFAGQRVIQDTI-RE
ACCD_DINSH        VQMLKE---AGLPYIVVLTHPTTGGVTASYAMLGDVQIAEPNALICFAGPRVIEQTI-RE
ACCD_GLUDA        VQMLRD---AGLPYIVVLTNPTTGGVTASFAMLGDVQISEPNALIGFAGQRVIEDTV-RE
ACCD_GLUOX        VQMLQE---AGLPYVVVFTNPTTGGVSASFAMLGDVHIAEPNALIAFAGPRVIQDTV-RE
ACCD_GRABC        TRMVKE---AGLPFIVVLTDPTTGGVTASFAMLGDIQIAEPKALIGFAGARVIEDTT-RE
ACCD_METI4        LQRLSQ---AHVPYISLLTNPTMAGVIASFASLGDVILAEPKAMIGFAGSRVIKETT-QQ
ACCD_OPITP        LGRLAA---ARLPYISVLTHPTTGGVSASYATLGDVILAEPGALIGFAGPRVIKDTT-KQ
ACCD2_ROSCS       LTRLAA---ARQPHIAVLVDPCYGGVTASYASVADIIIAEPGANIGFAGRRVIEQTI-RQ
ACCD1_ROSS1       LTRLAA---AGQPHIALLVDPCYGGVLASYTSVADVIIAEPGARVGFAGRRVIEQTI-RQ
ACCD_CHLAD        LTRLAE---AGQPHIALLVDPCYGGVTASYPSVADIIIAEPGANIGFAGKRLIEQIM-RQ
ACCD_HERA2        LTRLAR---VRQPHISLLVDPCYGGVSASYASVADIILAEPGANIGFAGRRVIEQTI-RQ
B9L1K0_THERP      VEALAE---ARLPFISVLVDPCYGGVTASFATVADVILAEPGAMIGFAGPRVIEQVT-RQ
ACCD_RUBXD        LSRFME---GSKPYISILTDPTFGGVTASFATAADIIIAEPGARVGFAGARVIEQTT-KE
ACCD_THET2        LDRVWA---RRLPYVSVLTDPTTGGVTASFAALADVILAEPGALIGFAGPRVIRQTI-RQ
ACCD_WOLSU        LARLSQ---AKLPFISLLTDPTMGGVSASFAFLGDIIIAEPGAMVGFAGARVIKQTI-GA
ACCD_RHOBA        LSRYH---AAGGLFISVLTNPTMGGVAASFASLGDLVFAEPKALIGFAGPRTIKATI-GI
ACCD_SORC5        LERYR---KARLPFLSVLLHPTTGGVAASFAFLGDANIAEPKALIGFAGPRVIENTI-RQ
ACCD_HELSJ        LNVYQN--EANLLYISLCTSPTTGGVTASFAMLGDIIFSEPEAIIGFAGRRVIQQTL-QQ
ACCD_CYACA        LERLQ--S-KGLLYISILSSPTTGGVFASFAMLGDIILAEPKAVVGFAGKRVVEQTL-NE
ACCD_CUSGR        LYDYQ--SNKRLFYISILTSPTTGGVTASFAMLGDIIITEPGTFVAFAGPRVVQQIL-NE
ACCD_BRANA        LCDYQ--SSKKLFYISILTSPTTGGVTASLGMLGDIIIAEPYAYIAFAGKRVIEQTL-KK
ACCD_CUCSA        LYDYKYQSNKKLFYVAILTSPTTGGVTASFAMLGDIIIAEPNAYIAFAGKRIIEETL-KM
ACCD_CALFG        SYDYQ--LNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_RANMC        SYDYQ--SNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_COFAR        LYDYQ--SNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NT
ACCD_LACSA        LYDYQ--SNKKLFYVPILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_SPIOL        LYDYQ--SNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_GOSBA        LYDYQ--SNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_FAGEA        LFDYQ--SNKKLFYVSILTSPTTGGVTASFGMLGDIIISEPSAYIAFAGKRVIEETL-NT
ACCD_PHAAO        SYDYQ--SNKKLFFVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-KK
ACCD_SOYBN        LYDYQ--KNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_LOTJA        LYDYQ--LNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NK
ACCD_CICAR        LYNYQ--INQKLFYVAILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTL-NT
ACCD_EPIVI        LFDYQ--SNKKLLYVSILTSPTTGGVTASFGMLGDIIIAEPNSYIAFAGKRVIEQTL-HK
ACCD_CUSRE        LYDYQ--SNKRLVYVSILTSPTAGGVTASFGMLGDIIIVEPRAYVAFAGKRVIEQTL-NQ
ACCD_IPOPU        LYEYQ--LNKRLFYVSILTSPTTGGVTASFGMLGDVIIVEPNAYVAFAGKRVIEQTL-NQ
ACCD_MARPO        LQIHQ--AQKRLLYIAILTYPTTGGVTASFGMLGDIIIAEPKAYIAFAGKRVIEQTL-RQ
ACCD_PINTH        LYIHQ--KEKKLLYISILTSPTTGGVTASFGMLGDIIIAEPKAYIAFAGKRVIEQTL-GQ
ACCD_AMBTC        SYNYQ--SNKKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAYVAFAGKRVIEETL-NK
ACCD_PEA          LYNYQ--INQKLFYVAILTSPTTGGVTASFGMLGDIIIAEPNATIAFAGKRVIEQLL-NK
ACCD_OENEH        LSDYQ--FNRTVFYVALLTSPTTGGVTASFGMLGDIILAEPNAYIAFAGKRVIEQTL-NI
ACCD_ACAM1        LDQHRT---NRLLYIPVLTHPTTGGVTASFAMLGDMILAEPKATIGFAGRRVVEQTL-RE
ACCD_NOSS1        LERHRD---ARLLYIPVLTNPTTGGVTASFAMLGDIILAEPKATIGFAGRRVIEQTL-RE
ACCD_SYNE7        LERHRE---AGLLYLPILTHPTTGGVTASFAMLGDLIIAEPKALIGFAGRRVIEQTL-RE
ACCD_SYNY3        LQNHRE---QKLLYIPVLTHPTTGGVTASFAMLGDLILAEPKATIGFAGRRVIEQTL-RE
ACCD_SYNP2        LERHRT---KKLLYIPVLTNPTTGGVTASFAMLGDLILAEPKATIGFAGRRVIEQTL-RE
ACCD_TRIEI        LEQHRE---AKQLYIPILTHPTTGGVTASFAMLGDIIIAEPKATIGFAGRRVIEQTV-RE
ACCD_PROM1        LERHRD---AQLLYMPLLTHPTTGGVTASFAMLGDLILAEPKALIGFAGRRVIEQTL-RE
ACCD_SYNR3        LERHRS---RKLLYIPLLTHPTTGGVTASFAMLGDLILAEPKALIGFAGRRVIEQTL-RE
ACCD_CHLVU        LHIHQNC--AKLLYISVLTSPTTGGVTASFAMLGDLLFAEPKALIGFAGRRVIEQTL-QE
ACCD_PORPU        LEMHKK---ENLLYLSVLTSPTTGGVTASFAMLGDLIIAEPKALIAFAGRRVIEQTI-KE
ACCD_GLOVI        LQNHRS---DRQLFVSVLTNPTTGGVTASFAMLGDIILAEPKATIGFAGRRVIEQTL-RQ
ACCD_SYNJB        LQRHRD---ARQLFISVLTHPTYGGVTASFAMLGDLILAEPGVQVGFAGPNVIEQTIGKG
ACCD_STAAC        LKRHSD---AGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI-NE
ACCD_STACT        LKRHSD---AGLLYISYITNPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI-NE
ACCD_MACCJ        LNRHRE---TGLLYIAFMTHPTTGGVSASFASVGDINLAEPESLIGFAGRRIIEQTI-NE
ACCD_BACLD        LKLFSE---EQGLIISVMTHPTTGGVSASFASLGDYNLAEPGALIGFAGRRIIEQTI-RE
ACCD_GEOKA        LKRFSN---DGGLFISVMTHPTTGGVSASFASLGDYNFAEPGALIGFAGRRVIEQTV-RE
ACCD_BACHD        LERLDR---VGGLFISVMTHPTTGGVSASFASLGDYNFAEPGALIGFAGRRIIEQTI-RE
ACCD_OCEIH        VKRFRD---SGGLMISVMTHPTTGGVSASFASIGDYNFAEPGALIGFAGRRIIEQTI-RE
ACCD_LISIN        FKRFSN---HGGLVITVMTHPTTGGVSASFASLGDYNFAEPGALIGFAGRRVIEQTV-RE
ACCD2_LYSSC       LKRHSD---QGLLFISILTHPTTGGVSASFASVGDINIAEPQALIGFAGRRVIEETV-RE
ACCD_EXIS2        LKQHSD---AGLLYVSCMTHPTTGGVSASFAMLGDFNIAEPGALIGFAGRRIIEQTI-RE
ACCD_EXISA        LKEHDE---AGLLYIAYLTHPTTGGVSASFAMLGDLNVAEPGALIGFAGRRIIEQTI-RE
ACCD_BREBN        LSRLDR---ERLLFVSVMTNPTYGGVSASFSSLGDYNIAEPGAMIGFAGRRVIEQTI-RQ
ACCD_PAESJ        LSMFQG---AGGLFISVFTDPTMGGVSASFASLGDYNLAEPGALVGFAGRIVIEQTI-RQ
ACCD_DESRM        LAKLDE---AGLLYVAVLTDPTTGGVTASFASLGDIIIAEPGALIGFTGPRVIEQTI-RQ
ACCD_PELTS        LARLGE---EGQLYISVLTDPTTGGVSASFAALGDIVIAEPGALIGFAGPRVIEQTI-RQ
ACCD_DESAP        IGRLDS---AGLLYVSVLTDPTMGGVSASFAFLGDIILAEPGALIGFAGPRVIEQTI-RQ
ACCD_CARHZ        VNRLNA---EKIFYLVVMTDPTTGGVSASFAALGDIILAEPGALIGFAGPRVIEQTI-RQ
ACCD_HELMI        LTRLSK---AGLPFFSVLTDPTTGGVTASFAMLGDLIIAEPGALIGFTGPRVIEQTI-RQ
ACCD_DESHD        LGRLAE---EGLLYISVLTDPTFGGVTASYASLGDIHIAEPGALIGFTGPRVIKQTM-RK
ACCD_HALOH        IKRLNK---AGILYVSVMTDPTSGGVTASFASLGDIIIAEKGALIAFAGPRVIKQTI-ST
ACCD_ALKOO        LGRLGE---AGLLYISVLTDPTTGGVTASFAMLGDIIIAEPGALIGFAGPRVIEQTI-RQ
ACCD_PEPD6        LSKLEE---KSLPYISVLTDPTTGGVTASFAMLGDIIISEPNTLIGFAGPRVIEQTI-NQ
ACCD1_EUBE2       IEKFKD---AGGLFISYLTNPTTGGVSASFASLGDIIIAEPGALICFAGPRVIEQTI-GQ
ACCD_FUSNN        VKKMRL---AGLPFISVPVNPTTGGVTASFAMLGDIIISEPKARIGFAGPRVIEQTI-RQ
ACCD_SYNWW        LGKFNQ---AGLLYISLLTHPTTGGVSASFASLADIILAEPGALIGFAGPRVIKQTI-GQ
ACCD_CLOB6        LAKLDE---EGLLYICVLTDPTTGGVTASFAMLGDIILAEPDALIGFAGKRVIEQTI-NE
