CLUSTAL format seed alignment for MF_01399

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPF2_NOSS1       ------------------------------------------------------------
ATPF2_TRIV2       ------------------------------------------------------------
ATPF2_NOSP7       ------------------------------------------------------------
ATPF2_CROS5       ------------------------------------------------------------
ATPF2_RIPO1       ------------------------------------------------------------
ATPF2_MICAN       ------------------------------------------------------------
ATPF2_GLOC7       ------------------------------------------------------------
ATPF2_SYNY3       ------------------------------------------------------------
ATPF2_TRIEI       ------------------------------------------------------------
ATPF2_SYNP2       ------------------------------------------------------------
ATPF2_SYNP1       ------------------------------------------------------------
ATPF2_THEEB       ------------------------------------------------------------
ATPF2_ACAM1       ------------------------------------------------------------
ATPF2_SYNE7       ------------------------------------------------------------
ATPF2_SYNJA       ------------------------------------------------------------
ATPF2_SYNJB       ------------------------------------------------------------
ATPF2_GLOVI       -----------------------------------------------------MDMLFDP
ATPF2_PROMA       ------------------------------------------------------------
ATPF2_PROM4       ------------------------------------------------------------
ATPF2_PROM1       ------------------------------------------------------------
ATPF2_PROMM       ------------------------------------------------------------
ATPF2_PROM3       ------------------------------------------------------------
ATPF2_PROMS       ------------------------------------------------------------
ATPF2_PROM9       ------------------------------------------------------------
ATPF2_PROM0       ------------------------------------------------------------
ATPF2_PROM2       ------------------------------------------------------------
ATPF2_PROM5       ------------------------------------------------------------
ATPF2_PROMP       ------------------------------------------------------------
ATPF2_PAUCH       ------------------------------------------------------------
ATPF2_SYNS9       ------------------------------------------------------------
ATPF2_SYNR3       ------------------------------------------------------------
ATPF2_RHDSA       ------------------------------------------------------------
