CLUSTAL format seed alignment for MF_01400

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MSRB_BRUME       --------------------MKYQKSAEA-----------IAKLSAEQYRVTQENGTERP
MSRB_BRUSU       --------------------MKYQKSAEA-----------IAKLSAEQYRVTQENGTERP
MSRB2_RHIME      --------------------MTYRKTDEE-----------VSKLTPEQYRVTQQNGTERP
MSRB_DEIRA       --------------MTQDTKTDFQKPSDND---------LRERLTPIQYQVTQHEGTERA
MSRB_BACHD       ----------------------MTE-QNEE---------LKKKLTPLQYEVTQNNGTEPP
MSRB_BACSK       ----------------------MTKPQKDE---------LKKKLTPIQYFVTQENGTEPP
MSRB_BACSU       -----------------------MAYNKEE---------KIKSLNRMQYEVTQNNGTEPP
MSRB_LISMF       ----------------------MDESKKNE---------RLQQLTDIQYNVTQKAGTERP
MSRB_LISMO       ----------------------MDESKKNE---------RLQQLTDIQYNVTQKAGTERP
MSRB_LISIN       ----------------------MDESKKNE---------RLKQLTDIQYNVTQKADTERP
MSRB_HATHI       --------------MNHKKEKEYKKLDTEK---------LKENLTELQYNVTQRNATEKP
MSRB_CLOPE       --------------------MKYTKKEKEE---------LKKVLTEEEYYVTQENGTERP
MSRB_MYCGE       -------------------MSKYQKKSEAE---------LKRTLTKLQFDVTQNAHTEPP
MSRB_MYCPN       -------------------MSKYQKKSDGE---------LKRTLTKLQYDVTQNAHTEPP
MSRB_STAAM       ----------------------MLKKD-------------KSELTDIEYIVTQENGTEPP
MSRB_STAAN       ----------------------MLKKD-------------KSELTDIEYIVTQENGTEPP
MSRB_STAAR       ----------------------MLKKD-------------KSELTDIEYIVTQENGTEPP
MSRB_STAAS       ----------------------MLKKD-------------KSELTDIEYIVTQENGTEPP
MSRB_STAA8       ----------------------MLKKD-------------KSELTDIEYIVTQENGTEPP
MSRB_STAAW       ----------------------MLKKD-------------KSELTDIEYIVTQENGTEPP
MSRB_STAES       ----------------------MIKKN-------------KEELNDMEYLVTQENGTEPP
MSRB_STAEQ       ----------------------MIKKN-------------KEELNDMEYLVTQENGTEPP
MSRB_STAHJ       ----------------------MIKKD-------------KNELNEMEYLVTQENGTEPP
MSRB_STAS1       ----------------------MIKKN-------------KNDLNEMEYLVTQENGTEPP
MSRB_CLOAB       ----------------------MKKDD------------LSKKLTPLQYEVTQNNATEPP
MSRB_LACLA       ----------------------MEKEK------------LKKKLSLLAYRVTQENGTEAP
MSRB_ENTFA       ----------------------MTKPTEEE---------LKQTLTDLQYAVTQENATERP
MSRB_LACPL       ----------------------MDK-QQGE---------LRQRLTPEQYAVTQEAATERP
MSRB_STRA3       -----------------------MKETQEE---------LRQRIGHTAYQVTQNSATEHA
MSRB_STRA5       -----------------------MKETQEE---------LRQRIGHTAYQVTQNSATEHA
MSRB_STRP1       ------------------------METSDE---------LKQRIGDLSYEVTQHAATESP
