CLUSTAL format seed alignment for MF_01398

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPF_RICPR       ------------------------------------------------------------
ATPF_RICBR       ------------------------------------------------------------
ATPF_BIGNA       ----------------------------------------------------MNDLFLFN
ATPF_HELPJ       ---------------------------------------------MFVVKMVLGFLILLS
ATPF_HELPY       ---------------------------------------------MFVVKMVLGFLILLS
ATPF_NITSB       ---------------------------------------------MKQKLLMLLLLGSVS
ATPF_CAMHC       ----------------------------------------------MNKFLFFIFVFVGI
ATPF_CAMC1       -----------------------------------------------MKIKILFFLALPF
ATPF_BDEBA       ---------------------------------------MHMKLILNLLVLLAPAAVFAA
ATPF_AQUAE       ---------------------------------------------MVRLISFLTLASTFA
ATPF_EUGGR       -------------------------------------------------MVIDNFNIFTI
ATPF_SYNJB       --------------------------------------MPVWSWVAGWILAVAETTELLP
ATPF_PROMP       --------------------------------------------------------MNLP
ATPF_SYNPX       ------------------------------------------------------------
ATPF_OSTTA       -----------------------------------------------------------M
ATPF_OEDCA       ---------------------------------------------------MNLLTIFNI
ATPF_CUSGR       -----------------------------------------------MKDVTYYLISLAS
ATPF_ORYSJ       -----------------------------------------------MKNVTHSFVFLAH
ATPF_VITVI       -----------------------------------------------MKNVTDSFVSLGH
ATPF_ARATH       -----------------------------------------------MKNLTDSFVYLGH
ATPF_LOBMA       -----------------------------------------------MKNLTDSFVYLGH
ATPF_CYACA       ----------------------------------------------------MRSQSLNF
ATPF_CYAM1       ------------------------------------------------------------
ATPF_HETA4       -------------------------------------------------MENLTNIFLFL
ATPF_VAULI       --------------------------------------------------MKNWISSFIL
ATPF_ANTSP       ---------------------------------------------MENNFQVFRLISENF
ATPF_PHATC       --------------------------------------------------MENFDQIFTL
ATPF_THAPS       --------------------------------------------------MENFNQIFTV
ATPF_ACHLI       -------------------------------------------------MDIFKEISDAI
ATPF_HYPNA       --------------------------------------------MKKTTSLLIAALAVAP
ATPF_SPHWW       -----------------------------------------------MSVNASTLVADNL
ATPF_PHEZH       ------------------------------------------------------------
ATPF_CAUVC       ------------------------------------------------------------
ATPF_CAUSK       ----------------------------------------------------------MP
ATPF_SORC5       -------------MQPGRARPTPPPAQPEHASHGEGHCPGHGPTDPPPHVNWWHGLIGVN
ATPF2_ACICJ      -----------------------------------------MRRTTILLAATALGLTPAI
ATPF1_GRABC      -------------------------------------MLLGTVVTVLSTLPAIAYAMDPE
ATPX_RHOCA       ------------------------------------------MANETNAVEAAAAVAGHA
ATPF_BRUME       ---------------------MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDA
ATPF2_METRJ      ----------------------------------MAQPNPLTTPPPGADTQVVPGHVEHT
ATPF_MYCPE       ---------------------------------------METINNVFDSVISLQSAIPDN
ATPF_PELUB       -------------------------------------------------MEAFAAESGGM
ATPF_MYCH7       ----------------------------------------------------MVNLNQSL
ATPF1_PROA2      ------------------------------------------------------------
ATPF_MYCA5       ----------------------------------------------MNFNINQSSISDAI
ATPF_MYCGE       -----------------------MVKAKKLVFKWSLLVFSFFTLSLFLVSCTENVREIKS
ATPF_PELPD       ---------------------------------MGTPSDRTTTLSLCLAVCVVVIAVGTG
ATPF_KORVE       ------------MYAQEAQQKPEAQQSAPAAEQPKPAEEQAKPEQHVTNPNAAVGKELSE
ATPF_SOLUE       ----------------------------------------MRRLAVYLAIAVGLFAQAPK
ATPFD_MYCLE      ------------------------------------------------------------
ATPX_CHLRE       MASLLARPQQAVVRAAKPAAARPLRLVVRASAQKPQQQLAQLAKPALSAIVANALMAMPA
ATPF_CLOAB       ------------------------------------------------------------
