CLUSTAL format seed alignment for MF_01397

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUOCD_CAMFF      --------MLEKFSSKFNVLKHSTTNGLLSVQINPNDIYEAVLFVRDN--IGFEILADIV
NUOCD_ARCB4      --------MLN-----------------CDMLIDSKELKSTISKLKNE--DNYTILLDVT
NUOCD_BDEBA      MNKLENLKQLLAGKFKIENFKFTHAVGDDVIEVPKEDAPALLLFLRES--GQFDFLMDVC
NUCD1_AQUAE      MPWAKEGDLQELLKAF-PQASVVELQNSTSVIVPKDILIDVLKYLKEK--LGYKLFLDHS
NUOCD_HYDS0      -MQASEKTLNEIKAKL-PYVEVKKDKLLSIVYVQKELLINTLKAIKED--FGFKLFLDHS
NUOCD_SULSY      MAWISLEKAKKLEERF-GYPKVSEGKGVLSVEVPKDKFIEFLTFLKEDPEYQFKMFIDLT
NUCD2_AQUAE      MKWVNKGTVERVKQEFKDEVKYYETKHTKGFEVSHDFLKPLLKFLKER--ERFLHFVDMT
NUOCD_BACFN      --------------------------MEEIKYIEPAALHDEMLRLRNE--KQMDFLESLT
NUOCD_BACFR      --------------------------MEEIKYIEPAALHDEMLRLRNE--KQMDFLESLT
NUOCD_BACTN      --------------------------MQEIQFIVPAALHDEMLRLRNE--KQMDFLESLT
NUOCD_BACV8      --------------------------MSERIEIPAEKLHEEMLKLRQG--KHMDFLRSLT
                                                 :        :  :::        : .  

NUOCD_CAMFF      CVDNLYID--------------------KEKRFSLYYIFRKIS-SENLCIYIDIDINQ--
NUOCD_ARCB4      AVDYLKFPDV------------------TPSRFAVIYILRDSTFTKEITIKSYVDDNTL-
NUOCD_BDEBA      GADYPSRE----------------------KRFDVVYNLFNSKDSSRLRVKAQVGEGE--
NUCD1_AQUAE      VVDLKDLLENEKEFNKVVKQNLIAFPEDRESRFQAFYILYNVD--ERKRVIVKTRTNG--
NUOCD_HYDS0      VVDTLEAQ----------------------NRFEAFYILYNVD--TKERIAVKTRTEH--
NUOCD_SULSY      IIDHGEKEN---------------------PRFQGVVILFSPK--NQERIIVKTWAENE-
NUCD2_AQUAE      CIDFPEHP----------------------NRFQGVYILYNPE--ENERVIVKSWAKDG-
NUOCD_BACFN      GMDWGVADEGD--------------APNVTRGLGVVYHLESTVTGERIAIKTSTNNRETP
NUOCD_BACFR      GMDWGVADEGD--------------APNVTRGLGVVYHLESTVTGERIAIKTSTNNRETP
NUOCD_BACTN      GMDWGVADEKD--------------APEKLRGLGVVYHLESTVTGERIALKTAVTDRERP
NUOCD_BACV8      GMDWGEE------------------------GLGVVYHLEDTNTRENIVVSTRTTNREKP
                   *                             :     : .     .  :          