ATPF2_GUITH       ------------------------------------------------------------
ATPF2_PORPU       ------------------------------------------------------------
ATPF2_PYRYE       ------------------------------------------------------------
ATPF2_ANTSP       ------------------------------------------------------------
ATPF2_GRATL       ------------------------------------------------------------
ATPF2_EMIHU       ------------------------------------------------------------
ATPF2_CYAM1       ------------------------------------------------------------
ATPF2_GALSU       ------------------------------------------------------------
ATPF2_TRICV       ------------------------------------------------------------
ATPF2_PHATC       ------------------------------------------------------------
ATPF2_THAPS       ------------------------------------------------------------
ATPF2_VAULI       ------------------------------------------------------------
ATPF2_CYACA       ------------------------------------------------------------
ATPF2_CYAPA       ------------------------------------------------------------
ATPF2_SPIOL       MANMLVASSSKTLPTTTTTTITPKPKFPLLKTPLLKLSPPQLPPLKHLNLSVLKSAAITA
V4MC07_EUTSA      MANSIMASSK---PLIFLSSNQP-SRVQIPKLAKLPQIPKSISS-SELRTKALSLSSATV
Q84PA4_ORYSJ      MATAMMAATA-----TSCSPRRA-----PVVASSSVQPPRRQQQQQPRR-GLKQLPGLVA
F2CZS6_HORVV      MATAMMAAAT-----TSCSPRRAL--LKPVASSSSAPPPR----PQPRS-FLKQLPGLAA
C5WPC6_SORBI      MATAMMAAST-----TSCSPRRAAPVLKPVASSSSSSSSS---SARPRRPLAQQLPRLLA
ATPF2_CHLRE       MASLLARPQQ-----------------AVVRAAKPAAARPLRLVVRASAQKPQQQLAQLA
E1ZQ70_CHLVA      MQALTLARPA-----------------AAFTASRQAARRVVLCAAQPKQAPVKLELPAIV
                                                                              

ATPF2_NOSS1       ---MTHWITLLAVEKVAK--EGGLFDLDATLPLMAIQFLLLALILNATLYKPLGKAIDGR
ATPF2_TRIV2       ---MTHWITLLAVEEVAK--EGGLFDLDATLPLMAIQFLLLALVLNATLYKPLGKAIDGR
ATPF2_NOSP7       -----------------------MFDFDATLPFMALQFLLLAAVLNAIFYKPLTKVLDDR
ATPF2_CROS5       -----------------------MFDFDATLPLMALQFVLLAIILNAIFYKPLNKALDER
ATPF2_RIPO1       -----------------------MFDFDATLPVMALQFILLAVILNGIFYTPLNKALDER
ATPF2_MICAN       -----------------------MFDFDATLPVMALQFILLAVILNAVFYKPLSKVLDER
ATPF2_GLOC7       -----------------------MFDFDATLPLMALQFLVLAVVLNAVFYKPLGKALDSR
ATPF2_SYNY3       -----------------------MFDFDATLPLMALQFVVLAFLLNAIFYKPMNKVLDER
ATPF2_TRIEI       ---MINLTIVLAVEEVAE--KGGLFDINATLPLMAIQFLLLAFVLDKIFYKPLGKAIDSR
ATPF2_SYNP2       ---MTHWTIVLATEAVEKTAEGGLFDFDATLPVMAIQFLVLAALLNKLFYKPIGQAIDDR