ATPF_BACSU       ---------------------------------------------------------MSQ
ATPF_STAEQ       -------------------------------------------------------MTATA
ATPF_STRPF       ------------------------------------------------------------
ATPF_LACJO       -----------------------------------------------------------M
ATPF_LACP3       ------------------------------------------------------------
ATPF_MYCTU       -------------------------------------------MGEVSAIVLAASQAAEE
ATPF_MYCLE       --------------------------------------------MFEVSAIVFAVSQAAE
ATPX_PHATC       ------------------------------------------------MINISMLISNSE
ATPX_VAULI       --------------------------------------------------MLKFSFLFLT
ATPX_GALSU       --------------------------------------------------MQYQYINSYS
ATPX_NOSP7       ------------------------------------------------------------
ATPX_SYNP6       ------------------------------------------------MNAWMILAAEAV
ATPX_PROMP       -----------------------------------------------------MLAFDFF
ATPX_PAUCH       --------------------------------------------------MTSWLLLAEA
ATPF_THEMA       ------------------------------------------------------------
ATPF_FUSNN       ------------------------------------------------------------
ATPF_BUCBP       ------------------------------------------------------------
ATPF_PARPJ       ------------------------------------------------------------
ATPF_BURVG       ------------------------------------------------------------
ATPF_XANC8       ------------------------------------------------------------
ATPF_HAEIN       ------------------------------------------------------------
ATPF_SHEON       ------------------------------------------------------------
ATPF_ECOLI       ------------------------------------------------------------
ATPF_CORDI       --------------------------------------------MTNVIKYLAEGEALPL
ATPF_BIFAA       --------------------------------------------------------MVTA
ATPF_MICLC       --------------------------------------------------MISNGLILAA
                                                                             

ATPF_RICPR       -------MNFLD-----------------------ESFWLT--ISFVIFVYLIYRPAK--
ATPF_RICBR       -------MHFLD-----------------------ESFWLA--ISFIIFVYLIYRPAK--
ATPF_BIGNA       NSFQDSFEINTD-----------------------LFDTNI--INLSIVLFVVIRFLG--
ATPF_HELPJ       PLCATGLDISQT-----------------------DIIERS--LNFLLFVGILWYFLA--
ATPF_HELPY       PLCATGLDISQT-----------------------DIIERS--LNFLLFVGILWYFSA--
ATPF_NITSB       LFANEAAASGGT-----------------------DIIPRT--VNFLIFAAILYYLAA--
ATPF_CAMHC       SFAGDDTATKDY-----------------------DIVWRT--INFAIFFGILFYLIK--
ATPF_CAMC1       LAYASEHGGTNY-----------------------DIVERT--LNFLLFFAILVYFAA--
ATPF_BDEBA       GGGHGDGHIPTS-----------------------TIMFQA--INLTILFAAIIYFTK--
ATPF_AQUAE       YAGEGHLGHSPG-----------------------ALIWKG--LNILAFLGIVYYFGK--
ATPF_EUGGR       ISNAKTFGINTN-----------------------VFETNI--INLAIVVGTLFYYGK--
ATPF_SYNJB       EAKAGEGDLLAK-----------------------ILESNL--INIAIILTLLFILGR--
ATPF_PROMP       LLATEGFGLNLN-----------------------LFETNV--LNWAVVVFGLYKFLP--
ATPF_SYNPX       ------MTLNFN-----------------------PLETNL--VNLAIVIGVLVWFLR--
ATPF_OSTTA       VSLAEGFGFNTN-----------------------ILETNV--LNLAVVLPIVFTLGR--
ATPF_OEDCA       LPLGEGFGFNDN-----------------------ILETNI--INLAAVVGIVVFFVG--
ATPF_CUSGR       QSPAGSFGLNTN-----------------------NLVTTL--INIAVVLSLLIVFGK--
ATPF_ORYSJ       WPSAGSFGLNTD-----------------------ILATNL--INLTVVVGVLIYFGK--
ATPF_VITVI       WPSAGGFGFNTD-----------------------ILATNP--INLSVVLGVLIFFGK--
ATPF_ARATH       WPSAGSFGFNTD-----------------------ILATNP--INLSVVFGVLIFFGK--
ATPF_LOBMA       WPAAGSFGFNTD-----------------------ILATNP--INLSVVFGVLIFFGK--
ATPF_CYACA       VASNTTSDFISN-----------------------LLESNV--INIIILISLLIYLGK--
ATPF_CYAM1       -----MHTLLET-----------------------LLESNV--INIAILVVILIRFAR--
ATPF_HETA4       SNENEGIQLNTD-----------------------IFEANI--INLALLIVLVINVAK--
ATPF_VAULI       VHQEKSISFNTN-----------------------ILETNL--INIIILLIILFYFLK--
ATPF_ANTSP       SEVSHSIGLNSD-----------------------FLEANV--LNIMLLLFGLIYVLK--
