CLUSTAL format seed alignment for MF_01396

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPL_SYNAS            --------------------------------MVTCLTTFAVLLLTAAVASAAEAAAPGG
ATPL_DESPS            ------------------------------------------------------------
ATPL_ARCB4            -----------------------------------MKKIVLLMLAIAGIAFAAD------
ATPL_CAMJ8            -----------------------------------MKKVLFLLLACAAVAFAAETNAPVE
ATPL_HELAH            -----------------------------------MKFLALFFLALVGVAFAYD-----G
ATPL_THEYD            -----------------------------------MRKFFVILMVALVVVLTASAVFAAD
ATPH_OENBI            ------------------------------------------------------------
ATPH_BUXMI            ------------------------------------------------------------
ATPL_SYNS3            ------------------------------------------------------------
ATPL_SYNJB            ------------------------------------------------------------
ATPL_DICT6            ------------------------------------------------------------
E6XEF6_CELAD          ------------------------------------------------------------
A0AFQ7_LISW6          ------------------------------------------------------------
A4WGW8_PYRAR          ----------------------------------------------MQTKAILAAVLLAV
G4RPD3_THETK          ----------------------------------------------MKLRYITYLLLLSA
ATPL_AQUAE            ---------------------------------MMKRLMAILTAIMPAIAMAAEGEASVA
ATPL_HYDS0            ----------------------------------MKLKTLMLLTLASSIAMADTASSSSS
ATPL_CHLAA            ------------------------------------------------------------
ATPL_BACCN            ------------------------------------------------------------
ATPL_STAAN            ------------------------------------------------------------
ATPL_EXIS2            ------------------------------------------------------------
ATPL_OENOB            ------------------------------------------------------------
ATPL_BACSK            ------------------------------------------------------------
ATPL_ACTP2            ------------------------------------------------------------
ATPL_HAEDU            ------------------------------------------------------------
ATPL_HAES1            ------------------------------------------------------------
ATPL_PSESM            ------------------------------------------------------------
ATPL_SHEB8            ------------------------------------------------------------
ATPL_VIBPA            ------------------------------------------------------------
ATPL_LEPCP            ------------------------------------------------------------
ATPL_ECOLI            ------------------------------------------------------------
ATPL_AERHH            ------------------------------------------------------------
ATPL_NITOC            ----------------------------------------------------------MD
ATPL_MYCLE            ------------------------------------------------------------
ATPL_MYCTU            ------------------------------------------------------------
ATPL_CLAMS            ------------------------------------------------------------
ATPL_TROWT            ------------------------------------------------------------