NUOCD_CAMFF      SVKSVESIYKSANWGERECFDQFGVKFENHPNLKRILNHKDFQGYPLRKDYPITKYQ---
NUOCD_ARCB4      EIDSLYDLYESADWAERETFDQYGIKFVGHPNLKRVLNHHQFIGHPLRKDYKITKGQ---
NUOCD_BDEBA      SIGTAIPAYRGADWFEREAYDMFGIIFEGHPNLRKILTHHQFVGHPLRKDYDANNQQ---
NUCD1_AQUAE      KLPTIEKLWFAGKWAERECYDMFGIEYEGHENLVRAFMWDTYPYFPLRKDFPLEGIPEQE
NUOCD_HYDS0      SLPSAEKLWFAAKWAERECYDMFGINYEGHEHLVRAFMWDTYNYHPLRKDFPLQGYETVE
NUOCD_SULSY      TLPTLTNLWKGAKWAEREAWDMFGIKFEGHENLVRMLLWETYPYHPLRKDFPLEGIKDTE
NUCD2_AQUAE      KLPTVEDLWPGAKWAEREAYDMFGVVFEGHENLRRMFMWEGYEHYPLRKDFPLQGIPEVE
NUOCD_BACFN      EIPSVSDIWKAADFNEREVFDYYGIVFIGHPDMRRLYLRNDWVGHPMRKDNNPEKDNP--
NUOCD_BACFR      EIPSVSDIWKAADFNEREVFDYYGIVFIGHPDMRRLYLRNDWVGHPMRKDNNPEKDNP--
NUOCD_BACTN      EIPSVSDIWKIADFYEREVFDYYGIVFVGHPDMRRLYLRNDWVGYPMRKDNDPEKDNP--
NUOCD_BACV8      ELPSVSDIWKGAEFNEREVYDYYGIRFIGHPDMRRLFLRDDWVGYPLRKDYD-ESLNP--
                  : :    :  ..: *** :* :*: : .* .: :    . :  .*:***          

NUOCD_CAMFF      -------------VLYESDDLVGEMKNEMQRAGLASEENDEFKTKYTFLNIGPSHPATHG
NUOCD_ARCB4      -------------ICTETEDLMDEMVPKLKSKGYKKEEIDDL----MLLNVGPSHPASHG
NUOCD_BDEBA      -------------ACTNS--LPIHFNNEPGSPG------DVLNDKYLPLNIGPSHTAMHG
NUCD1_AQUAE      LPSLNEVVFGDNLEGLMNYDRMHTRVPTLEDLEVTEKKRLK-KKAQIVLNWGPLHPGTHG
NUOCD_HYDS0      LPSLNETVFGDNLSNTMNYRRTHTYVPTLKDLEYTEKNRIK-KKAQVVLNWGPLHPGTHG
NUOCD_SULSY      LPSLNETLRGENLEGLFNYDRMHTALPTMEDLEITQKKRMPVKTSQIVLNWGPLHPGTHG
NUCD2_AQUAE      LPSLTEVLHGRTDPPSHDFELVHTKLPTLEDLERTEKARLK-KKAELVLNWGPLHPGTHG
NUOCD_BACFN      -----------LRMDNEETYDTTREIELNPDGTYQTQENVIFDDREYVVNIGPQHPATHG
NUOCD_BACFR      -----------LRMDNEETYDTTREIELNPDGTYQTQENVIFDDREYVVNIGPQHPATHG
NUOCD_BACTN      -----------LCMANEETFDTTQEIELNPDGTIKNREMKLFGEEEYVVNIGPQHPATHG
NUOCD_BACV8      -----------LRMTNEEPVDTTQYIEVQHDGSVIEKRETIFDEDEYIINIGPQHPATHG
                                                                 :* ** *.. **