MSRB_STRP3       ------------------------METSDE---------LKQRIGELSYEVTQHAATESP
MSRB_STRP8       ------------------------METSDE---------LKQRIGDLSYEVTQHAATESP
MSRB_STRP6       ------------------------METSEE---------LKQRIGDLSYEVTQHAATESP
MSRB_AGRFC       ------------MSDLTSPKVNKSDADWRE------------QLTPEQYHILREHGTERP
MSRB1_RHIME      ------------MSENRMPKITKTNEEWRA------------ALTPEQYRVTREHGTERP
MSRB_THEEB       -----------------MTKVVKTDAEWQA------------QLTPEQYYVTRKKGTERA
MSRB_PSEPK       -----------------MKKIEKTLDEWRS------------MLDPEQYQVCRLKGTERP
MSRB_PSESM       -----------------MDKLQKTLEEWKE------------MLDPAQYSVCRLKGTERP
MSRB_PSEAE       -----------------MSKIDKPLDSWRE------------ELTEEQFHICRLGGTERA
MSRB_METTH       MKDRIPIFSVAKNRVEMVERIELSDDEWRE------------ILDPEAFRVARKAGTEPP
MSRB_LEPIC       ----------------MNYEVNKSDEDWKK------------ELTPEQYRILRQKGTEMA
MSRB_LEPIN       ----------------MNYEVNKSDEDWKK------------ELTPEQYRILRQKGTEMA
MSRB_BRADU       --------MPDAKTKTTDDKVIKSEEQWRR------------ELSPIQYAVLREKATERP
MSRB_XYLFA       -------------MNVAFDLTPPSPSQREA---------LIATLNAEEHRILLQHGTEAP
MSRB_XYLFT       -------------MNVTFDLTPPSPSQREA---------LIATLNAEERRILLQHGTEAP
MSRB_CAUVC       ------MTDAATLSTAGFDLTPPTEAERER---------LEANLTAEEARVLLHHGTEAP
MSRB_ECOLI       -----------------MANKPSAEELKK-------------NLSEMQFYVTQNHGTEPP
MSRB_ECO57       -----------------MANKPSAEELKK-------------NLSEMQFYVTQNHGTEPP
MSRB_ECOL6       -----------------MANKPSAEELKK-------------NLSEMQFYVTQNHGTEPP
MSRB_SHIFL       -----------------MANKPSAEELKK-------------NLSEMQFYVTQNHGTEPP
MSRB_SALTY       -----------------MANQPSAEELKK-------------KLSEMQFYVTQDRGTEPP
MSRB_SALTI       -----------------MANQPSAEELKK-------------KLSEMQFYVTQDRGTEPP
MSRB_YERPE       -----------------MAKELNPTENIE-------------KLSDIQRYVTQERGTEAP
MSRB_YERPS       -----------------MAKELNPTENIE-------------KLSDIQRYVTQERGTEAP
MSRB_PECAS       -----------------MTNDSASHTPSDNT-----------EMTEMQRYVTQQRGTEPA
MSRB_PASMU       -----------------MKKRE--------------------DMTEMQVHVCLNQGTEYP
MSRB_VIBVU       ---------MHKKSSTLIRKREISDVTKESKVVLKSDQQWREQLSEQEYHVCREQGTEPP
MSRB_VIBVY       ---------MHKKSSTLIRKREISDVTKESKVVLKSDQQWREQLSEQEYHVCREQGTEPP
MSRB_VIBPA       ---------MPK-----IVKKEPKFVEQSGKKVTKSDEQWREQLSDEEFRVCREQGTEPP
MSRB_VIBCH       ---------MVSEA---ISKKEIERVKFESKDLHKPDEYWREHLTEEAFYVCRQQGTEAP
MSRB_RALSO       ------------------MTIEKTDAEWRD------------QLSDIEYRVTREAATERP
                                                            :      :     ** .