ATPF2_SYNP1       --MVGKASYVRFPLLFRPILERLMFDFDATLPLMAVQFLILTVILNALLYKPLGQALDNR
ATPF2_THEEB       -----------------------MFDFDATLPLMAVQFLILTVILNALLYKPLGQALDNR
ATPF2_ACAM1       -----------------------MFDFNGTLPLMMFQFFLLVAVLNAVFFKPLTQAIDER
ATPF2_SYNE7       -----MNAWMILAAEAVQEAEGGLFDLDATLPLMAVQILVLVFLLNAVFYKPFGKVLDDR
ATPF2_SYNJA       -------MICSTLLAVEAAEKNGLFDLDATLPIIAVQFLLLVAVLNSLFYEPVTRVIDSR
ATPF2_SYNJB       -------MFFPTLLAVEAAEKGGLFDLDATLPLIAIQFLLLVAVLNSLFYEPVTRAIDSR
ATPF2_GLOVI       GWAAHLLLLAAEEAAAAEAESGGLFDFGGTLVLQIVNFLLLMTILSAVFYGPISRVIEER
ATPF2_PROMA       ----------MTSLLLFGASEGGLFDFDATLPLMAAQVVLLTFILNALFFKPVGRVVEDR
ATPF2_PROM4       ----------MTSLLLFGASEGGLFDFDATLPLMAVQVVLLTFILNALFFKPVGRVVEER
ATPF2_PROM1       ----------MPTLFLFGASEGGLFDFDATLPLMAVQVVLLTFILNALFFKPVGRVVEER
ATPF2_PROMM       ----------MTSLLLFGA--GGLFDFDATLPLMALQVVLLTFILNALFFRPVGRVVEER
ATPF2_PROM3       ----------MTSLLLFGA--GGLFDFDATLPLMALQVVLLTFILNALFFRPVGRVVEER
ATPF2_PROMS       ----------MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKR
ATPF2_PROM9       ----------MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKR
ATPF2_PROM0       ----------MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKR
ATPF2_PROM2       ----------MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGKVVEKR
ATPF2_PROM5       ----------MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGKVVEKR
ATPF2_PROMP       ----------MLAFDFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKR
ATPF2_PAUCH       -------MTSWLLLAEAGVPEGGLFDLDATLPLMAIQVVFLTFILNAIFFRPIGRTVEER
ATPF2_SYNS9       --------MTWLLLAEAGVPEGGLFDLDATLPLMAVQVVLLTFLLNALFFRPVGKVVEDR
ATPF2_SYNR3       -------MHSWLLLAEAATPKGGLFDLDATLPLMAVQVVVLTFVLNALFFRPVGKTVEDR
ATPF2_RHDSA       ---MTNSLFLLA--------EGGLFDFNATLPLMVLQILLLMVVLNAIFYTPIARVLDER
ATPF2_GUITH       ---MTNYLYILALQIAEAESEGGLFDFNATLPLMAVQILLFMVILNAVFYNPVAKVLDER
ATPF2_PORPU       ---MIYLPL-----LLAEEIEGGLFDFNGTLPLMALQFLILMLLLNTIFYKPVTKILDER
ATPF2_PYRYE       ---MIDLPF-----LLAEEIEGGLFDFNGTLPLMALQFLTLMVLLNTIFYKPVTKVLDER
ATPF2_ANTSP       ---MNNFLISLALQESSTEVQGGLFDFNATLPLMALQFLALTIILNLIYYKPLGKILDER
ATPF2_GRATL       ---MIVFPF-LLFQMLSTEVEGGLFDFNATLPLMALQFIILTTILNFIFYKPVTNVLDER
ATPF2_EMIHU       ---MNNLIMLVTNAVTLSEAAGGLFDFNATLPLQALQFILLTVLLTFIFYKPIGKLLEER
ATPF2_CYAM1       -------------------MSTGLFDFNGTLPVMGLQVVLLSWLLEQILYSPIQGVIQKR
ATPF2_GALSU       ---MQYQYI----NSYSLLAAGGLFDFDATLSFIALEFLLLTSVLNLIYYQPISKVIDSR
ATPF2_TRICV       ---MVNLSIIIS--SSEVNGPGGLFDINATLPLVAIQFLLLMVLLNVILYSPLLTIIEER
ATPF2_PHATC       ---MINISMLIS--NSEVSGPGGLFDFNATLPLVAIQFILLMVLLNILLYNPLLTIIEER
ATPF2_THAPS       ---MINLSILIS--SSEVSGPGGLFDINATLPLVAIQFILLMVTLNIILYSPLLTIIEER