NUOCD_CAMFF      TIRNFVALDGEKIISCVTEIGYLHRGFEKACENHSYAQIIPYTDRLNYCSAMLNNVGYAK
NUOCD_ARCB4      TIRNFVAMEGETITACVTEIGYLHRGFEKACEHHTYSQIIPYTDRLNYCSAILNNIGYSK
NUOCD_BDEBA      TLRVMAEMDGETIVRCNNEIGYLHRCFEKMAETHPYNQVIPYTDRLNYCSAPMNNIGYCK
NUCD1_AQUAE      TMWFLFDLEGERIVQTDVILGQLHRGVEKLAEHEMYNQFLVYTDRMDYLSALCSNQAWVV
NUOCD_HYDS0      TMWFLFDLEGERIVQTDVILGQLHRGVEKLAEHEPYQQFLVYTDRMDYISALCSNQAWTV
NUOCD_SULSY      TIWFLFDLDGEYVKQCDIIIGQLHRGVEKLGENVNWQQFIPYTDRMDYIAAINENHAYVL
NUCD2_AQUAE      TIWFLFDLEGEKVVQSDVILGQLHRGMEKLAENLHYFQFIPYTDRMDYISAICNELAYVE
NUOCD_BACFN      VMRFRVSLEGETIKKLDANCGYIHRGIEKMNESLTYPQTLALTDRLDYLGAHQNRHALCM
NUOCD_BACFR      VMRFRVSLEGETIKKLDANCGYIHRGIEKMNESLTYPQTLALTDRLDYLGAHQNRHALCM
NUOCD_BACTN      VMRFRVSLEGEIIRKIDANCGYIHRGIEKMNESLTYPQTLALTDRLDYLGAHQNRHALCM
NUOCD_BACV8      VLRFRVSLEGEIIKKLDVHCGYIHRGIEKMCESLTYPQTLALTDRLDYLGAHQNRHALCM
                 .:     ::** :       * :** .**  *   : * :  ***::* .*  .. .   

NUOCD_CAMFF      AVEEALGLN--LPDRGIFMRVILGELARIIDHEVCLGAMFVDMGGLTNYWYLYNPRERIY
NUOCD_ARCB4      AVEEMLGIE--ITPRAKMIRVIIGELSRILDHLVCNAANMVDLGGLTNFWYLFSPRDMAY
NUOCD_BDEBA      AVERLLGVE--IPPKAQAMRVILAELSRIIDHTIAIGTGAMDLGALTSFFYMFGMREKVY
NUCD1_AQUAE      AIERLMGIHDKVPPKAKYIRTMMSELQRINSHLLWLGTYALDLGALTIFLYAFKEREKIM
NUOCD_HYDS0      AVERLLGIEDIVPIKAKYIRTMMSELQRINSHLLWLGTYALDLGALTIFLYAFKEREKIM
NUOCD_SULSY      AAEKMLGIE--VPEKAKWIRTMMAELSRINSHLLWLGTYALDLGALTMFLYTFREREKIM
NUCD2_AQUAE      TVERLLGVE--VPEKARYIRTMFAELQRINSHLLWLGTGALDLGALTVFLYAFREREKIM
NUOCD_BACFN      CIEKAMGIE--VSERVKYIRTIMDELQRIDSHLLFYSCLAMDLGALTAFFYGFRDREMIL
NUOCD_BACFR      CIEKAMGIE--VSERVKYIRTIMDELQRIDSHLLFYSCLAMDLGALTAFFYGFRDREMIL
NUOCD_BACTN      CIEKAMGIE--VSDRVKYIRTIMDELQRIDSHLLFYSALAMDLGALTAFFYGFRDREKIL
NUOCD_BACV8      CIEQAMGVE--VSERVQYIRTIMDELQRIDSHLLFFSCLCMDMGALTAFFYGFRDREKIL
                   *. :*:.  :. :   :*.:: ** ** .* :  .   :*:*.** : * :  *:   