ATPF_PHATC       LAEHEGIGLNLN-----------------------ILETGL--LNILTLVGILIYAGK--
ATPF_THAPS       LAASEGIGLNLD-----------------------ILETGL--LNILALVAILVYTGK--
ATPF_ACHLI       QEGLNSIFERWD-----------------------LVLWQI--AATVILIIVVRIFLW--
ATPF_HYPNA       LAHAAEGGFVGG-----------------------LMYAATDPVTFVAFLCMVTFLLIAA
ATPF_SPHWW       ADAASLEGLPENVSAGHAAAGTEEHHVDPTALGMTATAWVS--LAMVIVILLLLWKKV--
ATPF_PHEZH       ---MPAFLNPAE-----------------------AEFWVG--AGLLIFLGIV-FFGA--
ATPF_CAUVC       -MEHQSLFSFSN-----------------------PEFWVL--AALVIFFGLLVVLKV--
ATPF_CAUSK       AFFEGEFWQIAN-----------------------PELWVG--VGLILFIAIVIWAKA--
ATPF_SORC5       NEAAAKGGINAL-----LWRYHNEQNPCDPKNEPPPFLASV--LNFGLLALIVVRFGR--
ATPF2_ACICJ      AMAEGKMPQMDF----------------SNPLTGAQVVWMA--VIMVVLYFVLARWAL--
ATPF1_GRABC      SPEHEGMPQLNF----------------ANPLTTSQVVWMA--LILLAFYLLLSKWAL--
ATPX_RHOCA       AEAAEKGGMPQL----------------DFSTFPNQIFWLL--LALGAIYWLLKNIAI--
ATPF_BRUME       GHGSGVFPPFDS------------------THYASQVLWLA--ITFGLFYLFLSRVVL--
ATPF2_METRJ      EAHSGAFPPFET------------------SGFLAQLIWLA--LAFGLLYYLMDKIAL--
ATPF_MYCPE       SQIINQIFPNVY-----------------------VLIAHV--ISLIFLLLLVIRLAW--
ATPF_PELUB       PQLNPEFWVS-------------------------QIFWLI--ITFGILYVVLSKLIL--
ATPF_MYCH7       GDLFKGIIPNVY-----------------------VLGATI--VSFLVLFLFITYFVY--
ATPF1_PROA2      ------MLIDWF-----------------------TVIAEL--VNFLILVWLLKRFLY--
ATPF_MYCA5       TKTFGNLTINWP-----------------------FFVFSF--LTLILVVTIVTLLVY--
ATPF_MYCGE       SSVINELFPNFW-----------------------VFITHL--LAFFILLTLMIFLFW--
ATPF_PELPD       WASEAGEGAHQV----------------DSAAQMKDFGWRV--LNFAVLAALLGWAIA--
ATPF_KORVE       ASHAAEGEEEAGEHMELKHSTMVKTLAKWLGVSVETSYWIAMAFNFAIVFALLGWAMK--
ATPF_SOLUE       EGARESLAEKAD---------EAGNKAHAAEEEGSMDIWKW--ANFLILAGGLGYLVG--
ATPFD_MYCLE      ----------MS-----------------------TFIGQL--VGFAAIVYLVWWYVV--
ATPX_CHLRE       AAEAGKIFDFNL-----------------------TLPVMA--GEFLLLMVFLEKTWF--
ATPF_CLOAB       ------MEFNLV-----------------------TIGFTI--VNFIILMLILKHFFF--
ATPF_BACSU       LPLELGLSFNGG-----------------------DILFQL--LAMLILLALLKKYAL--
ATPF_STAEQ       NTFILGAGVEWG-----------------------TTFVTL--VTFVILIILLKKFAW--
ATPF_STRPF       --MSITFGELVG-----------------------NFILVT--GSVIVLLLLIKKFAW--
ATPF_LACJO       QFMFAALKLELG-----------------------DTLYYL--LIFAALLLLVKHFAW--
ATPF_LACP3       --------MTLG-----------------------DTLFTL--VTFLVLMLAVGKVAW--
ATPF_MYCTU       GGESSNFLIPNG-----------------------TFFVVL--AIFLVVLAVIGTFVV--
ATPF_MYCLE       EGKSSNFLLPNG-----------------------TFFFVL--AIFLVVLGVIGTFVV--
ATPX_PHATC       VSGPGGLFDFNA-----------------------TLPLVA--IQFILLMVLLNILLY--
ATPX_VAULI       VEKPGGLFDFDG-----------------------TLPLIA--IQFLILMFLLNILLY--
ATPX_GALSU       LLAAGGLFDFDA-----------------------TLSFIA--LEFLLLTSVLNLIYY--
ATPX_NOSP7       ------MFDFDA-----------------------TLPFMA--LQFLLLAAVLNAIFY--
ATPX_SYNP6       QEAEGGLFDLDA-----------------------TLPLMA--VQILVLVFLLNAVFY--
ATPX_PROMP       GATEGGLFDINA-----------------------TLPLMA--IQVVALTYILNSLFF--
ATPX_PAUCH       GVPEGGLFDLDA-----------------------TLPLMA--IQVVFLTFILNAIFF--
ATPF_THEMA       ----MGFLEINW-----------------------TSAAML--MLFVLMVYFLNKFLY--
ATPF_FUSNN       ----MPIISIDY-----------------------TFFWQI--INFFLLLFIVKKYFK--
ATPF_BUCBP       -------MDFNV-----------------------TIVGQA--ISFVLFVFFCMKYVW--
ATPF_PARPJ       -------MNLNA-----------------------TLFAQM--VVFLILAWFTMKFVW--
ATPF_BURVG       -------MNLNA-----------------------TLFAQM--VVFLVLAWFTMKFVW--
ATPF_XANC8       -------MDITL-----------------------TIFAQA--LAFAGLIWIVATKIW--
ATPF_HAEIN       -------MNLNA-----------------------TLIGQL--IAFALFVWFCMKFVW--
ATPF_SHEON       -------MNFNA-----------------------TLIGQT--VAFIIFVWFCMKFVW--
ATPF_ECOLI       -------MNLNA-----------------------TILGQA--IAFVLFVLFCMKYVW--
ATPF_CORDI       EDHPSVLLPASY-----------------------DIVWSL--VVFIIVLILFWKFVR--
ATPF_BIFAA       ASEMELFLPKSY-----------------------DIFWSL--VILIIVAVFFYKFFL--
ATPF_MICLC       AEGANPLIPNPW-----------------------EILVVV--VGFALLMFIVIKFIV--
                                                                 .           