ACCD_CLOK5        ISRLNE---EGLLYLSVLTDPTTGGVTASFAMIGDIILAEPGALIGFAGKRVIEQTI-KQ
ACCD_CLOAB        LAKHNE---AGLLYVSVLTDPTTGGVTASFAMLGDIILAEPKTLIGFAGRRVIEQTI-NQ
ACCD_CLONN        IARHNE---AGLLYIPVLTDPTTGGVIASFAMLGDIILSEPGTLIGFAGRRVIEQTI-KQ
ACCD_CLOPE        IYRHGR---ENLLYITVLTNPTTGGVTASFAMEGDIILSEPGCLVGFAGRRVIEGTI-NE
ACCD_CLOBA        LARHDE---KGLLYITILTDPTTGGVTASFAMEGDIILSEPNTLVGFAGRRVIENTI-NE
ACCD_CLOCE        VKRHSN---NGNLYVAVLTDPTTGGVTASFAMQGDIIVSEPDTLIGFAGPRVIEQTI-RR
ACCD2_EUBE2       AKRHSD---AGLLYVVCTTDPTMGGATASFAMLGDIIISEPGAMIGFAGKRVVEQVT-GE
ACCD_LACLM        VKRHSN---AGLFYITVLTDPTTGGVTASFASLGDIILAEPQSLIGFAGRRVIEQTV-RQ
ACCD_STRDG        VKRHSN---AGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVIETTV-RE
ACCD_ENTFA        LQRHNK---AGLLYLTVLTDPTTGGVTASFAMDGDIILAEPQSLIGFAGRRVIEQTI-RQ
ACCD_LACBA        VARHSQ---AGLLYIVVLCDPTTGGVTASFAMQGDLILAEPHALVGFAGRRVIEQTI-HQ
ACCD_LACH4        VAEHSA---AGLLYIVVLCDPTTGGVTASFAMDGDIILAEPHALVGFAGRRVIEQTI-MQ
ACCD_PEDPA        VARHSA---EGLLYIAVITDPTTGGVTASYAMQADIIISEPKTLIGFAGRRVIEQTI-NQ
ACCD2_LACPL       VANHRK---AGLLYITILTDPTTGGVTASFAMQGDIMLSEPRALIGFAGRRVIEQTI-QQ
ACCD_LACP3        VKAHSN---AGLLFISVLTDPTMGGVTASFAMQGDITLAEPHSLIGFAGRRVIEQTI-NQ
ACCD_OENOB        VNRHRQ---AGLLYIVVLTDPTTGGVIASFAMEADITIAEPKALIGFAGRRVIEQTV-KQ
ACCD_LEUMM        VAAHQE---AKLLYLVVLTDPTTGGVTASFAMQGDVTLAEPHALVGFAGARVIESTI-HE
ACCD_LACF3        IAEHDA---AGLLYIVVLTDPTTGGVTASFAMEGDVILAEPRALVGFAGRRVIEQTT-HT
ACCD_LACRJ        INEHAA---AGLLYIVVLTDPTTGGVTASFAMDGDIILAEPHALVGFAGRRVIEQTI-HQ
ACCD_LACS1        VKEHSN---AGLLYITVITDPTTGGVTASFAMQGDIILSEPRALLGFAGKRVIEQTI-HQ
ACCD_LACSS        VKQHAE---QGLLYISLLTDPTTGGVTASFATEADIILAEPKAVIGFAGRRVIEQTM-HE
ACCD_LACDA        INRHKA---AGLLYLVVLTDPTTGGVTASFASEGDITLAEAHAMVAFAGRRVIEQTI-HE
ACCD_ACHLI        LNLLDE---KGLVYISVMTNPTTGGVAASFASLGDINIAEKSSLIGFAGARVIKQTI-GQ
ACCD1_LACPL       LARLAA---TPLPLITVLTDPTMGGVSASFAFKGDLIIAEAGAKIGFAGARVIQQTL-PV
ACCD_TREDE        AAELDE---KGVPLFIMLCDPTTGGVTASFAMLGDITAAEPGALIGFAGPRVIEGTI-RQ
ACCD_PARUW        LAKLHE---ARIPYISVLTNPTTGGVTASFASLGDIIVAEPNALICFAGPRVIEQTI-GQ
ACCD_GEOBB        LAKLRE---AGLPFVSILTDPTTGGVTASFAMLGDINMAEPKALIGFAGPRVIEQTI-RQ
ACCD_PELPD        LAKLKD---AGLPFISILTDPTTGGVTASFAMLGDINIAEPKALIGFAGPRVIEQTL-RQ
ACCD_PELCD        LSRLKE---AGLPYISIMTDPTTGGVTASFAMLGDVNMAEPRALIGFAGPRVIEQTI-RQ
ACCD_UNCTG        LAKLAD---NRLAFISILTDPTTGGVAASYAMLGDINIAEPKALIGFAGPRVIEQTI-RQ
ACCD_AMOA5        LLQLAK---ARIPYISLLTDPTTGGVTASFAMLGDFNIAEPGALIGFAGPRIIRDTI-GR
ACCD_GRAFK        LAQLAD---AKIPYISLATDPTTGGTTASFAMLGDINISEPGALIGFAGPRVVKDTT-GK
ACCD_FLAB3        LAQLSE---EGLLYIAYLCDPTFGGITASFAMTADIIMAEPGALIGFAGPRVIRETI-GK
ACCD_PEDHD        LALLSQ---AKIPYISLLTDPTTGGVTASYAMLGDINIAEPGSLIGFAGPRVIKETI-KK
ACCD_CHLL7        LTRLGE---NRLPFISLMTDPTMGGISASFAMLGDLNISEPKALIGFAGPRVIRDTI-KR
ACCD_PROA2        LSQLSA---RGIPYISLMTNPTMGGTSASYAMLGDINISEPKALIGFAGPRVIRDTI-KR
ACCD_SALRD        LTRLDE---AGLPFISILTHPTTGGVTASFAMLGDIHIAEPDALIGFAGPRVIRETI-GS
ACCD_HYDS0        VDIMHK---NGIPFITVLTNPTTGGVSASFAFLGDVIIAEPKAIIGFAGARVIEQTI-KQ
ACCD_SULSY        IDRLNK---AGILYISVLTDPTMGGVSASFAFLGDIIIAEPESLIGFAGPRVIEQTI-RQ
ACCD_ECOLI        LAKMQE---RGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTV-RE
ACCD_PROMH        LAKMQE---RGLPYISVMTDPTMGGVSASLAMLGDINVAEPKALIGFAGPRVIEQTV-RE
ACCD_BLOFL        LAVLYD---RCLPYISVLTNPTMGGVSASLGMLGDINIAEPKALIGFAGPRVIEQTV-RE
ACCD_BLOPB        LANLHE---RCLPYISVLTNPTMGGVSASLAMLGDLNIAEPKALIGFAGPRIIEQTV-RE
ACCD_WIGBR        LSKLRK---KKIPYISVMTDPSMGGVSASIAMLGDINIAEPKALIGFAGPRVIEQTV-RE
ACCD_PASMU        LAKMRE---QGVPFISVLTDPTLGGVSASFAMLGDINIAEPKALIGFAGPRVIEQTV-RE
ACCD_IDILO        LARMSE---EGLPFISILTDPTMGGVSASLAMLGDIHIAEPKALIGFAGPRVIEQTV-RQ
ACCD_PSEHT        LAKMTE---KGLPFISVMTDPTMGGVSASLAMLGDINVGEPKALIGFAGPRVIEQTV-RE
ACCD2_VIBCB       LDHLSR---VGLPYISVLTDQTFGGVSASIAMMGDINIGEPEARIGFAGRRVIEQTV-RE
ACCD_VIBVU        LERLSA---KGLPFISVMTDPTMGGVSASLAMLGDINIGEPKALIGFAGRRVIEQTV-RE
ACCD_ALCBS        LEKMRQ---AGLPFISVLTDPVYGGVSASLAMLGDVNVAEPNALIGFAGPRVIEQTV-RQ
ACCD_CHRSD        LEKLKQ---EGVPYISVLTDPVFGGVSASLAMLGDINVAEPNALIGFAGPRVIEQTV-RE
ACCD_HAHCH        LEVMKQ---RGLPYISVMTDPVFGGVSASLAMLGDLNVAEPNALIGFAGPRVIEQTV-RE
ACCD_MARHV        LEKLKQ---EGIPYISVMTDPVFGGVSASLAMLGDLNIAEPYALIGFAGPRVIEQTV-RE
ACCD_CELJU        IERLKM---QGTPYVSVMTDPVYGGVSASLALLGDINVAEPGARAGFAGPSIIEQTI-RQ
ACCD_PSEF5        LARLRE---EGIPFISVLTDPVYGGVSASLAMLGDVIVAEPKALVGFAGPRVIEQTV-RE
ACCD_METCA        LGRLSK---ARIPFISVLTDPTMGGVSASFAMLGDINIAEPGALIGFAGPRVIEQTV-RE
ACCD_HYDCU        LGHLRA---NKLPFISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTV-RE
ACCD_ALKEH        LARLSE---EGVPFVSVLTDPTMGGVSASLAMLGDLVVAEPGALIGFAGPRVIEQTV-RE
ACCD_HALHL        ISRLNE---ARVPYISVLTDPTMGGVSASLATLGDVIIAEPGALIGFAGPRVIEQTV-RE
ACCD_BURCA        LTKLAE---AKLPFISVLTDPTMGGVSASFAFLGDVVIAEPKALIGFAGPRVIEQTV-RE
ACCD_DECAR        LTKLSA---AGLPFISILTDPTMGGVSASFAFVGDVVIAEPKALIGFAGPRVIEQTV-RE
ACCD_METFK        LTRLSK---AGLPYISVLTDPTMGGVSASFAMLGDVIIAEPQALIGFAGPRVIEQTV-RE
ACCD_XANAC        LGRLRE---AGLPYISVLTHPTTGGVSASFAMLGDINIAEPHALIGFAGPRVIEQTV-RE
ACCD_COXBU        LARLAE---YKLPYISVLTDPTMGGVSASLAMLGDVIIAEPNALIGFSGPRVIEQTI-RQ
ACCD_PSYA2        IERLRI---AGIPYVVVLTNPVYGGVTASLAMLGDIHLAEPKAMIGFAGKRVIEQTV-RE
ACCD_PSYWF        IERLRL---AGIPYIVVLTNPVYGGVTASLAMLGDIHIAEPKAMIGFAGKRVIEQTV-RE
ACCD_ACIB5        IQKLKD---AGLPYIVVLTHPVYGGVTASLAMLGDIHIAEPKAMIGFAGKRVIEQTV-RE
ACCD_PELUB        INELKK---NNLPYIVVLTDPTAGGITASYAMLGDLHLAEPGALIAFAGARVIQGTV-RE
                                .        .*  **    .*    *      *:*   :.      

ACCD_AGRVS        KLPEGFQTSEYLLEHGMVDMVVKRHDIPATLARTLKILTKQPA-----------------
ACCD_LIBAP        KLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ-----------------
ACCD_BARBK        TLPEGFQSSEYLLEHGMVDMVVSRLDMKATIAKILRLMMKFPA-----------------
ACCD_RHILO        KLPDGFQRSEYLMEHGMVDMVVSRLEMRQTIARLLKMLLKMPG-----------------
ACCD_AZOC5        KLPDGFQRSEYLFEHGMIDMVVHRHQMRETLARVCRLMMKAPG-----------------
ACCD_RHOPB        KLPEGFQRAEYLKEHGMIDMVVHRHDLKATLARLCRLLTKAPMPEVIVESEPEPEPEPVV
ACCD_BEII9        HLPEGFQRAEYLQAHGMVDMVVRRHDLPAVLARLCAFLTNSPR-----------------
ACCD_METC4        KLPDGFQRAEYLREHGMVDQVVHRHQLKETISRLCGLLMDVRR-----------------
ACCD_CAUSK        TLPPGFQRSEYLVEKGMVDRVTPRKELPAVLGSILGTLM---------------------