NUOCD_CAMFF      NFLSKLTGARFTNSFARIGGMANDFYDGWKEELLAHLKDVEKGVDDTMILIEKNRIFLDR
NUOCD_ARCB4      DLLSKLTGARLTNTYTRIGGLEFDLYDGFDKDLEEVLKAVEKGVEDALSLIAHNRIYHDR
NUOCD_BDEBA      GLFEKLCGARLTVSMTRIGGMAQDAPEGWFDEVLALVKEIRKGTDEMANMVIDNKIFIQR
NUCD1_AQUAE      DIIEGITGARLTISYPRIGGVRMDLPEGALEVIKAFIKKFPEELKDWETILTRNRIWLRR
NUOCD_HYDS0      DIIEGITGARLTISYTRIGGVRMDLPEGALEVIESFIKFFPKELKDWEKILSRNRIWVKR
NUOCD_SULSY      DIIEGITGARFTINYFRIGGVFADLPYGALDAIEHLIKDLPQRINDYETLLTRNRVWLSR
NUCD2_AQUAE      DIIEGNAGYRLTSCFLRIGGVHYDLAEGTLDVVKHFIKDFPNRLKEYHTLLTRNRIWLRR
NUOCD_BACFN      DMFEETCGGRLIMNYNTIGGVQADLHPNFIPRVKKFIPYLRGIIHEYHDVFTGNVIARQR
NUOCD_BACFR      DMFEETCGGRLIMNYNTIGGVQADLHPNFIPRVKKFIPYLRGIIHEYHDVFTGNVIARQR
NUOCD_BACTN      DIFEETCGGRLIMNYNTIGGVQADLHPNFVKRVKEFIPYMRGIIHEYHDIFTGNIIAQSR
NUOCD_BACV8      DIFEATTGGRLIQNYNTIGGVQADIAPDFVQKVKEFIAYLRPMLKEYHEVFTGNVIAQER
                 .::.   * *:      ***:  *   .    :   :  .    .:   :.  * :   *

NUOCD_CAMFF      VQNICKINANDALSYGFSGPNLRASGVSFDLRKDKPYYYYDSFDFSVPVGSEGDIYDRMF
NUOCD_ARCB4      TQDVGVIKADFALRNGISGPNLRAAGVACDLRKDKPYYGYENFDFDVVIGSHGDVYDRMM
NUOCD_BDEBA      TKNVCPVSAADAIQWGYTGPMLRACGVNLDLRKAQPYYGYDALDFDVPVGTNGDIYDRYL
NUCD1_AQUAE      NKEVGIISKEDAYFHGVTGPVIRGSGIPYDIRKFEPYDAYDEVEFDIPVGEIGDCYDRYL
NUOCD_HYDS0      NKNVGVLTKEDIYFYGLTGAVARGSGVFYDIRKLEPYDAYGMVEFDVPLGENGDCYDRYL
NUOCD_SULSY      NKDVCVITEEDVYQYGLTGAVARGSGVPYDVRKIDKYDAYGEVEFDIPVGEKGDSYDRYL
NUCD2_AQUAE      TKDVGVITREDVHNYGLSGPVARGSGVPYDLRKLQPYAAYDEVEFDIPVGEVGDVYDRYL
NUOCD_BACFN      LKGVGVLSREDAISFGCTGGTGRASGWACDVRKRMPYGVYDKVDFKEIVYTEGDSFARYM
NUOCD_BACFR      LKGVGVLSREDAISFGCTGGTGRASGWACDVRKRMPYGVYDKVDFKEIVYTEGDSFARYM
NUOCD_BACTN      MKGVGVLSREDAISFGCTGGTGRASGWACDVRKRIPYGVYDKVDFQEIVYTEGDCFARYL
NUOCD_BACV8      LKGVGVLSREDAISFGATGGTGRASGWACDVRKRHPYAMYGKVDFKEIVHTEGDCFARYM
                  : :  :.       * :*   *..*   *:**   *  *  .:*.  :   ** : * :