MSRB_BRUME       GTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTELTDMSHGMVR
MSRB_BRUSU       GTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTELTDMSHGMVR
MSRB2_RHIME      FTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCGWPSFTKPIVPANVNELRDNSHGMIR
MSRB_DEIRA       FTGEYWDHDEDGIYVDVVSGEPLFSSLDKYDAGCGWPSFTQPIPDVALTENTDYKIGYAR
MSRB_BACHD       FRNEYYDLEAEGIYVDIVSGKPLFSSKDKYDAGCGWPSFTKPIDEEEVIEKEDRSHGMFR
MSRB_BACSK       FQNEYYETEEEGIYVDVVSGKPLFSSKDKYDAGCGWPSFTKPIDEAEIIEKEDRSHFMVR
MSRB_BACSU       FQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPI-EEEVEEKLDTSHGMIR
MSRB_LISMF       FQNEFYDNEAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEHRDLTHGMIR
MSRB_LISMO       FQNEFYDNEVKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEHRDLTHGMIR
MSRB_LISIN       FQNEFYDNVAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEHRDLSHGMIR
MSRB_HATHI       FLNKYDKHFEDGIYVDIVSGEPLFLSIDKFNSGCGWPAFSKPISRKYIKERADFSHGMSR
MSRB_CLOPE       FTNEYWDFNGEGIYVDITTGEPLFTSKDKFHSSCGWPAFSKPIDRSIIKEKVDKSHGMIR
MSRB_MYCGE       YINEYNRNFEKGIYVDITSGEPLFISTDKFKSGCGWPAFSKPIDKNLIANYRDESHGMIR
MSRB_MYCPN       YTNEYNRHYEKGIYVDITSGEPLFISTDKFKSGCGWPAFTKPISQDLIANYRDESHGMIR
MSRB_STAAM       FMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMVR
MSRB_STAAN       FMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMVR
MSRB_STAAR       FMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMVR
MSRB_STAAS       FMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMLR
MSRB_STAA8       FMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMLR
MSRB_STAAW       FMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMLR
MSRB_STAES       FQNEYWNHFEKGIYVDKLSGKPLFTSEDKFESNCGWPSFSKALNDDEIVELVDKSFGMIR
MSRB_STAEQ       FQNEYWNHFEKGIYVDKLSGKPLFTSEDKFESNCGWPSFSKALNDDEIVELVDKSFGMIR
MSRB_STAHJ       FQNEYWNHFDKGIYVDKISGKPLFTSEEKFESNCGWPSFSKSIDDDEIIELVDKTFGMIR
MSRB_STAS1       FQNEYWNHFEKGIYVDKISGKPLFTSEEKFESDCGWPSFSKALADEEIVELVDKTFGMVR
MSRB_CLOAB       FNNEYWDNKSEGIYVDIISGKPLFTSLDKFDSGCGWPSFTKPIVKENIKANTDFSYNMKR
MSRB_LACLA       FANEFDDFFEQGLYVDVVSGEALFTSLDKYQSGCGWPAFTQPIDKGVVKEKRDKSLFMER
MSRB_ENTFA       FSGEYDDFYQDGIYVDIVSGEPLFSSLDKYDAGCGWPSFTKPIEKRGVKEKADFSHGMHR
MSRB_LACPL       FSGEYDNFYQEGIYVDVVSGQALFSSRDKYDAGCGWPSFTKPIDQTNLNEHRDESFGMHR
MSRB_STRA3       FTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSGCGWPAFSKPIENRMVTNHQDHSHGMHR
MSRB_STRA5       FTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSGCGWPAFSKPIENRMVTNHQDHSHGMHR