ATPL_STRCO            ------------------------------------------------------------
ATPL_NOCSJ            ------------------------------------------------------------
ATPL_BIFLO            ------------------------------------------------------------
ATPL_CARHZ            ---------------------------------MDFTMSLVAGLI---------------
ATPL_MOOTA            ----------------------------------------MATIG---------------
ATPL_SORC5            -------------------------------MSLKSKLSLSAVVGTALVLVPAMALAQDG
A6H2E0_FLAPJ          -------------------------------------------------MG---------
G2Z3W6_FLABF          --------------------------------------------------M---------
ATPL_AZOPC            -----------------------------------MLLSILLQVATGTGLA---------
ATPL_PARUW            ----------------------------MHLARNPALKSIYIKIRKRKTMSIGTAL----
ATPL_STRP7            ---------------------------------------MNLTFL---------------
ATPL_STROR            ---------------------------------------MNLTFF---------------
A0A0H2UTZ8_STRP3      ---------------------------------------MNPIF----------------
ATPL_STRMU            --------------------------------------MLNLKIL---------------
ATPL_THEMA            -------------------------------MENLGDLAQGLALLGK-------------
ATPL_CLOD6            ------------------------------------------------------------
ATPL_RUMCH            ------------------------------------------------------------
ATPL_MYCS5            ----------------------------------MNQLQNLAEALSASSPVSGTVQTVVD
ATPL_MYCPE            ------------------------------------------------------------
ATPL_MYCGA            ----------------------------------MNIFLVIHELINQADQVN--------
ATPL_MYCGE            ----------------------------------MEHVNEILATVGVILQQT--------
ATPL_MYCHJ            ---------------------------------MNSIVNFSQQLIQNFQEVS--------
ATPL_CLOAB            ------------------------------------------------------------
ATPL_UREU1            ----------------------------------MSSFIDITNVISSHVEANLPAVSA-E
ATPL_MAGSA            ------------------------------------------------------------
ATPL_JANSC            ------------------------------------------------------------
ATP9_EMENI            MAASRVFAQRLASTMKVARPAARIQARTLTTQRMATPFQTIKRQQPSMIQASARQAFAAR
ATP9_DICCI            -------------------------------------MKNIVKIE---------------
ATP9_HELAN            ------------------------------------------------------------
ATPL_WOLPM            ------------------------------------------------------------
ATPL_WOLTR            ------------------------------------------------------------
ATPL_RICB8            ------------------------------------------------------------
                                                                                  

ATPL_SYNAS            ESYVKAIFAVGAMIGAGIAIGVGAV---GAGLGIGTAASGACQAVGRNPGVQGKIMMTML
ATPL_DESPS            --MEGNIQLALICVGAALSIGLAGL---GAGIGIGSVGQGACMGLARNPEVQPKLMVFMI
ATPL_ARCB4            EAVVNETLKAYSVVAAGIGLGLAAL---GGAIGMGNTAAATIAGTARNPGLGGKLMTTMF
ATPL_CAMJ8            QEAINVWIKAFSVLAAGLGLGVAAL---GGAIGMGNTAAATIAGTARNPGLGPKLMTTMF
ATPL_HELAH            GMDGMDMIKSYSILGAMIGLGIAAF---GGAIGMGNAAAATITGTARNPGVGGKLLTTMF
ATPL_THEYD            SDPAKLNYYGYATAGALIGLGAAAG---GGGAGMGQGLRGILEGSARNPGVTGKLMTLFI