ACCD_PHEZH        TLPPGFQKSEFLVERGMIDQVVRRADLPEVLGSVLKTLM---------------------
ACCD_HIRBI        KLPEGFQRAEFLRERGMVDMVVDRRDLPAKLGQILSMLMGGKP-----------------
ACCD_HYPNA        SLPKGFQRSEFLREKGQVDIVVDRRKLKATVARVLGHLL---------------------
ACCD_MARMM        KLPEGFQRAEYLLEKGMVDKVVHRADIPATLARMLRVLM---------------------
ACCD_ERYLH        QLPDGFQRAEYLHKHGMVDRVVHRHQLKHELATLLGYLQ---------------------
ACCD_NOVAD        KLPEGFQRAEYLHAHGMIDMVTHRRDLKTTLAQVIDFLM---------------------
ACCD_DINSH        KLPEGFQRAEYLLDHGMLDRVTHRMKLRDELIRITRMLLGLGPAIV------------GD
ACCD_GLUDA        KLPEGFQRAEYLLDHGMIDMVVKRPALPEMLGRLIGLMNHRHV-----------------
ACCD_GLUOX        KLPEGFQRSEYLREHGMVDIVAKRSELPELLGRILGIMMRQKT-----------------
ACCD_GRABC        KLPEGFQRAEFLLEHGIVDMVVRRADMRATLSRVIALLTEGVT-----------------
ACCD_METI4        ELPPGFQTAEFLLEKGLIDKIVHRKELRSTLKQLLYFLT---------------------
ACCD_OPITP        TLPPGFQTSEFLLKHGLIDQIVPRTEMRERLHQILLALYVKQTPASASVAKS--------
ACCD2_ROSCS       KLPADFQTAEFMLQHGMVDMVTPRSELHGVLAKLLRLYAAEGRSGAYSSEAVAPTLASI-
ACCD1_ROSS1       KLPVHFQTAEFLLDHGMIDMVTPRSELRGVLSTLLRLYRDAFAHTSAAQHVPALTHVQG-
ACCD_CHLAD        KLPAGFQTAEFMLEHGMIDMVVPRSEMRETLARILKHYQQRQAPAAKADLAARRATLPQP
ACCD_HERA2        KLPPNFQTAEFFLEHGMIDAVVPRSDMRATIGRLLRLYQRPTSSADHREHVVAGHQ----
B9L1K0_THERP      KLPPGFQTAEFALEHGMVDMVVPRQRIRAVLASLIRTLAGSSLVPLAGDTMRQEVGE---
ACCD_RUBXD        RLPEGFQTAEFQREHGMVDRIVHRLALKGDLERLLGFVG---------------------
ACCD_THET2        ELPEGFQRSEFLLKHGMVDRVTDRRRLKEELVRVLRHLHPGVAYAPGV------------
ACCD_WOLSU        DLPEGFQTAEFLLEHGLIDMITPRKEMKKTLGDLLRFFNPYDENPCLLHL----------
ACCD_RHOBA        ELPEGFQTSEFLLEHGYIDRIVHR---KSLKTEIATAIDYCGK-----------------
ACCD_SORC5        TLPAGFQRSEFLLDHGMVDAIVPR---PEMKAYIGTLLQHLTAGRRARR-----------
ACCD_HELSJ        ELPEDFQTSESLLHHGLIDAIVPRCFLVNAISEVASIFAYAPSKYKKLGNISHYHENTLS
ACCD_CYACA        KLPPNFQSAEYLLDNGFVDLIVKRKQLKKTIHMILDLHN---------------------
ACCD_CUSGR        TIPEEEQEAEALFEKGFFDLIVPRHLLKNVISELLNLHAL--------------------
ACCD_BRANA        AVPEGSQAAESLLRKGLLDAIVPRNPLKGVVSELFQLHAFFPLNKNEIK-----------
ACCD_CUCSA        EVPEGSQKTEPLFEKGLLDLIVPRNPLKDVVSELFQLHAFVPSNQNSIK-----------
ACCD_CALFG        TVPDGSQAAEYSFHKGLFDPIVPRNPLKGVLNELFRLHGFFPLNQNSSRALGSVICSEL-
ACCD_RANMC        TVPDGSQEAEYLFQKGLFDLIVPRNLLKGVLSELFQLHGFFPLNKNFIK-----------
ACCD_COFAR        TVPEGSQAAEYLFQKGLFDLIVPRNLLKSVLSELFKFHAFVPLNQNETEH----------
ACCD_LACSA        TVPEGSQAAEYLFQKGLFDLIVPRNPLKSVLSELFQLHTFFPLNQN--------------
ACCD_SPIOL        TVPEGSQAAEFLFHKGLFDPIVPRNLLKGVLSELFELHAFFPLNQNKGED----------
ACCD_GOSBA        TIPEGSQAAEYLFHKGLFDPIVPRNPLKGVLSELVQLHGFFPLNQYSIK-----------
ACCD_FAGEA        TVPEGSQEAEYLFDKGLFDPIVPRNPLKGVLSELFRLHAFFPLNQNSIGQ----------
ACCD_PHAAO        TVPDGLQVAEYLFHKGLFDPIVPRNPLKGVLNELFQLHGFLPLNQD--------------
ACCD_SOYBN        AVPEGSQAAEYLFHKGLFDSIVPRNLLKGVLSELFQFHNFFSLTKNDKA-----------
ACCD_LOTJA        AVPEGSQAAEYLFHKGLFDSIVPRNPLKGILSELFQLHAFFPLIQNEKESRS--------
ACCD_CICAR        EVPEGSQSAEFLFEKGLFDSIVPRNLLKEVLGELFQFHGFFPLTQNGN------------
ACCD_EPIVI        IVPEGSQAAEYLFQKGLFDLIIPRNLLKSVLGELFKLHAFFPLN----------------
ACCD_CUSRE        TIPNDSQEAEFLFHKGLFDLIIPRHLLKSVISELFTLHDLFPLNQNSNQYSQYRALLNPI
ACCD_IPOPU        TVPEGSQEAEYLFEKGLFDLIVPRHLLKSVLSELFEFHALFPLNQNSNQVEC--------
ACCD_MARPO        KIPDGFQVAESLFDHGLLDLIVPRNLLKGVLSEIFELYNAAPCKKFQNSFFK--------
ACCD_PINTH        KVIEDFQVTEHLFGHGLFDLIVPRNLLKGVLSELFWFYVLRSSL----------------
ACCD_AMBTC        KIPDGLQVAEYSFHKGLFDSIVPRNPLKGVPSELFQLHGFFSSTFHPLKSNKVKR-----
ACCD_PEA          EVPEGSQSADLLFDRGLLDAVVPRHLLKEFLTELFQFHGFVPLT----------------
ACCD_OENEH        EVPEGSQTAEYLFDKGLFDQIVPRNPLKGSLSELFNFHGFVTLNSQVINIYNYLYS----
ACCD_ACAM1        KLPDDFQTAEYLLSHGFVDAIVPRPELKRTLAQLIRIHAQ--MPMASDVS--PAAVPVAA
ACCD_NOSS1        KLPDDFQTAEDLLKHGFVDDIVPRTQLKNTLSQLIALHQP--VPTTPPMVLWETMSLSST
ACCD_SYNE7        KLPDDFQTAEYLQAHGFVDTIVPRTQLKKTLAQLIRLHQP--QSPEMKLPLLESSSPATA
ACCD_SYNY3        KLPDDFQTSEYLLHHGFVDAIVPRPQLKRTLAQLISLHQP--FYP-ILPPLNADSNQVNP
ACCD_SYNP2        KLPDDFQTSEYLLQHGFVDAIVPRTELKKTLAQMISLHQP--FHP-ILPELQLAPHVEKE
ACCD_TRIEI        KLPENFQTSEYLLKHGFIDAIVPRTQLKKTLVKLIRLHKPHSLTLISDESLETGPHCHLP
ACCD_PROM1        KLPDNFQTAEYLQDHGFVDTIVPRTELKETLAKILRLHKT------------QEVKLQTN
ACCD_SYNR3        KLPDNFQTAEYLQDHGFVDAIIPRTQLRSRLASLLQMHQQ------------PAAVSA--
ACCD_CHLVU        QLPDDFQTAEYLLHHGLLDLIVPRSFLKQALSETLTLYKEAPLKEQGRIPYGERGPLTKT
ACCD_PORPU        DLPDNFQSSEYLFEHGFLDLIVPRTQLRSKLIQILHLHTNNN------------------
ACCD_GLOVI        KLPEGFQTAEFLLKHGFVDRIVERAQLRPTLARILRLHGV---GQVQAYRPSPQASLAQE
ACCD_SYNJB        KLPEGFQTAEYLLAQGLIDAIVPRTELRKRLAQLLSMHRP---RLHMSLPSIDSEALTLQ
ACCD_STAAC        KLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIH--QEVTK---------------
ACCD_STACT        KLPDDFQTAEFLLEHGQLDKVVHRKEMRSTLESILKMHAGQEVNKDA-------------
ACCD_MACCJ        KLPDDFQTAEFLLDHGQLDKVVHRKEMKEVLTTILKLHQRGEN-----------------
ACCD_BACLD        ELPEDFQTAEFLLKHGQLDSVVHRADMKKTLGSILKMHQTGGDLEWLEN-----------
ACCD_GEOKA        ELPDDFQTAEFLLKHGQLDAVIHRHELKETLAVVLDLHQKGGEEGWWRN-----------
ACCD_BACHD        ELPNDFQTAEFLLKHGQLDRVIPRSEMKDTLTKILDIHHVS-------------------
ACCD_OCEIH        KLPSDFQTAEFQLHHGQVDKVIHRQDMNDTLGKLLKMHMDGRQLK---------------
ACCD_LISIN        ELPEDFQTAEFLLKHGQLDDCISRLDLKNKLSFILKIHVKTPEAGGESDGE---------
ACCD2_LYSSC       KLPNDFQTAEFLLEHGQLDAIFPRKDLRKQVSLLVKMHTKGGVQHV--------------
ACCD_EXIS2        KLPEDFQTSEFLLQAGQLDDVVSRHDLKTYYTRILMMHSEETNHATI-------------
ACCD_EXISA        KLPENFQTAEFLLESGQLDAVIHREQMRSFLKKMIELHDGGVRHV---------------
ACCD_BREBN        ELPKDFQTAEFLLKNGQLDMVVHRKDMRNTLSKLVEMHTSREGVETWQASSPLKSH----
ACCD_PAESJ        KLPDNFQTAEFNMQHGQLDLVVHRKDMKTTLGKLLDMHTVREGLSHGG------------
ACCD_DESRM        KLPEGFQRAEFLRKHGMVDMIVNRPQLKDTLANILSLHGTN-------------------
ACCD_PELTS        KLPEGFQRAEFLKQHGFVDMIVPRPQMKETLARLLDLHLRGEK-----------------
ACCD_DESAP        KLPDGFQQAEFLQEHGFVDAVVPRSRLKDTLIKIIGMHQAG-------------------
ACCD_CARHZ        KLPEGFQRAEFLEQHGFIDAVVSREQQKEVITKLLAWHSQK-------------------
ACCD_HELMI        KLPEGFQRSEFLQKHGMVDIIIERPKMREQLAALLALHCGNSLEGVES------------
ACCD_DESHD        ELPEGAQTAEFNQSHGQIDCVVERAEMRKVLGRLLRYHQEGAV-----------------
ACCD_HALOH        KLPEGFQRAEFLLDHGMVDMVLSRHEIRDELAKILKIHQIGVVSNGG-------------
ACCD_ALKOO        KLPEGFQRSEFLLEKGFIDQIVSRKDMRNTLASLLRIHRLGGEMHA--------------