ATPF_RICPR       --KA---ILNALDTKISEIQEKVLKAKKLKEDAALLFEQTKLQIQKLETLRSQMIEESDK
ATPF_RICBR       --KA---ILKSLDMKVLEVQERVLKAEKLKDDAKLLFEQTEEQIKNLEALQLQMTKENNE
ATPF_BIGNA       --EA---LSDTLENRKQTIIDSLQNSNKKVYIVKNKLVEVKSKLELTQTEVENVYSSRFS
ATPF_HELPJ       --KR---LRSFLHSKSLEISKRLEEIQAQLKVSKEHKKKLLKELEQAKEKAELIISDANK
ATPF_HELPY       --KK---LRSFLRSKSLEISKRLEEIQAQLKVSKENKKKLLKELEQAKEKAELIVSDANK
ATPF_NITSB       --EP---IKRFFQERKEGIAKRLEEVEAKLKEAKEEKAQAEAELKKAKELAQEIVETAKQ
ATPF_CAMHC       --GP---IKNAYNARINRISSRLEAIQTKLKESKEKKEASKKNLEDVKQKCVELIETAKK
ATPF_CAMC1       --KP---LKALYQSRIDRIANKLESIQEKLRESKAKKDDVLKRVEEAKQNANALIETAKK
ATPF_BDEBA       --DA---IVSFFAGRKAAYLEAAQKSAFAREQAEKEFVDIKNKLANLDQTREENLRKAQT
ATPF_AQUAE       --KP---ISEAFNKFYNSIVESLVNAEREFMMAREELSKAKEELENAKKKAQEYEKLAIE
ATPF_EUGGR       --LT---LSDLLKTRKKTIIKNILDIDEKIRSSQSSLYLAELEFENAAKKASLIRSNGTT
ATPF_SYNJB       --KV---VGEALAKRREGILEELRQAEQRKREAIERLAEEQQKLAQAQQEAERIRKQAEA
ATPF_PROMP       --GF---LGKMLQKRREGILLELKDAEDRLLKATQALEKAKTDLSLAEEKAGQIKADSLK
ATPF_SYNPX       --GF---LGGILDRRRQAILQELQDAETRLKTATEELSKAQSDLAAAQQKADKIRVDGEA
ATPF_OSTTA       --DT---LTSMLDTRREKILGSLRSADDRFKQAQLELDTAKAELATANDKVKDIKSEGRK
ATPF_OEDCA       --KN---FSILLENRQQTILNNLREANQRASEALERYNQAKKQLELAEKKAKDIRQEGTL
ATPF_CUSGR       --GF---LRDFLDTRKNRIVNTIQISDELYSGAVEKLEKAQARLCKVEKEAKQLRVTGYS
ATPF_ORYSJ       --GV---LKDLLDNRKQRILSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGYS
ATPF_VITVI       --GV---LSDLLDNRKQRILNTIRNSEELREGAIEQLEKARARLRKVEMEADQYRVNGYS
ATPF_ARATH       --GV---LNDLLDNRKQRILNTIRNSEELREGAIQQLENARARLRNVETEADKFRVNGYS
ATPF_LOBMA       --GV---LNDLLDNRKQRILNTIRNSEELREGAIQQLENARARLRKVEAEADQFRVNGYS
ATPF_CYACA       --RT---IVTNLNDRKLNIQCSILEAEKKLSQAQLRLAEAEKKITESEEIISILKHEAKI
ATPF_CYAM1       --QV---VGEILVQRQQQVKEALEEASNRLKLAEQQLKTAQEEWSQTQEQINQIEEEANQ
ATPF_HETA4       --DV---LGSILSARKASILDKIEEADKKLNEADKRFTEARLQWSQANIFGEDLEKKTYQ
ATPF_VAULI       --GL---LKDNLSSRQENILSTIQNSENRINEANERLVDAKLQWSQAQITLEELKNQTLQ
ATPF_ANTSP       --QF---LGSLLTIRQEKVIFAISECEERLQQANNRLLESEKQLEQTQLVITQVLNDAEI
ATPF_PHATC       --DF---LGSLLEERKTTIVKGVQDAEDRLNEAQKRLNEAQKQLNQANLVISEIRNETIA
ATPF_THAPS       --DF---LGSILQERKSTIVKSVQDAEDRLNEANRRLSEAQKQLSQAHVVISEIRNETKT
ATPF_ACHLI       --KP---ITRYLEQRQEALSKELHEAAHERERVAQIRYELQTEYEVMRKEARQMKDTLMS
ATPF_HYPNA       RMGAFKTILGGLDTRASNIRKELEEAASLREQAAEALALAERRAQDADKEAEAIIDQAKR
ATPF_SPHWW       --PSV--IGASLDKKIASIRANLDEAAALRADAEKLKAEYEAKAKAAAKEAEEMLAHARS
ATPF_PHEZH       --KAHKAIAAALDAKAASIQANLDEAARIRDEARRLLEGLQAERAEAERQAKEMLATAEV
ATPF_CAUVC       --LPGA-LFGALDGYAAKIKAELDEAQQLREEAQALLADVKAQREDAERQAAAMLEAAKA
ATPF_CAUSK       --PAM--IAGKLDETAAKIQTDLDEAARIRAEAEALLATIRAEREETERQAIAMLAAAKA
ATPF_SORC5       --KP---IAEALKKRKQTITQELDNASRLKQEAELRLEEYEDKLTRLEETLAELKAEHAA
ATPF2_ACICJ      --PR---IGGVIENRHNRIATDLETARRAKAEAEHAVRELNLAIQNARESSQGAIAEAVN
ATPF1_GRABC      --PQ---VSQVVDDRNASIMGDLDSAHLAKAEANAAVEEMNDAIRRANLEGQAEIEKTVS
ATPX_RHOCA       --PR---IAAILADRAGTISGDLAAAEQYKLKAKDAEAAYAKALADARAQAQKIIAETRA
ATPF_BRUME       --PR---IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQARSKAASIAEAARE
ATPF2_METRJ      --PR---IQSILHARAERLRADLDQAQAMKAEADAAGVAFETALRDAQGKARDIAQTTRN
ATPF_MYCPE       --KP---TKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAEL
ATPF_PELUB       --PK---ISANLENRKSQILENIEAAEKQREESEQKIEEYEKIVQSSKNEAKNYFKQARE
ATPF_MYCH7       --RP---LKKYIKKRKDFLQNHIDLTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQI
ATPF1_PROA2      --EP---VLKAIDEREKKIASELQHAADVEKEAESRLIELQRKNEAFDNAHAQMIKDAEQ
ATPF_MYCA5       --KP---LKKMLKNRQNFIQNNIDESIKAKEAALKVQEEIDEKIIESSKHANQIIEQAKL
ATPF_MYCGE       --KP---TQRFLNNRKNLLEAQIKQANELEKQARNLLEESNQRHEKALIVSKEIVDQANY
ATPF_PELPD       --KAQ--VKKALNERQVKIERSLREAEQSRDAAEQKLREYSGKLEHASREIEEMRGAMLR
ATPF_KORVE       --KN---LPGVFKARNESIQRGIAEARAASDDAKRRLADIEARLSKMDGEVAAIRAVTEK
ATPF_SOLUE       --KN---AGPFFAARSAGIRKDMENSLAQQKDAEARAADVDRRLANMEADIAALRGEGER
ATPFD_MYCLE      --PP---VCRLMRARRDAVRQQLTEAAEAADRLVEASQAHTKATEDAKVEAQRVVKEAVE
ATPX_CHLRE       --TP---VGKVLDERDNLIRSKLGSVKDNTGDVDKLVLEAETILKSARSDVSAMINTKKA
ATPF_CLOAB       --DK---VNKVIDDRNNEVALTIKKADAQNEEARLLKVESEKNLEDSKLQGKTIVENYKV
ATPF_BACSU       --GP---LLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKK
ATPF_STAEQ       --GP---LKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKETQDEVQKILDDAKI
ATPF_STRPF       --GA---IESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKE
ATPF_LACJO       --GP---VTKMMEERRQKVISDLDQAESDRKKAELLANQREAALKDSKQEATQILSTAKS
ATPF_LACP3       --KP---VSKMMADRQQKISGDLDYAEKSRKDADALVAKRQEELQHSQADAVKIVNQAKE
ATPF_MYCTU       --PP---ILKVLRERDAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARA
ATPF_MYCLE       --PP---ILKVLQERDAMVAKTDADSKMSAAQFAAAQADYEAAMKEARVQSSFLRDNARV
ATPX_PHATC       --NP---LLTIIEERKEYILTNLGKASELLSEANKLTQQYEQELDNVRKEAQLEITNSQK
ATPX_VAULI       --TP---LLKIIDERSEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQN
ATPX_GALSU       --QP---ISKVIDSREDYIRENLNKASLYLDQANELTKKYELELITARKEAIKMVTTSQT
ATPX_NOSP7       --KP---LTKVLDDRDSYIRTNTLEARESLAKAERLATEYEQQLADARRQSQATVEAAQL
ATPX_SYNP6       --KP---FGKVLDDRDQFVRGGRQDAKARLAEVKALTAQYEQELAATRKQSQALIAEAQT
ATPX_PROMP       --KP---VGNVVEKREKFVSNNIMDAKNKLSEVEKLEADLLSQLQSARYEAQKIVSEAEN
ATPX_PAUCH       --RP---IGRTVEERENYVASSRADAKQKLAQVERLEANLTEQLRGARKQSQTVIAEAEE
ATPF_THEMA       --TP---FIEMAEKRRKKVEEDLKSAEQLKEEAEKMRSEAERFLSEARQRADEIVESARK
ATPF_FUSNN       --EP---ISKIINERKQKIEAELVEATKNKKEAEQLLKDAEAQINASRKEATEIVKAAQR
ATPF_BUCBP       --PS---VIFIIETRQKEIKDSLTFIENSKKELNIFKENSKNEIKIIKKNASKIIDSAIQ
ATPF_PARPJ       --PP---LINALDERSKKIADGLSAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEK
ATPF_BURVG       --PP---LINALDERSKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEK
ATPF_XANC8       --PP---LLKAIEERQQKIAEGLAAADRSQKDLAQAQEKVNEALKDARTKANEIIDQAHA
ATPF_HAEIN       --PP---IINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKLQAQDILDAANK
ATPF_SHEON       --PP---LMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANK
ATPF_ECOLI       --PP---LMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANK
ATPF_CORDI       --PK---YQEVLTEREDRIKGGIQRAEAAQAEAKAALEKYNAQLAEARAEAAEIREEARA
ATPF_BIFAA       --PK---FQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLSNARVEASKIRDDARA
ATPF_MICLC       --PT---LEKSYQDRVEAIEGGLAKAEKAQAEANAMMADYESQLADARTEANRIREDART
                                                                             

ATPF_RICPR       ATKQIIQDKTKEMEEFLERKKADAIQLIQNQKSTASKDLQDEFCDEVITLVSKYFRSAKL
ATPF_RICBR       ITEKIVQEKTKEIEEFLEHKKVETIKLIESQKLLASKELQDEFSDEVVKLVSEYFHS-TK
ATPF_BIGNA       YFKTRKQTLLEQVQSYLTQLQSLQKDSIEGQTKKVLSDVYDTTISKTFDTLYINLAS-AF
ATPF_HELPJ       EAYTITQKYELQTKMDVENLIKNSKALMDLEVKKIKRELVESVFKDLRESKKVSFNA---
ATPF_HELPY       EAYMITQKYELQTKMDVENLIKNSKALMDLEVKKIKRELVESVFKDLRESKKVSFNA---
ATPF_NITSB       EIEILTKEIKEQAKQEIEMLEKSFEESMELEKRKRVRAITKEVLEELFEEKALELEK---
ATPF_CAMHC       EAIQLDEKIQQSAQIDIAQMQKSFAEQKEFEIRRLKKSVTAEILDELFNEKSVNLSQ---