ATPF2_VAULI       ---MLKFSFLFL--TVEK--PGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDER
ATPF2_CYACA       ---MQDILNIYL--SSEE--SGGLFDFDATLPLMASQFLLIMLILDITFYKPINKVLKDR
ATPF2_CYAPA       ---MTQWIIWLAIETEAAKPEGGLFDFDATLPVMMVQLLVLMLILNAVFYKPLIKILDER
ATPF2_SPIOL       TPLTL-SFLLPYPSLAEEIEKASLFDFNLTLPIIMAEFLFLMFALDKIYYTPLGDFMDKR
V4MC07_EUTSA      KSLAL-IAAFAPPSMAEAMEKAQLFDFNLTLPIIVVEFLFLMFALDKLYYSPLGNFMDQR
Q84PA4_ORYSJ      TAAVA-VAAAPLPALAEQMEKAALFDFNLTLPLIATEFLLLMVALDKLYFTPLGKFMDER
F2CZS6_HORVV      TAAAAAVASVPLPALAVEMEKAALFDFNLTLPAITIEFLLLMVALDKLYFSPLGKFMDER
C5WPC6_SORBI      TAAAA-VAAAPLPVLAEQMEKAQLFDFNLTLPAIATEFLLLMVALDKLYFTPLGKFMDER
ATPF2_CHLRE       KPALSAIVANALMAMPAAAEAGKIFDFNLTLPVMAGEFLLLMVFLEKTWFTPVGKVLDER
E1ZQ70_CHLVA      KPAALTALSNVILSMPAHAEAGKIFDFNFTLPIMVGEFLLLMVFLDKFWFGPVGAVLDAR
                                         :**:. **     :.. :   *    : *.   :. *

ATPF2_NOSS1       NEYVRNNQLEAQERLSKAEKLAEAYEQELAGARRQAQTIIADAQAEAQKIAAEKVAAAQK
ATPF2_TRIV2       NEYVRNNQLEAQERLSKAEKLAEAYEQELAGARRQAQTIIADAQAEAQKIAAEKVAAAQK
ATPF2_NOSP7       DSYIRTNTLEARESLAKAERLATEYEQQLADARRQSQATVEAAQLEAKKITAEKIAEAQK
ATPF2_CROS5       ADYIRQNETGGQQQLAEAKELAAKYEQQLAQARKESQDIVAQAQAEAKQLATEAVAEAQK
ATPF2_RIPO1       ADYIRQKETDEKERLAKAKELAQEYEKQLADARKQSQEVIAAAQADAQKIAAEALAKAQK
ATPF2_MICAN       AEYIRQTESGAKEQLAKTEALVQEYELQLSSARKQSQEIIAQAQAEAQKLASERVAAAQK
ATPF2_GLOC7       ADYIRSNENQAREQLAKAQNLAQEYEKQLGDARRQSNEIIAAAQAQAKQIADEKIAQAQK
ATPF2_SYNY3       ADYIRTNEEDARERLAKAKAITQEYEQQITDARRQSQAVIADAQAEARRLAAEKIAEAQR
ATPF2_TRIEI       ADYIRENQVKAKERLAKAKQLAEQYEQEFAQTRQKSQVVIVAAQAEAEKIAATKVAVAQK
ATPF2_SYNP2       SDYIRTNLVDAKERQQKAEDLAAQYEQELRDVRREAQDVIAKAQAEAQKVVADEVKSAQA
ATPF2_SYNP1       DEYIRTNLQQAKERLQQATELANQYEQELAYTRREAQAIIEEARAEAQKIATAEIAAAQQ
ATPF2_THEEB       DEYIRTNLQQAKERLQQATELAQQYEQELASTRRQAQALIEEARVEAQKIATAEIAEAQQ
ATPF2_ACAM1       DGFIRTNNTEARERLAKAKSLTEQYEQELAGTRKQSQQVLADAQAEAQKIAQTQITEAQK
ATPF2_SYNE7       DQFVRGGRQDAKARLAEVKALTAQYEQELAATRKQSQALIAEAQTEAGRIAAQQLAEAQR
ATPF2_SYNJA       NDYIRTTQAEAQERLDKAMALTRQYEAEIGQARLQAQQVIAEAEAAAARIRSEKLAAAQA
ATPF2_SYNJB       NDYIRTTQAEAQERLDKAVSLTRQYESEISQARLQAQQVIAEAEAAAARIRSEKLAAVQA
ATPF2_GLOVI       SEYIRSNAGSAQRRFDEAKALADQYEQELRTTRLEAQQVIAAAEAEAQKIRAQQLAEAQR
ATPF2_PROMA       EDYVLTSRAEAKKKLAEVEKLENDLKNQLKEARKAAQQVISEAEEDSEKLYKEALNLANS
ATPF2_PROM4       EDYVTSSLADAKKKLAEVEKLESDLKNQLKEARLAAQSVINEAETDSENLYREALALATA
ATPF2_PROM1       EDYVNTSRAEAKKKIAEVELLETELKDQLKEARLEAQKVILEAEQDSENLYKEALALATS
ATPF2_PROMM       EVYVTTSRAEAKQKLAEAEKLELELKEQLKSARIAAQQLIQEAEKDSEQLYREALAIANA