ACCD_PEPD6        KLPEGFQTSEFLLEKGFIDMIVDRRKMKEVLYQILAMHKK--------------------
ACCD1_EUBE2       KLPEGFQHSEFLLEHGMIDMIVDRKDMKQTLSKILKMHVNTGGEA---------------
ACCD_FUSNN        KLPENFQKSEFLQECGMVDVIAKREDLKATIFKVLNDII---------------------
ACCD_SYNWW        QLPPRFQRSEFLLEHGMIDLLVERSQLKATLSSLLGLHQG--------------------
ACCD_CLOB6        KLPEDFQKSEFLLEHGFIDKIVPRSDLRKVLAKLINMHKNSF------------------
ACCD_CLOK5        KLPEGFQKAEFLLQHGFIDNIVSRENLKETLRKILVIHGRGN------------------
ACCD_CLOAB        KLPSDFQTSEFLFKHGFIDMIVERKELKVTLGNILRMHS---------------------
ACCD_CLONN        KLPDDFQSAEFLLEHGFLDKIVNRNELKKVLYKILELH----------------------
ACCD_CLOPE        KLPDDFQTAEFLLEKGFIDKIVQRKDLKQVITSLLRMHEVD-YE----------------
ACCD_CLOBA        TLPESFQKSEFLLEKGFIDSIVERKNMRAYLYKILILHGVNKYE----------------
ACCD_CLOCE        SLPDGFQRAEFLMERGFLDSIVGRNELKKYLGNILMLHNVEAR-----------------
ACCD2_EUBE2       VLPDNFQSAEFQLKNGFIDDIVPRQEQRAYLANILAIHAETVSA----------------
ACCD_LACLM        TLPDDFQKAEFLLNHGFVDAIVKRTELRQKLALLLELHTEVENV----------------
ACCD_STRDG        NLPDDFQKAEFLQDHGFVDAIVKRTELRDKVAHLVAFHGGGQ------------------
ACCD_ENTFA        ELPDDFQKAEFLLEHGFVDQIVPRNLLRQRLSDLLRLHSLEGWR----------------
ACCD_LACBA        TPPADFQRAETVLQHGFIDAIVARPQLKQRLADLLRLHKGES------------------
ACCD_LACH4        TPPKDFQSAETVMKHGFIDQIVKRSDMKKTLTQLLRLHTKENAYG---------------
ACCD_PEDPA        KPPKDFQQAETLLKNGFLDDIVERPNLKEYLNNLLNLHSDK-------------------
ACCD2_LACPL       TPPADFQRAETLLANGWLDQIVPRPALRKTLQRLLTITQGGHQDV---------------
ACCD_LACP3        KLPQNFQRAETLLQSGFIDAVVQRQDQPSYLGDLLALHTA--------------------
ACCD_OENOB        KLPADFQSAEQLQKNGFVDEIVPREHLTEELKLLLDMNQSNAWRANHDK-----------
ACCD_LEUMM        KLPKDFQRVETLLENGFVDQIVPRSELAQLIAKIVRLHTAEAE-----------------
ACCD_LACF3        EIPADLQDAENVLKHGFIDHIVTRQDEKTTLAWLMKYGGKQND-----------------
ACCD_LACRJ        QIPIDLQSAENILHHGFIDRIVKRQDEKKLLEWLLKTGSVANE-----------------
ACCD_LACS1        KVPDDLQDAETVLKNGFIDNIIKREDQKEKLAWLVKIHSMKGAF----------------
ACCD_LACSS        QIAPDLQDAETVLKNGFIDQIVARQDQKKVLHQLLKLHERGAHY----------------
ACCD_LACDA        QLPKDAQRAETVLKHGFIDRIVLRQEEKETLAWLLKYGGMQDD-----------------
ACCD_ACHLI        DLPAGFQTDAFQLQKGQVDLVVLRSQLKKTLSTLLKLHAKKVTS----------------
ACCD1_LACPL       KLPADFQTADQLFKNGMVDAVVERPQLRSTLGQALVNYGIGRSAHG--------------
ACCD_TREDE        QLPEGFQRAEFQLEKGFVDCIVPRQEQRQFFARMID---------------AHSLGLKET
ACCD_PARUW        RLPPGAQKSEFLLEHGMIDCIVKRPELKQKLAELIDFLKGNFSEENEPSPPPKNLIKKTS
ACCD_GEOBB        KLPQGFQRSEYLLDHGMVDVIVERSKMKSQLSSILTMLYRP-------------------
ACCD_PELPD        KLPDGFQRAEYLLEHGMLDVIVPRTEMRAKLASILGILYRPAA-----------------
ACCD_PELCD        KLPEGFQRSEYLLEHGMIDMIVRRPEMKARLSQMLRIFMKQ-------------------
ACCD_UNCTG        QLSEEFQRSEFLEKHGMVDIVVERKNIRDVLTKALTFFYNRQCFLKF-------------
ACCD_AMOA5        DLPKGFQTSEFLLEHGFLDFIVDRRMLKATLTKLLTMLANN-------------------
ACCD_GRAFK        DLPKDFQTSEFLKEKGFLDFITKRSELKNKINLYLDLIQNQPVRA---------------
ACCD_FLAB3        DLPEGFQTSEFLQEKGFVDFIVKRTEIKEKVSKTVKLLVH--------------------
ACCD_PEDHD        DLPKGFQTAEFVLEHGFLDFIVDRRAMKAKLAAFLKMMKN--------------------
ACCD_CHLL7        DLPEGFQRAEFLQEHGFVDMIVHRKELKQRLAKTLAMMRVEG------------------
ACCD_PROA2        DLPEGFQRAEFLLEHGFLDCIVHRRDLKHRLSQILGHLSS--------------------
ACCD_SALRD        DLPEGFQKSEFLQEHGFVDMIVDRRRLRRRIIRLLNLLME--------------------
ACCD_HYDS0        QLPEDFQTSEFLLKKGMVDMVVHRHLMKQTLKNLLNLLFYKNA-----------------
ACCD_SULSY        QLPEGFQRAEFLLEKGQIDMVVDRKNLKKTIYTLIRHTHG--------------------
ACCD_ECOLI        KLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPE--APREGVVVPPV
ACCD_PROMH        KLPAGFQRSEFLLEKGAIDMIVRRPEMRDELAELLAKLTQYDLAKDEDELLGEEMIADDI
ACCD_BLOFL        KLPLGFQRSEFLLEKGVIDLIVRRPDMRLKIANLLSKLTQQSFSEK--------------
ACCD_BLOPB        KLPLGFQRSEFLLEKGSIDLIIRRPDLRFKVAGLLAKLTQQPIPKVDYRHCVE-------
ACCD_WIGBR        KLPDKFQKSEFLIQKGIIDLIIKRKNMRFSIGKLLAKITNKPEPKKE-------------
ACCD_PASMU        KLPEGFQRSEFLLEKGAIDMIVKRADMRHTLASVLSKLSNKPSPFVEPELVENEEQSKSD
ACCD_IDILO        TLPEGFQRAEFLLEHGAIDMITDRRDMRDTVARLLAKMQNLPST----------------
ACCD_PSEHT        TLPEGFQRSEFLLEHGAIDMIIDRREMRDTLARILAKFMNLPST----------------
ACCD2_VIBCB       KLPDGFQQSEFLLEHGALDMIVERSDMRRKIGGLIAKLTNKSIQ----------------
ACCD_VIBVU        DLPEGFQRSEFLLEHGAIDMIVDRREMRQRVGGLIAKLTNHKSPLVVSVNDSPNEAAYSV
ACCD_ALCBS        KLPEGFQRSEFLLEHGAIDMIVSRHDMRETLYRLLANMMGWPPLALDD------------
ACCD_CHRSD        QLPEGFQRSEFLLEHGTVDMIVHRHDMRERLGSVMRKLTHQPHQDRDAEPDDTASQSTLD
ACCD_HAHCH        KLPEGFQRSEFLLEHGALDMILSRNQLRRRLSMLISKMMKLPEPEFENEEELEEEEMERP
ACCD_MARHV        KLPEGFQRSEFLLEHGAIDMILHRHQMRERIAHLLAKFTAQEKPGTEAPIEFEVTEKPDV
ACCD_CELJU        KLPKGFQRAEFLLEHGAIDMIIHRGEMRDKLASLLAKFTRRAAV----------------
ACCD_PSEF5        KLPEGFQRSEFLLEHGAIDMIISRQELRPRLGNLLAQLMGLPTPEFVAA---PVEPIVVP
ACCD_METCA        KLPEGFQRSEFLLEHGAVDMIVDRRDLRERIAALLALMTRDGRAVAPAAAKAPPAIGEGA
ACCD_HYDCU        KLPEGFQRSEFLLEHGAIDRIIHRHNLSDELASICRMLLQKSA-----------------
ACCD_ALKEH        TLPEGFQRAEFLLEHGAIDQIIDRREMADRLHRILAMLTHQPAAEAADAPEAG-------
ACCD_HALHL        TLPEGFQRAEFLLDHGAIDMIVDRRDMRDEIASLMGKLGGDVSVAPAPAPAATVDPEPES
ACCD_BURCA        KLPEGFQRAEFLLKTGAIDMIVDRRKMRDEIAQLLALLQRQPADALA-------------
ACCD_DECAR        TLPEGFQRSEFLLEKGAIDMIVDRRELRDQVARVLALLQKLPAAA---------------
ACCD_METFK        TLPEGFQRSEFLLEHGAIDMIVDRREMRDKLATLMTSFMRVPAGAA--------------
ACCD_XANAC        TLPEGFQRSEFLLDHGTIDQICDRRQMRDRIAELTAMMMRQPHPQDADAA----------
ACCD_COXBU        TLPEGFQRSEFLLEHGAIDMVVDRRELKSTIASLITKLTHQPPPDLPVEESV--------
ACCD_PSYA2        TLEEPFQRAEFLLKHGVVDEVVHRHQMIDTIYRLLAKLCSVPNVDAQ-------------
ACCD_PSYWF        TLEEPFQRAEYLLEHGVIDQVVHRHQMNDTVYRLLAKLTHV-------------------
ACCD_ACIB5        TLEEPFQRAEYLLDHGVVDQIVHRHALRDTVSRLVSKLMNLP------------------
ACCD_PELUB        ELPEGFQRSEYVEKTGFVDLIVERKDLREKIGSLLSILLKKNSAINSSENETSEDSRALT
                        *        * .*    *                                    

ACCD_AGRVS        -TVVGANDDKTLSVIEASRAVSA-------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        -APEPSHAFSKDSQTQISKTKAA-------------------------------------
ACCD_RHILO        -EQKPLEPEILPPAVVAAEARPQA------------------------------------
ACCD_AZOC5        ---VPPKGRLPAPAAA--------------------------------------------
ACCD_RHOPB        AEIIPPTSDLPVSAPAPAPVAAQTPAPAAPSA----------------------------