ATPH_OENBI            ---MNPLISAASVIAAGLAVGLASI---GPGIGQGTAAGQAVEGIARQPEAEGKIRGTLL
ATPH_BUXMI            ---MNPLISAASVIAAGLAVGLASI---GPGVGQGTAAGQAVEGIARQPEAEGKIRGTLL
ATPL_SYNS3            ---MDSITSAASVVAAGLAVGLAAI---GPGIGQGSASQGAVEGIARQPEAEGKIRGTLL
ATPL_SYNJB            ---MDPLTSAASVLSAALAIGLGSL---GPGLGQGNAAAAAMEGLARQPEAEDKIRGNLL
ATPL_DICT6            ---MLAWVIIVSIITAGLSVALVGM---NATKAQGNAAASALESVARQPEAGDQINRMLL
E6XEF6_CELAD          -MDNSTLIGMVSIITAGVTMAIGGM---IPALGQGKSIAAALNSLAQQPDANQTITRTLF
A0AFQ7_LISW6          ----MDLVVACSVIGAALAIGLATL---GAAIGQGIAVSRATEIIGKNPNAKKEVMGGLF
A4WGW8_PYRAR          ATFAQTTG-GERYIGAGLAMGLAGL---GAGLGIGIAGAAAMSALVERP----QERTWYL
G4RPD3_THETK          VALAQSTNPGNQYIGAGIAMGLAGL---GAGIGVGIAGAAAISALVERP----QERVWYL
ATPL_AQUAE            --------KGLLYLGAGLAIGLAGL---GAGVGMGHAVRGTQEGVARNPNAGGRLQTLMF
ATPL_HYDS0            DAHARALFYGLMAVAAGVSIGLGAL---GAGVGAGSAIRGAEEGMARNPNMAGKLQTIMF
ATPL_CHLAA            -------MEGLNLVATALAVGLGAI---GPGVGIGIIVSGAVQAIGRNPEIENRVVTYMF
ATPL_BACCN            --------MSLGVIAAAIAIGLSAL---GAGIGNGLIVSRTIEGVARQPELKGALQTIMF
ATPL_STAAN            ----------MNLIAAAIAIGLSAL---GAGIGNGLIVSRTVEGVARQPEARGQLMGIMF
ATPL_EXIS2            ----------MELIATAIIIGLGAL---GAGIGNGLIVNGTVLGQARQPELKNELRQTMF
ATPL_OENOB            ----------MNYIAAGIALCGSAI---GAGIGNGMLMAKLIESIARQPELEGNLRTNMF
ATPL_BACSK            ----------MTELAIGIAAGLAAI---GGAIGVAIIVKAVIEGTARQPEQRGTLQTLMF
ATPL_ACTP2            ---MESV-ITATIIGASILLAFAAL---GTAIGFAILGGKFLESSARQPELASSLQTKMF
ATPL_HAEDU            ---MESV-ITATIIGASLLLAFAAL---GTAIGFAILGGKFLESSSRQPELASSLQTKMF
ATPL_HAES1            ---MENI-ITATIFGSVILLAVAAL---ATAIGFSLLGGKFLESSARQPELAASLQTKMF
ATPL_PSESM            ---METV-VGLTAIAVALLIGLGAL---GTAIGFGLLGGKFLEGAARQPEMVPMLQVKMF
ATPL_SHEB8            ---METI-LGMTAIAVALLIGMGAL---GTAIGFGLLGGKFLEGAARQPEMAPMLQVKMF
ATPL_VIBPA            ---METL-LSFSAIAVGIIVGLASL---GTAIGFALLGGKFLEGAARQPEMAPMLQVKMF
ATPL_LEPCP            ---MENV-LGLVALACGIIIGLGAI---GACIGIALMGGKYLEASARQPELMNELQTKMF
ATPL_ECOLI            ---MENLNMDLLYMAAAVMMGLAAI---GAAIGIGILGGKFLEGAARQPDLIPLLRTQFF
ATPL_AERHH            ---MENLNMDLLYIAAAMMMGLAAI---GASIGIGILGGKFLEGAARQPDLIPVLRTQFF
ATPL_NITOC            PELLVSI-YASTAVSVGIILAAAGL---GSALGWGLICSKYLEGIARQPEMRPQLMGQML
ATPL_MYCLE            ---MDPMIAQGALIGGGLIMAGGAI---GAGIGDGMAGNALVSGIARQPEAQSRLFTPFF
ATPL_MYCTU            ---MDPTIAAGALIGGGLIMAGGAI---GAGIGDGVAGNALISGVARQPEAQGRLFTPFF
ATPL_CLAMS            --MDPIITAEITGNIATVGYGLAAI---GPGIGVGIVAGKTVEAMARQPEMAGSLRTTMF
ATPL_TROWT            --MGSVL-AEVAGSLASIGYGLAAI---GSAIGVGIVVGKTVESVARQPELAKRLTVLMY
ATPL_STRCO            --MSQTL-AAVEGSLGSIGYGLAAI---GPGVGVGIIFGNGTQAMARQPEAAGLIRANQI
ATPL_NOCSJ            --------MAIEGSANMIGYGLAAI---GPGVGIGLIFAAYISGVARQPEAQSRLQAIAI
ATPL_BIFLO            --MDIITLAEVAGNLSVIGYGIGTL---GPGIGLGILFGKAMESTARQPEMSGKIQTIMF
ATPL_CARHZ            ------------AIGAGIAVGFGAI---GSGIGQGIAAGKAFEAMARQPEVRGTVQTFLI
ATPL_MOOTA            ------------FIGVGLAIGLAAL---GSGLGQGIASRGALEGMARQPEASGDIRTTLL
ATPL_SORC5            AASNKYDANSWLAVAAGFAIGIAAL---GGTMGQGRAAAAALEGISRNPGAAARIQTPMI
A6H2E0_FLAPJ          ------------TIPNLVGAGLIVI---GASLGIGRIGGSAMDAIARQPEASGKIQTAML