ATPF2_PROM3       EVYVTTSRAEAKQKLAEAEKLELELKEQLKSARIAAQQLIQEAEKDSEQLYREALAIANA
ATPF2_PROMS       EKFVSNNIIEAKNKLSEVKKLEADLLTQLQSARTEAQRIVSEAENESDKLYKEALELANN
ATPF2_PROM9       EKFVSNNIIEAKNKLSEVKKLEAELLTQLQSARTEAQRIVGEAENESDKLYKEALELANN
ATPF2_PROM0       EKFVSNNVIEAKNKLSEVKKLEADLLTQLQSARTEAQRIVSEAEDESDKLYKEALELANN
ATPF2_PROM2       EKFVSDNIIEAKNKLSEVEKLEADLLTQLQSARTEAQRIVSEAENESDKLYKEALELANN
ATPF2_PROM5       EKFVSNNIMEAKNKLSEVEKLEADLLSQLQSARSEAQKIVSDAENESDKLYKEALELANN
ATPF2_PROMP       EKFVSNNIMDAKNKLSEVEKLEADLLSQLQSARYEAQKIVSEAENESDKLYKEALALAND
ATPF2_PAUCH       ENYVASSRADAKQKLAQVERLEANLTEQLRGARKQSQTVIAEAEEEVNRLYQEALRMAQA
ATPF2_SYNS9       EGFISTSRADAKQKLAQVERLEADLAEQLKGARQAVQSVIVDAEQEVDGLYREALAQAEA
ATPF2_SYNR3       EGYISTSRAQAKEKLAQAERLEAELKAQLLDARKQSVAVIQKAEEEVDRLFREALAVAQS
ATPF2_RHDSA       DEYIRKNLTQASETLAKAEAITKQYEQDLAKERRDAQMIIASSQQEAQEIVAMEIKQAQK
ATPF2_GUITH       EEYIRKNLTQASDILAKAEAITKQYEKDLAQERREAQLIISVAQKEAQDIVALEIKQAQK
ATPF2_PORPU       DEYIRTTLTTASSMLVKADELAAKYEEDLSKARRDAQAKIAASQKDAQSIVSEDIKKAQM
ATPF2_PYRYE       DEYIRTTLTTASSMLVKADELAAKYEEDLSEARRNAQLKIASSQKEAQNIVSEDIKKAQL
ATPF2_ANTSP       DEYIANSLTAASAALSKANDLTKRYEQDLAESRKKAQDIIKNAQQDAQNIVSSKIKEAQK
ATPF2_GRATL       DEYIRNSLTTASASLVKADELTKTYEQQLAESRKKAQDIIKVAQEQAQQIVSVKIKDAQA
ATPF2_EMIHU       ETFISNNLAEASAKLLKADELCEQYETQLKEAKTGAQDVIAKAESEAKGIVAQEITQARA
ATPF2_CYAM1       QNKIQQELQLAADQLQKAQQLTQEYQTQLQKAREKARERIRQVQQEAQTMMEDQLKQAQQ
ATPF2_GALSU       EDYIRENLNKASLYLDQANELTKKYELELITARKEAIKMVTTSQTEAQEFVNAQISQAQK
ATPF2_TRICV       KEYILNKLAKASEILSQANELTAQYEQELNTVRKEAQLEITNSQKIHKEILEIELNISQK
ATPF2_PHATC       KEYILTNLGKASELLSEANKLTQQYEQELDNVRKEAQLEITNSQKIHKEILEVELNISQK
ATPF2_THAPS       KEYVLSHLAQASEKLAQAKELTTQYEQDLETARKEAQLEIANSQNIHKEILDIELDISQK
ATPF2_VAULI       SEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQK
ATPF2_CYACA       ENYILKTLESATQISEKTKETLARYEEVILKSKKESQQLIDSIKTKTEHDIVNELIQTQN
ATPF2_CYAPA       KEYIQSNFNEAEKCLAQAAELTTQYETKITDARQNASKLTNTTRSEIQRFVSEKLEEAQK
ATPF2_SPIOL       DASIKEQLSGVKDTSSEVKQLEEQANAVMRAARAEISAALNKMKKETQLEVEAKLAEGRK
V4MC07_EUTSA      DSAIKEKLASVKDTSTEVKALDEQAAAVMRAARAEIAAALNKMKKETQVEVEEKLAEGRK
Q84PA4_ORYSJ      DAKIRAELGGVKDASEEVRQLEEQAAAVLKAARAEIAAALNKMKKETTQELEAKLDEGRR
F2CZS6_HORVV      DAKIRAELGGVKDASEEVRQLEEQAQAILKAARAEIAAALNKMKKETTKELEAKLDEGRR
C5WPC6_SORBI      DAKIRGELGDVKDASEEVKQLEDQAAAIMKAARAEIAAALNKMKKETTAELEGKLEEGRS
ATPF2_CHLRE       DNLIRSKLGSVKDNTGDVDKLVLEAETILKSARSDVSAMINTKKAAKQSELDKTYNEAKA
E1ZQ70_CHLVA      DAELRGKLGLVKGNGAEIARLQEEAQRIITDAHAAAQKQVAEAKAVVSAECAKELAEAKA
                     :            .           :   :          .                