NUOCD_CAMFF      VRFFEMRESISIIRQAIKLIPEGKISVDDKDV----FLPSKDQVYSNIESLINHFKLIFD
NUOCD_ARCB4      CRFEEMRQSTKIIRQAMKNLPDGAINVYAPGV----ILPSKKDVYGNIEGLMNQFKLTFE
NUOCD_BDEBA      VRFEEMRQSVRIIEQVCKNVPGGDYTIRDKGI----VLPEKKDVYGNIEGLMNHFMLIIK
NUCD1_AQUAE      VRIEEMKQSIRIIEQCVAKLEKMSKNEPFFYE-----GEG-KKLKLSLDGI---------
NUOCD_HYDS0      VRIEEMKQSIRIIEQCVQKLKTMSPNEPFMAE-----SQDPKKLRLTLDGI---------
NUOCD_SULSY      VRMEEMRQSIRIIEQCIAKLRKMSKDDPYFFQ-----TPDEKKLKVTIDGR---------
NUCD2_AQUAE      VRMEEMAQSVRIIEQCVQKLEKLPKDAPYLNKEHPAVIPPKEDVFHDLESMVKSFRVVVH
NUOCD_BACFN      VRMDEIMESLNIIEQLIDNIPEGPIQEKMKPI----------------------------
NUOCD_BACFR      VRMDEIMESLNIIEQLIDNIPEGPIQEKMKPI----------------------------
NUOCD_BACTN      VRMDEIMESLKIIEQLIDNIPEGPYQEKMKPI----------------------------
NUOCD_BACV8      VRMEEILESMDIIEQLIDNIPEGNYQEKMKPI----------------------------
                  *: *: :*  **.*    :                                        

NUOCD_CAMFF      GIKLPNGHFYSASEGANGELGFFIFSN-SEPNPYRVKLRPPCFYALNAFSSMVQGSLIAD
NUOCD_ARCB4      GIQVPKGEYYSFSEAANGELGFFIVSD-GSGRPYKVKCRPPCFYSLAAYSKIVEGTMLAD
NUOCD_BDEBA      GLRPPVGEVYDATEAANGELGFYLVSD-GSANPYRLKVRPPCFAIYQSFPTVVKGAMLAD
NUCD1_AQUAE      GVKAPVGEIYSSGENPRGELGFYVVST-GGTSPYRVKIRPPSYYNLCIYPHLMKDRYVAD
NUOCD_HYDS0      GLKVPVGEIYSSGENPRGELGFYINSK-GGLKPYRVKIRPGSFYNLCVYPHLMENRYVAD
NUOCD_SULSY      GMKLPAGETYASSDNPRGELGFYIYNKKDGLKAHRMRIRSGAFYNLQVFTKAIIGRPIAD
NUCD2_AQUAE      GEDAPPGEVYFAGENPRGELGFFIYSK-GGGKPYRTRIRSGALYNLSIFPKLIQGRTIAD
NUOCD_BACFN      -IRVPEGSYYTAVEGSRGEFGVFLESH-GDKTPYRLHYRSTGLPLVSAVDTICRGAKIAD
NUOCD_BACFR      -IRVPEGSYYTAVEGSRGEFGVFLESH-GDKTPYRLHYRSTGLPLVSAVDTICRGAKIAD
NUOCD_BACTN      -IRVPEGSYYAAVEGSRGEFGVFLESQ-GDKMPYRLHYRATGLPLVAAIDTICRGAKIAD
NUOCD_BACV8      -IRVPEGNYYAAVEGSRGEFGVYLESR-GDKFPYRMKFRATGLPLVSAMETMCRNAKIAD
                     * *  *   : ..**:*.:: .  .   .:: : *.              .  :**

NUOCD_CAMFF      SILNLGSLNIIAGELDR
NUOCD_ARCB4      AVVTMASMNFIAGEFDR
NUOCD_BDEBA      AIATVASMNLIAGELDR
NUCD1_AQUAE      AVTILASIDPVVGETDR
NUOCD_HYDS0      AVTILASLDPVVGEVDR
NUOCD_SULSY      AITLLSTIDPVVGETDR
NUCD2_AQUAE      AIALLGSLDPVVGETDR
NUOCD_BACFN      LIAIGGTLDYVVPDIDR
NUOCD_BACFR      LIAIGGTLDYVVPDIDR
NUOCD_BACTN      LIAIGGTLDYVVPDIDR
NUOCD_BACV8      LIAIGGTVDYVVPDIDR
                  :   .::: :. : **