MSRB_STRP1       FTGEYDNFFEKGIYVDIVSGEVLFSSLDKFNSGCGWPAFSKPIENRMVTNHDDSSYGMRR
MSRB_STRP3       FTGEYDDFFEKGIYVDIVSGEVLFSSLDKFNSGCGWPAFSKPIENRMVTNHDDSSYGMRR
MSRB_STRP8       FTGEYDDFFEKGIYIDIVSGEVLFSSLDKFNSGCGWPAFSKPIENRMVTNHDDSSYGMRR
MSRB_STRP6       FTGEYDDFFEKGIYVDIVSGEVLFSSLDKFNSGCGWPAFSKPIENRMVINHDDSSYGMRR
MSRB_AGRFC       FTGPYWNSTEKGLYRCAACDEPLFLSDTKFDAGCGWPSYFEPVKPGAVTEHRDSTHGMVR
MSRB1_RHIME      FTGPFLDNKRHGTYKCVCCGRALFRSDTKFDSGCGWPSYFAPVDPDAIAEYVDRSHLMVR
MSRB_THEEB       FTGCYWNNKKPGLYSCVCCGTPLFRSETKYDSGTGWPSFWQPLDPNNIRMERDLSHGMVR
MSRB_PSEPK       FSGKYNSERRDGIYHCICCGLPLFDAQTKFDAGCGWPSFYAPIEDSAMIEIRDTSHGMIR
MSRB_PSESM       FSGKYNDTKTAGVYHCICCNEALFDSTTKFDSGCGWPSFYAPLEGSAVVEVRDVSHGMIR
MSRB_PSEAE       FSGEYHATKTPGIYHCTCCGTALFDSDAKYDSGSGWPSYFQPVDAEAVRELDDFSHGMHR
MSRB_METTH       FTGKYHDLHDDGIYRCICCGTDLFDSETKFDSGTGWPSFYDVVSEHNIKLREDRSLGMVR
MSRB_LEPIC       FTGALYKNQDKGTYVCAACGAVLFSSDTKYESGSGWPSFYQPVKDGVVDKQKDSSHGMER
MSRB_LEPIN       FTGALYKNQDKGTYVCAACGAVLFSSDTKYESGSGWPSFYQPVKDGVVDKQKDSSHGMER
MSRB_BRADU       FSGEYEHDHRAGTYVCAGCGNVLFESDAKFDSGCGWPSFTQPAVESHVDEERDVSHGMIR
MSRB_XYLFA       FCNRLLDNNQLGTYTCRFCGLPLFHSNAKFKSGTGWPSFFEPYTHAHIRKQHDTSHGMIR
MSRB_XYLFT       FCNRLLDNNQLGTYTCRLCGLPLFHSNAKFKSGTGWPSFFEPYTHTHIRKQHDTSHGMIR
MSRB_CAUVC       FCGGLLGEKSPGVYGCRLCGLPLFKHETKFESGTGWPSFYAPFAEDHVVGVRDTSYGMVR
MSRB_ECOLI       FTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQR
MSRB_ECO57       FTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQR
MSRB_ECOL6       FTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQR
MSRB_SHIFL       FTGRLLHNKRDGVYHCLICDAPLFHSETKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQR
MSRB_SALTY       FTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFYQPVSEEAIRYIDDFSHGMQR
MSRB_SALTI       FTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFYQPVSEEAIRYIDDFSHGMQR
MSRB_YERPE       FTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQPIDADSIRYIDDYSHNMHR
MSRB_YERPS       FTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQPIDADSIRYIDDYSHNMHR
MSRB_PECAS       FSGKLLHNKRTGAYHCLCCQAPLFYSDSKYDSGCGWPSFDQPVSSEAVRYLEDESHNMRR
MSRB_PASMU       FTGKLLDQQKKGLYRCVVCHSPLFVSDTKFDAGCGWPSFFQAISPEAIRYLDDYTLSRPR
MSRB_VIBVU       FSGKLLHNKDSGEYACTCCHAPLFSSVNKYDSGCGWPSFDAPINETAVLYLDDFSHGMKR
MSRB_VIBVY       FSGKLLHNKDSGEYACTCCYAPLFSSVNKYDSGCGWPSFDAPINETAVLYLDDFSHGMKR
MSRB_VIBPA       FSGKLLHNKETGVYACTCCNAPLFISDNKYDSGCGWPSFDAPLNNEAIRYLEDLSHGMVR
MSRB_VIBCH       YSGKLLHNKDTGLYHCTCCQSALFSSENKYDSGCGWPSFDAPINEQVIRFLDDFSHGMVR