ATPF_CAMC1       EAVNLAAKVKKEAQNDIANIEKGYKEQKEFEERKMTKGVVNEILSDIFSSDSLKVDQ---
ATPF_BDEBA       HAEDLKKQILEEANDVTKRIKNDAELTARLEVQRAQKELRTQLLQDSVEAARIVLTK-DL
ATPF_AQUAE       TAETEKKKILQHAQEVSERIKEKAKETIEIELNKAKKELALYGIQKAEEIAKDLLQK-EF
ATPF_EUGGR       FCLKSFDIIRSSVNEDIKRLKQSKRLILRTEDKKSVREIFKNLYSQACQKAKATIIK-RL
ATPF_SYNJB       NAEARRQELLEQAEREVERLRANAEKELSSEQERVFQELRRQIVRQALSKVEQELPQ-HL
ATPF_PROMP       RSESIRMESEKKAIEEMARIKQSAISDESSEASRAISQLRKEAVELAIKKALDSLPN-RL
ATPF_SYNPX       RAAAIRSDGEQRTIAAMAAVKQGAAADADAEAARIKDILRREAALAAIDKVLSDLPS-RL
ATPF_OSTTA       TLEALTAEQSSRMAEVATRFAGLKDETIRLEEEKAIAQFRKQLVNVAFEKAIVGIQS-QM
ATPF_OEDCA       KARQEKENCFNQYKLDLVRLEEYKQETLQFYQQKAFQQIYVSIVSRALGEVKQKFNK-PL
ATPF_CUSGR       EIEQEKLNLINSTYKTLERLEKKKKETCSFEQQRAINDVRQWVLQQTLQRVLKTLNG-SL
ATPF_ORYSJ       EIEREKANLINATSISLEQLEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNS-CL
ATPF_VITVI       EIEREKLNLINSTYNTLEQLENYKNETIHFEQQRAINQVRQRVLQQALQGALGTINS-CL
ATPF_ARATH       EIEREKLNLINSTYKTLKQLENYKNETILFEQQRTINQVRERVFQQALQGAIGTLNS-CL
ATPF_LOBMA       EIEREKLNLINSTSKTLKQLENYKNETILVEQQRTINQVRERIFQQALQGAIGTLNS-CL
ATPF_CYACA       AANKIKELIVNNAKRKIDKIILDGKTIIANTEIEIMNQIKNRIISTAIDKTKIKLTK-NL
ATPF_CYAM1       TAQVVKEYWLKQANEAIAQLKTKTQQSLSQASRQVAKQIRQTLIELAIEKVKQT------
ATPF_HETA4       RINAFHESQNLKNKDALLREYFSTLVVLDLKNEQVQKQVRNYVMELALIEVYGVFTK-LV
ATPF_VAULI       NKLILFNAEFEIKNQVLSQHFNNLLMTLYYREQQAFNNIKKQVSELALKKVIAKLQA-PL
ATPF_ANTSP       TAQKVRQSILDKGKIDVEKLIGASKASIVVAENQINQQIKQKITALAIQKVSSQLKA-QV
ATPF_PHATC       TKKVLLESEVFGAKKDLKIRFERALAMFKSKERQIFLEIKQQIISLVLKRTVIRAQQ-AF
ATPF_THAPS       AKTNLLKSDATTAKKELTTRFNRAISSFRSKERVIFLDVKQQIISLVLKRSAIQAKE-TF
ATPF_ACHLI       EAQLEKERIISDARNEAKRRIQQVDRDVQQELRLQSEKIRENIKNIAFDVAEKIVSH---
ATPF_HYPNA       DAKAMLEEARRDLAEKISRREAQAAARITRAETEATSEVRRAAADAATAAARRILSE---
ATPF_SPHWW       EAEAIVSQARVDATALIERRGKMAEDKIAAAERGAVAEVRAKAASAAAAAAGALIAE-RN
ATPF_PHEZH       QVRQFEAEAKAKLEEAIERRRRMAEQKIATAEAQAAAEVKAAAAELAAQMAESVLAQ-RL
ATPF_CAUVC       DAKRLAEEAKEKLEEQIKRRAEMAERKIAQAEAQAAADVKAAAVDLAAQAAETVLAA-RL
ATPF_CAUSK       DVAQMEIEAKAKLEDQIKRRAEMAERKIAQSEAQAQADVKAAAVDLAAQIAEQVLMA-RL
ATPF_SORC5       QAEVEKAHVLAEAEQRRVRMRRDAEFRAEQELKAARAMLLQEAVQNAVVAAEELLRQ-RI
ATPF2_ACICJ      AAKERARAQTAALNDRLSAQIASAEAEIDSARRTAVGALAPIARDVASSLLQRLIGE---
ATPF1_GRABC      AAKAKAQQEAAEAHARLERQLADAEARIASSRDTAMGALRDVATDTTQALIARLTGQ---
ATPX_RHOCA       VIQKDLDAATAKADADIAARVAQSEVKIAEIRAGALEAVQIVATDTATAIVTALGGK---
ATPF_BRUME       KGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETMATIVEQLLGL---
ATPF2_METRJ      ELAAEAETKRKALEDELNAKLSASEATIRTRTEAAMGNVRTIAGEAASAIVERLTGQ---
ATPF_MYCPE       DAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSK-KI
ATPF_PELUB       KVLKDIGVKREILEKELDEEVNKAEIEIKTFRDNAPEKIKKIAVETSSDLLQELIGA-EV
ATPF_MYCH7       EANKFLEDAKKTAIDNARQLINEGQKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQDK
ATPF1_PROA2      EAVEEKRTLLNEAHREYDALRMRLQETLKHEETSLESRVTGRISAEVFSIARKVLQD--L
ATPF_MYCA5       ERERIINNGIEVSNKKAEIIIEQANILVTKSQAEFENKQRKIIVENAVEIAKKIIGR-EI
ATPF_MYCGE       EALQLKSEIEKTANRQANLMIFQARQEIEKERRSLKEQSIKESVELAMLAAQELILK-KI
ATPF_PELPD       ESEQEKQRIIAEARAAAEKIAGQATLSAEHEVLKARSALQAEAGRLAVQLAATKLAG-AI
ATPF_KORVE       ESAAEEVRIREAAEADVKRILESAENEIDAATKQARRDLKSLAAGLAIDLATRKLHV---
ATPF_SOLUE       AARAEAERMEQHTAAEIAKIQQHSEQEIASAGKAARMDLKRYAAELAVELAEQKVRA-RM
ATPFD_MYCLE      DAKRIVEQLQAQADVEAERIKLQGARQVELLRAQLTRQLRLKFGHESVRQAAELVRN-HV