G2Z3W6_FLABF          ------------NIPMLVGAGLVVI---GAGLGLGKIGGSAMDAIARQPEAAGKIQTAMI
ATPL_AZOPC            ------------KLGEALGAGLAVI---GAGLGIGKIGESAMEGIARQPEAAGDIRMNMI
ATPL_PARUW            ------------ALSAPFAVGLAAL---GSGLGLGRAVSSAMEAIGRQPEASGKILTTMI
ATPL_STRP7            ------------------GLCIACM---GVSVGEGLLMNGLFKSVARQPDMLSEFRSLMF
ATPL_STROR            ------------------GLCLACM---GVSLAEGMLMNGLFKSAARQPDIIPQLRSLMI
A0A0H2UTZ8_STRP3      ------------------ALALACF---GVSLAEGFLMANLFKAASRQPEIIGQLRSLMI
ATPL_STRMU            ------------------ALGIAVL---GVSLGEGILVANIAKSAARQPEMYGKLQTLMI
ATPL_THEMA            ------------YLGAGLCMGIGAI---GPGIGEGNIGAHAMDAMARQPEMVGTITTRML
ATPL_CLOD6            ------METAIVAAASAIGAGIAVATGIGAGIGQGIAAAKAAEAVGNQPEAKGDITSTLL
ATPL_RUMCH            -----MAGTGII----AIAAAIAAFTGIGAGIGISLATGKAVEGIARQPEAAGSIRTSLL
ATPL_MYCS5            GNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFI
ATPL_MYCPE            -------MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYI
ATPL_MYCGA            -------VTLTNHVGAYIGAGMAMTAAAGVGVGQGFASGLCATALARNPELLPKIQLFWI
ATPL_MYCGE            --QTTQDVNASAKLGAYIGAGVTMIAGSTVGIGQGYIFGKAVEAIARNPEVEKQVFKLIF
ATPL_MYCHJ            --QRTAADSSNLKAFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQVFRVLV
ATPL_CLOAB            ---MNIDSHTFLLGMQYLGAGLAAIGCIGGGVGIGTVTGKAVEAIGRQPESASKVMPTMI
ATPL_UREU1            NVQSLANGAGIAYLGKYIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMI
ATPL_MAGSA            ------ME---ASAAKFIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGW
ATPL_JANSC            ------MEGDIAQMGQFIGAGLAAIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLF
ATP9_EMENI            RQYSSEIADAMVQVSQNIGMGSAAIGLGGAGIGIGVVFGSLLLAVSRNPALRGQLFSYAI
ATP9_DICCI            ---QLELASAVVELGKKVGAGLAAIGLTGAGAGVGIVFAAFILAVGMNPNLRGELFKLAM
ATP9_HELAN            ----------MLEGAKSIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAI
ATPL_WOLPM            ---------MDLVALKFIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGKMKSYVY
ATPL_WOLTR            ---------MDLVALKFIAIGLSVLGILGAGLGVANIFSTMLSGLARNPESEGKMKIYVY
ATPL_RICB8            ---------MDMVSLKFIGVGCMAIGMLGAALGVSNIFSSLLNSIARNPSATEQLQRMAL
                                                        .            .*           

ATPL_SYNAS            VGMAMAESIAIYALVVSLVLIFANPYTKFFFVG---
ATPL_DESPS            LGMALAESIAIYGLVISLILLYANPLLG--------
ATPL_ARCB4            IALAMIEAQVIYALVVAMIALYANPFLG--------
ATPL_CAMJ8            IALAMIEAQVIYALVIALIALYANPFIVLQ------
ATPL_HELAH            VAMAMIEAQVIYTLVFAIIAIYSNPFLS--------
ATPL_THEYD            VGLALIESLVIYVLVFVLITFYANPFVK--------
ATPH_OENBI            LSLAFMEALTIYGLVVALALLFANPFV---------
ATPH_BUXMI            LSLAFMEALTIYGLVVALALLFANPFV---------
ATPL_SYNS3            LSLAFMESLTIYGLVVALVLLFANPFA---------
ATPL_SYNJB            VSLAFMEALTIYGLVVALVLLFANPFA---------
ATPL_DICT6            FALAFIETIMIFTLTVALILLFANPLLGKL------
E6XEF6_CELAD          VGLAMLESVAIYCFVIAMILIFANPFWNHFIA----
A0AFQ7_LISW6          LGLLMIVALMLFALAIAVILLWVNPFI---------
A4WGW8_PYRAR          IFLALAEAIAIYGLLISLLLVL--------------
G4RPD3_THETK          IFVALAEAIAIYGLLVSFILAAK-------------
ATPL_AQUAE            IGLAFIETIALYGLLIAFILLFVV------------