MSRB_RALSO       FTGRYWDHWARGIYHCVCCGTPLFESSTKFDAGCGWPSYFAPINGEVIAEKTDHSHGMVR
                   .        * *        **    ::.:  ***::        :    * .    *

MSRB_BRUME       TEVRSAHGDSHLGHVFPDGPVDRGGLRYCINSASLRFVPKDRMEAEGYGDYLDQVEG---
MSRB_BRUSU       TEVRSAHGDSHLGHVFPDGPVDRGGLRYCINSASLRFVPKDRMEAEGYGDYLDQVEG---
MSRB2_RHIME      TEVRSAHGDSHLGHVFPDGPQDRGGLRYCINSAALRFIPREEMEAEGYGGYFNQVEDI--
MSRB_DEIRA       TEVRSASADSHLGHVFPDGPRDRGGLRYCINSAALRFVPLSELDAQGYGQYRALFEGRQG
MSRB_BACHD       TEVRSKQADSHLGHVFPDGP-GPNGLRYCINSAALRFIPKADLEKEGYGKYKALFD----
MSRB_BACSK       TEVRSKNADSHLGHVFPDGP-GPNGLRYCINSAALRFIPKAKLKEAGYGAYEKLFD----
MSRB_BACSU       TEVRSRTADSHLGHVFNDGP-GPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNK---
MSRB_LISMF       TEVKSADADSHLGHVFPDGPQDKGGLRYCINSAALRFIPVDKLEEEGYQAYKKIFE----
MSRB_LISMO       TEVKSADADSHLGHVFPDGPQDKGGLRYCINSAALRFIPVDKLEEEGYQAYKKIFE----
MSRB_LISIN       TEVKSVEADSHLGHVFPDGPQDQGGLRYCINSAALRFIPVDKLEEEGYQTYKKIFE----
MSRB_HATHI       IEVRSKNADSHLGHVFNDGPIENGGMRYCINSASLKFIAKDKLKEEGYEEFLPLFEKDKQ
MSRB_CLOPE       TEVRSKLGDSHLGHVFCDGPEELGGLRYCINSASLKFIPKEELKEKGYEEYLELFK----
MSRB_MYCGE       TEVRAKNSDSHLGHVFNDGPSELGGLRYCINSAALKFIPFEEMEKLGYKDYIHLFKNK--
MSRB_MYCPN       TEVRAKNSNSHLGHVFRDGPEEHGGLRYCINSAALKFIPFAEMESAGYGEYLKLFKESN-
MSRB_STAAM       TEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK---
MSRB_STAAN       TEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK---
MSRB_STAAR       TEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK---
MSRB_STAAS       TEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK---
MSRB_STAA8       TEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK---
MSRB_STAAW       TEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK---
MSRB_STAES       TEVRSEKANSHLGHVFNDGPKEKGGLRYCINSAAIQFIPYDKLEELGYGDLIKHFKK---
MSRB_STAEQ       TEVRSEKANSHLGHVFNDGPKEKGGLRYCINSAAIQFIPYDKLEELGYGDLIKHFKK---
MSRB_STAHJ       TEVRSEDANSHLGHVFNDGPKESGGLRYCINSAAIQFIPYDKLEELGYGDLIPHFEK---
MSRB_STAS1       TEVRSEDANSHLGHVFNDGPKESGGLRYCINSAAVQFIPYEKLEELGYGDLIPHFEK---
MSRB_CLOAB       IEIRSKDSDSHLGHVFDDGPKDKGGLRYCINSASLKFIPKEALEEEGYGEYLKLFNKKEE
MSRB_LACLA       TEVRSSNADSHLGHVFTDGPLDKGDLRYCINSAALRFVPFDQLEAEGYGEYVKYFS----
MSRB_ENTFA       VEVRSQEADSHLGHVFTDGPLQEGGLRYCINAAALRFVPVADLEKEGYGEYLSLFK----
MSRB_LACPL       TEVTSTQANSHLGHVFPDGPRDRGGLRYCINSAALKFIPVADLEKAGYGQYQSLFK----
MSRB_STRA3       IEVRSRQADSHLGHVFNDGPVDAGGLRYCINSAALDFIPYDQMAKRGYGDYLSLFD----