ATPX_CHLRE       AKQSELDKTYNEAKAKITAEVESSIAGLEQESASMLKSLDAQVDKISAEVLKRVLPE-GV
ATPF_CLOAB       KAEKVSEEITAEAKTEAQNILERAKRETQREKEKAEDEIKNQVVELAVLISSKALEN-SI
ATPF_BACSU       LGEKQKEEIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEK-EL
ATPF_STAEQ       QARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVSELSVLIASKVLRK-EI
ATPF_STRPF       IGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGA-NL
ATPF_LACJO       NAEKTKNNIISQADQEAAAIRKRASEDAAQAKTDALNEARDQVADISVAIAEKVISK-NL
ATPF_LACP3       NGEKLRQSLVDAANAEVTTMKKNAQTEIDQARKDALASAKNDVADLSLTIAQKLIGK-EL
ATPF_MYCTU       DGRKVIEDARVRAEQQVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGV---
ATPF_MYCLE       DGRKSIEEARVRAEQHVVSTLQIAGEQIKRERDAVELDLRAKAGAMSLILASRILGV---
ATPX_PHATC       IHKEILEVELNISQKYIDNLLDTIQKDLLAKKNIALNSLDEIVQSLCVDIEARL----SI
ATPX_VAULI       LHKNILEIEIISSQKIFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA----
ATPX_GALSU       EAQEFVNAQISQAQKEAQQLIQSSMMQFEKEKNKAIYSLEKQVEQLSEQIKNKLISI-YI
ATPX_NOSP7       EAKKITAEKIAEAQKEAQSQREQASVEIEQQKQQAFSTLEQQVDALSRQILEKLLGPTPV
ATPX_SYNP6       EAGRIAAQQLAEAQREAQAQREQAQQEIDQQKAVALQALDQQVDALSHQILDKLLAR---
ATPX_PROMP       ESDKLYKEALALANDEANASKEKARLEIENQTSSARDQLFKQADDLSELIVNRLILE---
ATPX_PAUCH       EVNRLYQEALRMAQAEANNIRESSRREIEIQKAAAIKSLQGDVDRLSNLIVDRLLAS---
ATPF_THEMA       EAEAIVEEAREKAKKEAQNIVESAKTQIEVEYKKALEQVQERAAELSVILATKLLQK-VF
ATPF_FUSNN       KAEEEAHNLIREARENRENILKTTELEITKIKNDAKEELGREVKNLAAELAEKIIKE-KV
ATPF_BUCBP       QKTQILKQAYLAAEKEKQTILKQAKLDVMIEYQKARYELRQKVSKIAVEIAKKIINR-SI
ATPF_PARPJ       RAVAVADEIKAQAQAEAARIIAQAKADAEQQVVKARETLRGEVAALAVKGAEQILKR-EV
ATPF_BURVG       RAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKR-EV
ATPF_XANC8       RANQIIEAAKLEAIAEANRQKDLAQAEIDASATRAREELRRQVSSLAVSGAEKLLKR-EI
ATPF_HAEIN       RRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGR-SI
ATPF_SHEON       RKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILER-SI
ATPF_ECOLI       RRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIER-SV
ATPF_CORDI       KGKQIEAEMKAKATEESNRIIESGEKQLAAQREQVVTELRREMGQNSISLAERLLGD-QL
ATPF_BIFAA       EASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGVLATALAGKILGS-KL
ATPF_MICLC       EAAEIVAEARERATAEATRVFEQAQAQIAAERQQAAAQLKREVGSLATTLAGKIVGE-SL
                                                                             

ATPF_RICPR       SE----KSIAKNLMDKSDFVHNDSKATYLH----------
ATPF_RICBR       NN----NLSETDIAKNLMDKV-------------------
ATPF_BIGNA       KKSGNFSNKKKAITYSYLKRLN------------------
ATPF_HELPJ       ----------QDCVNILKQRL-------------------
ATPF_HELPY       ----------QDCVNILKQRL-------------------
ATPF_NITSB       ----------EKFVNLIVKKVA------------------
ATPF_CAMHC       ----------NELINLVQKKVV------------------
ATPF_CAMC1       ----------KELVNIILKKVS------------------
ATPF_BDEBA       -G----SSDQQKLQKDFINNVGV-----------------
ATPF_AQUAE       KK----SKVQEKYIEAQLKLLEERKNA-------------
ATPF_EUGGR       -N----SKIHKKIILKKMEKMSLKKLKPKY----------
ATPF_SYNJB       -N----EEVHRSLIEKGIQMIAR-----------------
ATPF_PROMP       -D----QTTQENLVTQSINNIEMN----------------
ATPF_SYNPX       -D----DQAQARLIDSTITNLENA----------------
ATPF_OSTTA       -N----ASLHRKYIDAKISLMTSRL---------------
ATPF_OEDCA       -S----EQFHATINNFVIARLTEYNP--------------
ATPF_CUSGR       -N----PELHLHTIRVNISMLGTLK---------------
ATPF_ORYSJ       -N----TELHFRTIRANISILGAMEWKS------------
ATPF_VITVI       -N----KELHLRTISANIGMFGSMKEIRNN----------