ACCD_BEII9        --------RAPIPA----------------------------------------------
ACCD_METC4        ---TPQPGTAPEPTTPEPLPNAA-------------------------------------
ACCD_CAUSK        ----------MGRGLKAA------------------------------------------
ACCD_PHEZH        ----------MGRERLSPAA----------------------------------------
ACCD_HIRBI        LPEVEPIAVADVEELEAAEAEAAPDEVVEVEAPAVDEIVEEKPAATKAKPRSKAKSKAAP
ACCD_HYPNA        -PMSRRRDDRSTLQLTPPKTHAP------------------KPPEPKVKPD---------
ACCD_MARMM        ----KKPGTSMPAALTPPAPDHV-------------------VADGGSH-----------
ACCD_ERYLH        ----------PAEAA---------------------------------------------
ACCD_NOVAD        ----------AGKAAA--------------------------------------------
ACCD_DINSH        LPAPDPAPATPEPQKAAPSAPAQDKPGAGRS-----------------------------
ACCD_GLUDA        --------NAPGAALGGAAPVRPAA-----------------------------------
ACCD_GLUOX        --------VSDAAA----------------------------------------------
ACCD_GRABC        --------LPKVESVASLTEAKQPARTADA------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        IM----------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ------------------------------------------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        WATEEILRRNCINNKKVEYRTIEKIYQTTLYKESFFRLNKLLSKLKSEINFTNKMKKQNN
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        ------------------------------------------------------------
ACCD_BRANA        ------------------------------------------------------------
ACCD_CUCSA        ------------------------------------------------------------
ACCD_CALFG        ------------------------------------------------------------
ACCD_RANMC        ------------------------------------------------------------
ACCD_COFAR        ------------------------------------------------------------
ACCD_LACSA        ------------------------------------------------------------
ACCD_SPIOL        ------------------------------------------------------------
ACCD_GOSBA        ------------------------------------------------------------
ACCD_FAGEA        ------------------------------------------------------------
ACCD_PHAAO        ------------------------------------------------------------
ACCD_SOYBN        ------------------------------------------------------------
ACCD_LOTJA        ------------------------------------------------------------
ACCD_CICAR        ------------------------------------------------------------
ACCD_EPIVI        ------------------------------------------------------------
ACCD_CUSRE        F-----------------------------------------------------------
ACCD_IPOPU        ------------------------------------------------------------
ACCD_MARPO        ------------------------------------------------------------
ACCD_PINTH        ------------------------------------------------------------
ACCD_AMBTC        ------------------------------------------------------------
ACCD_PEA          ------------------------------------------------------------
ACCD_OENEH        ------------------------------------------------------------
ACCD_ACAM1        AVE---------------------------------------------------------
ACCD_NOSS1        AVE---------------------------------------------------------
ACCD_SYNE7        PL----------------------------------------------------------
ACCD_SYNY3        ELVLSHTALAVDNQISVNQDG---------------------------------------
ACCD_SYNP2        KVYEPIASTSTNDFYK--------------------------------------------
ACCD_TRIEI        FQAESHNLSTTDNKIQPTPQG---------------------------------------
ACCD_PROM1        A-----------------------------------------------------------
ACCD_SYNR3        ------------------------------------------------------------
ACCD_CHLVU        REEQLRRFLKSSKTPEYLHIVNDLKELLGFLGQTQTTLYPEKLEFLNNLKTQEQFLQKND
ACCD_PORPU        ------------------------------------------------------------
ACCD_GLOVI        QQ----------------------------------------------------------
ACCD_SYNJB        PML---------------------------------------------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        PKKKKA------------------------------------------------------
ACCD_PARUW        PLKDKN------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        P--DQEPEA---------------------------------------------------
ACCD_PROMH        ESSDNEPEINIETNKKEDV-----------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        NE----------------------------------------------------------
ACCD_IDILO        -EATEVSVNE--------------------------------------------------
ACCD_PSEHT        -EQEHRVA----------------------------------------------------
ACCD2_VIBCB       PEAE--------------------------------------------------------
ACCD_VIBVU        PEANEKG-----------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        EFSQADH-----------------------------------------------------
ACCD_HAHCH        EPPDNVE-----------------------------------------------------
ACCD_MARHV        DEPEGQ------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        PAPANL------------------------------------------------------
ACCD_METCA        GEADLARCLSALPMDDPEAE----------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ---EQPSEATDPVGEHWD------------------------------------------
ACCD_HALHL        AEPEAPAEEAGPAGAAGDQAGESQDEGDPRNA----------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        ------------------------------------------------------------
ACCD_PSYWF        ------------------------------------------------------------
ACCD_ACIB5        ------------------------------------------------------------
ACCD_PELUB        KAAS--------------------------------------------------------
                                                                              

ACCD_AGRVS        ------------------------------------------------------------
ACCD_LIBAP        ------------------------------------------------------------
ACCD_BARBK        ------------------------------------------------------------
ACCD_RHILO        ------------------------------------------------------------
ACCD_AZOC5        ------------------------------------------------------------
ACCD_RHOPB        ------------------------------------------------------------