ATPF2_NOSS1       EAQAQREQAAGEIEQQKQQALASLEQQVDALSRQILEKLLGADLVKQR
ATPF2_TRIV2       EAQAQREQAAGEIEQQKQQALASLEQQVDALSRQILEKLLGADLVKQR
ATPF2_NOSP7       EAQSQREQASVEIEQQKQQAFSTLEQQVDALSRQILEKLLGPTPVR--
ATPF2_CROS5       EAIAKKEAAAQEIEQQRQEALKTLEQQVDTLSRQILEKLLGPELVK--
ATPF2_RIPO1       EAQAKKEEAAVEIAQQRQAALGVLEQQVDVLSRQILEKLLGPELVK--
ATPF2_MICAN       EAIARKEAVAAEIAQQKEEAFRSLEGQVASLSRQILEKLLGPELVR--
ATPF2_GLOC7       EAQAQKEAAAKEIEQQKQEAMTALEQQVDALSRQILEKILGSELVK--
ATPF2_SYNY3       ESQRQKETAAQEIEAQRQSALSSLEQEVAALSNQILHKLLGPELIK--
ATPF2_TRIEI       EAQVKREQAAQEIEKQKEVALEQLEEQVDSLSRQILEKLLGPELVR--
ATPF2_SYNP2       EALAEREKAALEIEAQRESAFKSLEQQVDSLSQAIASKLVGAKL----
ATPF2_SYNP1       ALQAELMKAQAEIDQQKQATLQALEGQVSSLSEQLLAKLLA-------
ATPF2_THEEB       AVQAELLKIQAEIDQQKQATLQALEGQVASLSEQLLAKLMA-------
ATPF2_ACAM1       QVQAEVMKAQAELESQKQSAFSELEKQVDTLSQQILNKLLGSTLA---
ATPF2_SYNE7       EAQAQREQAQQEIDQQKAVALQALDQQVDALSHQILDKLLARA-----
ATPF2_SYNJA       EIQAKLEAARRQIEQEKQTALEQLQQQVDAIAAQITEKLLGSAR----
ATPF2_SYNJB       EIQQKLEAARLQVEQEKQAALEQLQQQVDAIAAQITQKLLGSAR----
ATPF2_GLOVI       EAQERIAQAQADLDKQKQAALASLSGEVEAISRTLSEKLLSDSARRF-
ATPF2_PROMA       EANASREQARREIDSQRDSALKKLKSDSDKLGDLIVERLLAAK-----
ATPF2_PROM4       EANASREEARREIDSQRESALNQLRSDAEKLGDLIVERLLASK-----
ATPF2_PROM1       EANASREKARREIDSQRDEALNQLKSEADNLGDLIIERLLAKK-----
ATPF2_PROMM       DANAAREKARREIDAQRDSALSQLKGDAEKLGDLIVNRLLAAK-----
ATPF2_PROM3       DANAAREKARREIDAQRDSALTQLKGDAEKLGDLIVNRLLAAK-----
ATPF2_PROMS       EANASKEKARLEIESQTSAARDQLSKQADDLSELIVNRLILEK-----
ATPF2_PROM9       EANASKEKARLEIESQTSAARDQLSKQADDLSELIVNRLILEK-----
ATPF2_PROM0       EANASKEKARLEIESQTSAARDQLSKQADVLSELIVNRLILEK-----
ATPF2_PROM2       EANASKEKARLEIESQTSAARDQLSKQADDLSELIVNRLILEK-----
ATPF2_PROM5       EANASKEKARLEIENQTSSARDQLFKQADDLSELIVNRLILEK-----