ATPF_ARATH       -S----NELHLRTINANIGMFGTMKEITD-----------
ATPF_LOBMA       -S----NELHLRTINANIGMFGTMKKITD-----------
ATPF_CYACA       -Q----AETIERITDNKITFLNNNL---------------
ATPF_CYAM1       ------PIDGSQILDRHISLLSYHEAKNR-----------
ATPF_HETA4       AN----KKFQENYSNYSVLLLEKLIGEK------------
ATPF_VAULI       -M----EEDQSVIIINKIHRLGGNLE--------------
ATPF_ANTSP       -D----TTMQAKIIDSSIIKLRGDI---------------
ATPF_PHATC       AP----KERATTLINDTINKLEGDLL--------------
ATPF_THAPS       GS----KKRARALINETIQKLEGDLL--------------
ATPF_ACHLI       -------QVTDENIDEVIDEMLDEKL--------------
ATPF_HYPNA       -------QTSVDQFEAAARDIERALS--------------
ATPF_SPHWW       -N----AKADKALIDGAIDALGNARF--------------
ATPF_PHEZH       -T----GAKADPLVDRAIGQLASKLQ--------------
ATPF_CAUVC       -A----GAKGDTLVDAAIGQMGAKLQ--------------
ATPF_CAUSK       AA-----GGSDGLVDTAIGQIGAKLQ--------------
ATPF_SORC5       -G----QQDLDRVNEDYLKAIPAAVSAGARRGAQTTGAAT
ATPF2_ACICJ      -------AVEPGRIEQAVSALSTQG---------------
ATPF1_GRABC      -------FPAQDTVEQAVGQALAARS--------------
ATPX_RHOCA       --------ADMGALNAAVGQRVKG----------------
ATPF_BRUME       -------TADKASVSEAVKAIRASNA--------------
ATPF2_METRJ      -------APDRTSLDRALDATAH-----------------
ATPF_MYCPE       -D----EEENKKIIDDIVNDLTAKLESSSKEK--------
ATPF_PELUB       NS----SSISAIVEDLSRKKMDEYYGN-------------
ATPF_MYCH7       NN----KILQQSLIADLEKELRKRENSSKKKDNFGK----
ATPF1_PROA2      SG----SSLEAQIADVFCQRLRESDPEDVAA>--------
ATPF_MYCA5       RD-----KDNLKMIEEMLES--------------------
ATPF_MYCGE       -D----QKSDREFIDKFIRDLEANETEDD-----------
ATPF_PELPD       -G----KEDHDLYVDDYLKKVEQFK---------------
ATPF_KORVE       -D----QQTDESLVRSFVAQLGKDGK--------------
ATPF_SOLUE       -T----PETQDALVQGFVRNLK------------------
ATPFD_MYCLE      AD----AVQQSATVDRFLDDLDAMTPKGADVEYPL>----
ATPX_CHLRE       RV--------------------------------------
ATPF_CLOAB       -N----EAEHRKLIEDFVSKVGI-----------------
ATPF_BACSU       -D----EQAQEKLIQDYLKEVGESR---------------
ATPF_STAEQ       -S----EQDQKELVEKYLKEAGDK----------------
ATPF_STRPF       -D----KTAQSQLIDSYLDDLGEA----------------
ATPF_LACJO       -S----AADQKDLVDQFIKGLND-----------------
ATPF_LACP3       -N----ADDQKGLIDDYIKRLGDANGSH------------
ATPF_MYCTU       -----------DLTASAATR--------------------
ATPF_MYCLE       -------DITASVVTR------------------------
ATPX_PHATC       ----------------------------------------
ATPX_VAULI       ----------------------------------------
ATPX_GALSU       ----------------------------------------
ATPX_NOSP7       R---------------------------------------
ATPX_SYNP6       -A--------------------------------------
ATPX_PROMP       -K--------------------------------------
ATPX_PAUCH       -R--------------------------------------
ATPF_THEMA       QD----ERARREYLVKILKEEIEKS---------------
ATPF_FUSNN       -D----DAQEISLIDKFIAEVGEDK---------------
ATPF_BUCBP       -C----IEEQNSIISSLIKKI-------------------
ATPF_PARPJ       -D----QAAHADLLNQLKAEL-------------------
ATPF_BURVG       -D----QTAHAQLLNQLKAEL-------------------
ATPF_XANC8       -D----ATAHKALLDELAAEI-------------------
ATPF_HAEIN       -D----EAANNDIIDKLVAEL-------------------
ATPF_SHEON       -D----PAAHSDIVNKLVAEI-------------------
ATPF_ECOLI       -D----EAANSDIVDKLVAEL-------------------
ATPF_CORDI       SD----DVKRSGTIDKFLAELDTVSPAGK-----------
ATPF_BIFAA       ES----DDVQSTMIDQMIAELDSDKK--------------
ATPF_MICLC       ED----DARSQRVVDRFLADLDRHQSAGVAE---------