ACCD_BEII9        ------------------------------------------------------------
ACCD_METC4        ------------------------------------------------------------
ACCD_CAUSK        ------------------------------------------------------------
ACCD_PHEZH        ------------------------------------------------------------
ACCD_HIRBI        KTDE--------------------------------------------------------
ACCD_HYPNA        ------------------------------------------------------------
ACCD_MARMM        ------------------------------------------------------------
ACCD_ERYLH        ------------------------------------------------------------
ACCD_NOVAD        ------------------------------------------------------------
ACCD_DINSH        ------------------------------------------------------------
ACCD_GLUDA        ------------------------------------------------------------
ACCD_GLUOX        ------------------------------------------------------------
ACCD_GRABC        ------------------------------------------------------------
ACCD_METI4        ------------------------------------------------------------
ACCD_OPITP        ------------------------------------------------------------
ACCD2_ROSCS       ------------------------------------------------------------
ACCD1_ROSS1       ------------------------------------------------------------
ACCD_CHLAD        ------------------------------------------------------------
ACCD_HERA2        ------------------------------------------------------------
B9L1K0_THERP      ------------------------------------------------------------
ACCD_RUBXD        ------------------------------------------------------------
ACCD_THET2        ------------------------------------------------------------
ACCD_WOLSU        ------------------------------------------------------------
ACCD_RHOBA        ------------------------------------------------------------
ACCD_SORC5        ------------------------------------------------------------
ACCD_HELSJ        AFNTSSVYANYYDVMLCNYNIGTHSLNLLFNEESEFCKYFPFNMDHMKKENRIKYNFITE
ACCD_CYACA        ------------------------------------------------------------
ACCD_CUSGR        ------------------------------------------------------------
ACCD_BRANA        ------------------------------------------------------------
ACCD_CUCSA        ------------------------------------------------------------
ACCD_CALFG        ------------------------------------------------------------
ACCD_RANMC        ------------------------------------------------------------
ACCD_COFAR        ------------------------------------------------------------
ACCD_LACSA        ------------------------------------------------------------
ACCD_SPIOL        ------------------------------------------------------------
ACCD_GOSBA        ------------------------------------------------------------
ACCD_FAGEA        ------------------------------------------------------------
ACCD_PHAAO        ------------------------------------------------------------
ACCD_SOYBN        ------------------------------------------------------------
ACCD_LOTJA        ------------------------------------------------------------
ACCD_CICAR        ------------------------------------------------------------
ACCD_EPIVI        ------------------------------------------------------------
ACCD_CUSRE        ------------------------------------------------------------
ACCD_IPOPU        ------------------------------------------------------------
ACCD_MARPO        ------------------------------------------------------------
ACCD_PINTH        ------------------------------------------------------------
ACCD_AMBTC        ------------------------------------------------------------
ACCD_PEA          ------------------------------------------------------------
ACCD_OENEH        ------------------------------------------------------------
ACCD_ACAM1        ------------------------------------------------------------
ACCD_NOSS1        ------------------------------------------------------------
ACCD_SYNE7        ------------------------------------------------------------
ACCD_SYNY3        ------------------------------------------------------------
ACCD_SYNP2        ------------------------------------------------------------
ACCD_TRIEI        ------------------------------------------------------------
ACCD_PROM1        ------------------------------------------------------------
ACCD_SYNR3        ------------------------------------------------------------
ACCD_CHLVU        NFFEELLTSTTVKKALNLACGTQTRLNWLNYKLTEFRIRPKF------------------
ACCD_PORPU        ------------------------------------------------------------
ACCD_GLOVI        ------------------------------------------------------------
ACCD_SYNJB        ------------------------------------------------------------
ACCD_STAAC        ------------------------------------------------------------
ACCD_STACT        ------------------------------------------------------------
ACCD_MACCJ        ------------------------------------------------------------
ACCD_BACLD        ------------------------------------------------------------
ACCD_GEOKA        ------------------------------------------------------------
ACCD_BACHD        ------------------------------------------------------------
ACCD_OCEIH        ------------------------------------------------------------
ACCD_LISIN        ------------------------------------------------------------
ACCD2_LYSSC       ------------------------------------------------------------
ACCD_EXIS2        ------------------------------------------------------------
ACCD_EXISA        ------------------------------------------------------------
ACCD_BREBN        ------------------------------------------------------------
ACCD_PAESJ        ------------------------------------------------------------
ACCD_DESRM        ------------------------------------------------------------
ACCD_PELTS        ------------------------------------------------------------
ACCD_DESAP        ------------------------------------------------------------
ACCD_CARHZ        ------------------------------------------------------------
ACCD_HELMI        ------------------------------------------------------------