ATPL_HYDS0            IGLAFIETFALYAMLFSIIFVFTGIFSGKAGF----
ATPL_CHLAA            IGIAFTEALAIFGLVIAFLIGFGVLQ----------
ATPL_BACCN            IGVALVEALPIIGVVIAFIVMNR-------------
ATPL_STAAN            IGVGLVEALPIIGVVIAFMTFAG-------------
ATPL_EXIS2            IGIGLVEALPIIGVAVGFLLLNS-------------
ATPL_OENOB            ISMALVEAMPIIVIAMSFVLINE-------------
ATPL_BACSK            IGAPLAEAVPIIAIVIAFLLFFMG------------
ATPL_ACTP2            IVAGLLDAIAMIAVGISLLFIFANPFIDLLK-----
ATPL_HAEDU            IVAGLLDAIAMIAVGISLLFIFANPFIDLLK-----
ATPL_HAES1            IVAGLLDAISMIAVGIALLFIFANPFIGLLN-----
ATPL_PSESM            IVAGLLDAVTMIGVGIALFFTFANPFVGQLAG----
ATPL_SHEB8            IVAGLLDAVTMIGVGIALFMLFTNPLGAML------
ATPL_VIBPA            IIAGLLDAVPMIGIVIALLFTFANPFVGQLG-----
ATPL_LEPCP            LLAGLIDAAFLIGVGIAMLFAFANPFVLK-------
ATPL_ECOLI            IVMGLVDAIPMIAVGLGLYVMFAVA-----------
ATPL_AERHH            IVMGLVDAIPMIAVGLGLYVMFAVAG----------
ATPL_NITOC            FTGGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS
ATPL_MYCLE            ITVGLVEAAYFINLAFMALFVFATPVK---------
ATPL_MYCTU            ITVGLVEAAYFINLAFMALFVFATPVK---------
ATPL_CLAMS            LGIAFSEALALIGLATYFIFTN--------------
ATPL_TROWT            VGVAFTEALALIGIGTYFLFR---------------
ATPL_STRCO            LGFAFCEALALIGLVMPFVYGY--------------
ATPL_NOCSJ            LGFALAEALAIIGIALAFVL----------------
ATPL_BIFLO            IGLALVEVLALIGFVAALII----------------
ATPL_CARHZ            IALAFMETLTIYGLVIAFMLLNKMS-----------
ATPL_MOOTA            LALAFMEALTLFSFVIAILMWTKL------------
ATPL_SORC5            LGLALIESLVLLSWVIAFFLQGKIAP----------
A6H2E0_FLAPJ          IAAALIEGIGFAAFFMGK------------------
G2Z3W6_FLABF          IIAALLEGLAFAALILGKA-----------------
ATPL_AZOPC            IAAALVEGVSLFAVVVCGFLL---------------
ATPL_PARUW            IGAALIEALTIYALIVFFVVLEKMA-----------
ATPL_STRP7            LGVAFIEGTFFVTLVFSFIIK---------------
ATPL_STROR            MGIAFIEGTFLVTLVFSFVIK---------------
A0A0H2UTZ8_STRP3      LGVAFIEGTFFVTLVMAFILK---------------
ATPL_STRMU            MGVAFIEGTFFVLLASTFFVG---------------
ATPL_THEMA            LADAVAETTGIYSLLIAFMILLVV------------
ATPL_CLOD6            LGVAIAESSAIYGLVISIILLFVNPFFKYLGM----
ATPL_RUMCH            LGAALAEATAIYGLVVALVLVFLKM-----------
ATPL_MYCS5            IGAGIAETASIYSFIVALLLIFVGK-----------
ATPL_MYCPE            LSAAVTETGALYCFIIAILLVFVAR-----------
ATPL_MYCGA            VGSAIAESSAIYGLIIAFILIFVAR-----------
ATPL_MYCGE            IGSAVSESTAIYGLLISFILIFVAGA----------
ATPL_MYCHJ            IGTAISETSSIYALLVALILIFVG------------
ATPL_CLOAB            MGLAFAEVTSLYALFVAIMLLFVK------------
ATPL_UREU1            VGLALAEAVAIYALIVSILIIFVA------------
ATPL_MAGSA            IGFAVTEAIALFALVVALMVLFA-------------
ATPL_JANSC            IGIAFAEALGIFAFLVALLLMFAV------------
ATP9_EMENI            LGFAFVEAIGLFDLMVAMMCKYV-------------
ATP9_DICCI            LGFALSEAVGLLALMMSFLILYS-------------
ATP9_HELAN            LGFALTEAIASFAPMMAFLISSVIPIKESKKEG---
ATPL_WOLPM            IGAAMVEIMGLLAFVLAMLLIFAA------------
ATPL_WOLTR            VGAGMVEFTGLLAFVLAMLLMFVA------------
ATPL_RICB8            IGAGLAEAMGLFSFVIAMLLIFS-------------
                      .   .