ATPF2_PROMP       EANASKEKARLEIENQTSSARDQLFKQADDLSELIVNRLILEK-----
ATPF2_PAUCH       EANNIRESSRREIEIQKAAAIKSLQGDVDRLSNLIVDRLLASR-----
ATPF2_SYNS9       EANRTKEESRRGIEAERESARAQLKGKVDQLSTTIIDRLLAA------
ATPF2_SYNR3       EANSVREKARGEVDAEKAKAFSGIDSQAEKLSSLIVDRLLAA------
ATPF2_RHDSA       DTELLVNEATTQLNSQKEKALQALEKQVNTLSEQIKNKLLSGQLAG--
ATPF2_GUITH       DTELLVNEATSQLNSQKQKALSALEDQVNTLTEQIKSKLLSNQLIS--
ATPF2_PORPU       NAEKLITEASKQLNIQKEEALKTLEDQVDTLSDQIKTKLLSSQSLK--
ATPF2_PYRYE       NAEKLIAEASKQLNVQKEEALKTLENQVDTLSDQIKVKLLSSQS----
ATPF2_ANTSP       DADQLMSNTYDQLNIQKEQALQNLEKQVDILSNQIQIKLLGN------
ATPF2_GRATL       YGEKLVSEAFHQLSIQKEDALKTLEMQVDTLSDLIKSKLLND------
ATPF2_EMIHU       DAASLIAQTNKELEAQKKLALQQLETQIDELSQLIKEKLLGKVVL---
ATPF2_CYAM1       QMTQLFNEAMQQLEQQKQQALMNLSNQVDEVAKFILSKLMKQ------
ATPF2_GALSU       EAQQLIQSSMMQFEKEKNKAIYSLEKQVEQLSEQIKNKLISIYI----
ATPF2_TRICV       YIDNLLENITDDLLEKKNTALNSLDTIVQSLCVQIENRLSI-------
ATPF2_PHATC       YIDNLLDTIQKDLLAKKNIALNSLDEIVQSLCVDIEARLSI-------
ATPF2_THAPS       YIDNLLETISSDLLNKKKTALDSLDTIVTSLCTEVETKLSI-------
ATPF2_VAULI       IFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA-------
ATPF2_CYACA       STREFISKSIKELYRKKEQTLKVLEEDTENLSDKIYLKLINPKQ----
ATPF2_CYAPA       KADSELASATNKLELQKDEALKSLESEVQTLSTKILEKLLGIQIANT-
ATPF2_SPIOL       KIEVELQEALGSLEQQKEDTIKSLDSQISALSDDIVKKVLPVS-----
V4MC07_EUTSA      KVEAELQEALLSLEKQKEETIKALDSQIAALSEDIVKKVLPS------
Q84PA4_ORYSJ      RVEAELVEALANLEAQKEEAVKALDAQIASLSDEIVKKVLPSA-----
F2CZS6_HORVV      RVEAELVEALASLEGQKEEAIKALDAQIVSLSDEIVKKVLPSA-----
C5WPC6_SORBI      RVEAELVEALANLEAQKEEAVKALDAQIASLSDEIVKKVLPSA-----
ATPF2_CHLRE       KITAEVESSIAGLEQESASMLKSLDAQVDKISAEVLKRVLPEGVRV--
E1ZQ70_CHLVA      KVDAELSRALATLEAEKAAAMKGLDAQVDKLSADILGRVLPEGVRV--
                              .  :       :      :   :  ::