ACCD_DESHD        ------------------------------------------------------------
ACCD_HALOH        ------------------------------------------------------------
ACCD_ALKOO        ------------------------------------------------------------
ACCD_PEPD6        ------------------------------------------------------------
ACCD1_EUBE2       ------------------------------------------------------------
ACCD_FUSNN        ------------------------------------------------------------
ACCD_SYNWW        ------------------------------------------------------------
ACCD_CLOB6        ------------------------------------------------------------
ACCD_CLOK5        ------------------------------------------------------------
ACCD_CLOAB        ------------------------------------------------------------
ACCD_CLONN        ------------------------------------------------------------
ACCD_CLOPE        ------------------------------------------------------------
ACCD_CLOBA        ------------------------------------------------------------
ACCD_CLOCE        ------------------------------------------------------------
ACCD2_EUBE2       ------------------------------------------------------------
ACCD_LACLM        ------------------------------------------------------------
ACCD_STRDG        ------------------------------------------------------------
ACCD_ENTFA        ------------------------------------------------------------
ACCD_LACBA        ------------------------------------------------------------
ACCD_LACH4        ------------------------------------------------------------
ACCD_PEDPA        ------------------------------------------------------------
ACCD2_LACPL       ------------------------------------------------------------
ACCD_LACP3        ------------------------------------------------------------
ACCD_OENOB        ------------------------------------------------------------
ACCD_LEUMM        ------------------------------------------------------------
ACCD_LACF3        ------------------------------------------------------------
ACCD_LACRJ        ------------------------------------------------------------
ACCD_LACS1        ------------------------------------------------------------
ACCD_LACSS        ------------------------------------------------------------
ACCD_LACDA        ------------------------------------------------------------
ACCD_ACHLI        ------------------------------------------------------------
ACCD1_LACPL       ------------------------------------------------------------
ACCD_TREDE        ------------------------------------------------------------
ACCD_PARUW        ------------------------------------------------------------
ACCD_GEOBB        ------------------------------------------------------------
ACCD_PELPD        ------------------------------------------------------------
ACCD_PELCD        ------------------------------------------------------------
ACCD_UNCTG        ------------------------------------------------------------
ACCD_AMOA5        ------------------------------------------------------------
ACCD_GRAFK        ------------------------------------------------------------
ACCD_FLAB3        ------------------------------------------------------------
ACCD_PEDHD        ------------------------------------------------------------
ACCD_CHLL7        ------------------------------------------------------------
ACCD_PROA2        ------------------------------------------------------------
ACCD_SALRD        ------------------------------------------------------------
ACCD_HYDS0        ------------------------------------------------------------
ACCD_SULSY        ------------------------------------------------------------
ACCD_ECOLI        ------------------------------------------------------------
ACCD_PROMH        ------------------------------------------------------------
ACCD_BLOFL        ------------------------------------------------------------
ACCD_BLOPB        ------------------------------------------------------------
ACCD_WIGBR        ------------------------------------------------------------
ACCD_PASMU        ------------------------------------------------------------
ACCD_IDILO        ------------------------------------------------------------
ACCD_PSEHT        ------------------------------------------------------------
ACCD2_VIBCB       ------------------------------------------------------------
ACCD_VIBVU        ------------------------------------------------------------
ACCD_ALCBS        ------------------------------------------------------------
ACCD_CHRSD        ------------------------------------------------------------
ACCD_HAHCH        ------------------------------------------------------------
ACCD_MARHV        ------------------------------------------------------------
ACCD_CELJU        ------------------------------------------------------------
ACCD_PSEF5        ------------------------------------------------------------
ACCD_METCA        ------------------------------------------------------------
ACCD_HYDCU        ------------------------------------------------------------
ACCD_ALKEH        ------------------------------------------------------------
ACCD_HALHL        ------------------------------------------------------------
ACCD_BURCA        ------------------------------------------------------------
ACCD_DECAR        ------------------------------------------------------------
ACCD_METFK        ------------------------------------------------------------
ACCD_XANAC        ------------------------------------------------------------
ACCD_COXBU        ------------------------------------------------------------
ACCD_PSYA2        ------------------------------------------------------------
ACCD_PSYWF        ------------------------------------------------------------
ACCD_ACIB5        ------------------------------------------------------------
ACCD_PELUB        ------------------------------------------------------------
                                                                              

ACCD_AGRVS        ---------------------
ACCD_LIBAP        ---------------------
ACCD_BARBK        ---------------------
ACCD_RHILO        ---------------------
ACCD_AZOC5        ---------------------
ACCD_RHOPB        ---------------------
ACCD_BEII9        ---------------------
ACCD_METC4        ---------------------
ACCD_CAUSK        ---------------------
ACCD_PHEZH        ---------------------
ACCD_HIRBI        ---------------------
ACCD_HYPNA        ---------------------
ACCD_MARMM        ---------------------
ACCD_ERYLH        ---------------------
ACCD_NOVAD        ---------------------
ACCD_DINSH        ---------------------
ACCD_GLUDA        ---------------------
ACCD_GLUOX        ---------------------
ACCD_GRABC        ---------------------
ACCD_METI4        ---------------------
ACCD_OPITP        ---------------------
ACCD2_ROSCS       ---------------------
ACCD1_ROSS1       ---------------------
ACCD_CHLAD        ---------------------
ACCD_HERA2        ---------------------
B9L1K0_THERP      ---------------------
ACCD_RUBXD        ---------------------
ACCD_THET2        ---------------------
ACCD_WOLSU        ---------------------
ACCD_RHOBA        ---------------------
ACCD_SORC5        ---------------------
ACCD_HELSJ        NSNDFIRKKTINDFSIMLIGD
ACCD_CYACA        ---------------------
ACCD_CUSGR        ---------------------
ACCD_BRANA        ---------------------
ACCD_CUCSA        ---------------------
ACCD_CALFG        ---------------------
ACCD_RANMC        ---------------------
ACCD_COFAR        ---------------------
ACCD_LACSA        ---------------------
ACCD_SPIOL        ---------------------
ACCD_GOSBA        ---------------------
ACCD_FAGEA        ---------------------
ACCD_PHAAO        ---------------------
ACCD_SOYBN        ---------------------
ACCD_LOTJA        ---------------------
ACCD_CICAR        ---------------------
ACCD_EPIVI        ---------------------
ACCD_CUSRE        ---------------------
ACCD_IPOPU        ---------------------
ACCD_MARPO        ---------------------
ACCD_PINTH        ---------------------
ACCD_AMBTC        ---------------------
ACCD_PEA          ---------------------
ACCD_OENEH        ---------------------
ACCD_ACAM1        ---------------------
ACCD_NOSS1        ---------------------
ACCD_SYNE7        ---------------------
ACCD_SYNY3        ---------------------
ACCD_SYNP2        ---------------------
ACCD_TRIEI        ---------------------
ACCD_PROM1        ---------------------
ACCD_SYNR3        ---------------------
ACCD_CHLVU        ---------------------
ACCD_PORPU        ---------------------
ACCD_GLOVI        ---------------------
ACCD_SYNJB        ---------------------
ACCD_STAAC        ---------------------
ACCD_STACT        ---------------------
ACCD_MACCJ        ---------------------
ACCD_BACLD        ---------------------
ACCD_GEOKA        ---------------------
ACCD_BACHD        ---------------------
ACCD_OCEIH        ---------------------
ACCD_LISIN        ---------------------
ACCD2_LYSSC       ---------------------
ACCD_EXIS2        ---------------------
ACCD_EXISA        ---------------------
ACCD_BREBN        ---------------------
ACCD_PAESJ        ---------------------
ACCD_DESRM        ---------------------
ACCD_PELTS        ---------------------
ACCD_DESAP        ---------------------
ACCD_CARHZ        ---------------------
ACCD_HELMI        ---------------------
ACCD_DESHD        ---------------------
ACCD_HALOH        ---------------------
ACCD_ALKOO        ---------------------
ACCD_PEPD6        ---------------------
ACCD1_EUBE2       ---------------------
ACCD_FUSNN        ---------------------
ACCD_SYNWW        ---------------------
ACCD_CLOB6        ---------------------
ACCD_CLOK5        ---------------------
ACCD_CLOAB        ---------------------
ACCD_CLONN        ---------------------
ACCD_CLOPE        ---------------------
ACCD_CLOBA        ---------------------
ACCD_CLOCE        ---------------------
ACCD2_EUBE2       ---------------------
ACCD_LACLM        ---------------------
ACCD_STRDG        ---------------------
ACCD_ENTFA        ---------------------
ACCD_LACBA        ---------------------
ACCD_LACH4        ---------------------
ACCD_PEDPA        ---------------------
ACCD2_LACPL       ---------------------
ACCD_LACP3        ---------------------
ACCD_OENOB        ---------------------
ACCD_LEUMM        ---------------------
ACCD_LACF3        ---------------------
ACCD_LACRJ        ---------------------
ACCD_LACS1        ---------------------
ACCD_LACSS        ---------------------
ACCD_LACDA        ---------------------
ACCD_ACHLI        ---------------------
ACCD1_LACPL       ---------------------
ACCD_TREDE        ---------------------
ACCD_PARUW        ---------------------
ACCD_GEOBB        ---------------------
ACCD_PELPD        ---------------------
ACCD_PELCD        ---------------------
ACCD_UNCTG        ---------------------
ACCD_AMOA5        ---------------------
ACCD_GRAFK        ---------------------
ACCD_FLAB3        ---------------------
ACCD_PEDHD        ---------------------
ACCD_CHLL7        ---------------------
ACCD_PROA2        ---------------------
ACCD_SALRD        ---------------------
ACCD_HYDS0        ---------------------
ACCD_SULSY        ---------------------
ACCD_ECOLI        ---------------------
ACCD_PROMH        ---------------------
ACCD_BLOFL        ---------------------
ACCD_BLOPB        ---------------------
ACCD_WIGBR        ---------------------
ACCD_PASMU        ---------------------
ACCD_IDILO        ---------------------
ACCD_PSEHT        ---------------------
ACCD2_VIBCB       ---------------------
ACCD_VIBVU        ---------------------
ACCD_ALCBS        ---------------------
ACCD_CHRSD        ---------------------
ACCD_HAHCH        ---------------------
ACCD_MARHV        ---------------------
ACCD_CELJU        ---------------------
ACCD_PSEF5        ---------------------
ACCD_METCA        ---------------------
ACCD_HYDCU        ---------------------
ACCD_ALKEH        ---------------------
ACCD_HALHL        ---------------------
ACCD_BURCA        ---------------------
ACCD_DECAR        ---------------------
ACCD_METFK        ---------------------
ACCD_XANAC        ---------------------
ACCD_COXBU        ---------------------
ACCD_PSYA2        ---------------------
ACCD_PSYWF        ---------------------
ACCD_ACIB5        ---------------------
ACCD_PELUB        ---------------------