MSRB_STRA5       IEVRSRQADSHLGHVFNDGPVDAGGLRYCINSAALDFIPYDQMAKRGYGDYLSLFD----
MSRB_STRP1       VEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAALKFIPYDQMEKEGYAQWLTLFDET--
MSRB_STRP3       VEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAALKFIPYDQMEKEGYAQWLTLFDET--
MSRB_STRP8       VEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAALKFIPYEQMEKEGYAQWLTLFDET--
MSRB_STRP6       VEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAALKFIPYEQMEKEGYAQWLTLFDET--
MSRB_AGRFC       TEIRCANCGGHLGHVFPDGP-PPTGLRYCINGHSMVFEPV--------------------
MSRB1_RHIME      TEIRCADCDAHLGHVFPDGP-PPTGLRYCLNGTAMTFEED--------------------
MSRB_THEEB       TEVLCAVCDAHLGHVFEDGP-PPTGLRYCINSAALAFVPESAASS---------------
MSRB_PSEPK       TEVTCARCDAHLGHVFPDGP-PPTGLRYCINSVCIDLRPRD-------------------
MSRB_PSESM       TEVVCARCDAHLGHVFPDGP-PPTGLRYCINSVCLELVPRE-------------------
MSRB_PSEAE       IEVRCGRCDAHLGHVFPDGP-RPTGLRYCINSASLKLVPRES------------------
MSRB_METTH       CEVLCARCDAHLGHVFDDGP-RPTGKRYCMNSAALKFIPRDQIG----------------
MSRB_LEPIC       TEILCSKCGGHLGHVFNDGP-RPTGLRYCINSASLKFQKE--------------------
MSRB_LEPIN       TEILCSKCGGHLGHVFNDGP-RPTGLRYCINSASLKFQKE--------------------
MSRB_BRADU       TEVLCAKCSGHLGHVFPDGP-GPTGLRYCINSAALKLEPK--------------------
MSRB_XYLFA       TEILCARCNSHLGHLFPDGP-PPTYERYCLNSVSLTFIPTGTLLPDQLHRGDNTAYRT--
MSRB_XYLFT       TEILCARCNSHLGHLFPDGP-PPTYERYCLNSVSLTFIPTGTLLPDQLHRGDNTTYRT--
MSRB_CAUVC       IETRCARCDSHQGHVFPDGP-APTRLRYCINSVSLQFVKAGAPLPDPLHRGDKIT-----
MSRB_ECOLI       IEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLRFTDG--------ENGEEING----
MSRB_ECO57       IEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLRFTDG--------ENGEEING----
MSRB_ECOL6       IEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLRFTDG--------ENGEEING----
MSRB_SHIFL       IEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLRFTDG--------ENGEEING----
MSRB_SALTY       VEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLAFSDE--------KNGDQLKG----
MSRB_SALTI       VEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLAFSDE--------KNGDQLKG----
MSRB_YERPE       IEIRCGNCDAHLGHVFPDGP-QPTGERYCINSASLNFVDD--------QNGEQTAG----
MSRB_YERPS       IEIRCGNCDAHLGHVFPDGP-QPTGERYCINSASLNFVDD--------QNGEQTAG----
MSRB_PECAS       IEIRCGQCDAHLGHVFPDGP-KTTGERYCVNSASLSFIDD--------VDGERVDG----
MSRB_PASMU       TEIRCGQCDAHLGHVFEDGP-PPTGLRYCVNSVSMAFEDS--------ETGELIEG----
MSRB_VIBVU       VEIRCARCDSHLGHVFPDGP-KTTGERFCVNSVSLIFNKI--------ETNE--------
MSRB_VIBVY       VEIRCARCDSHLGHVFPDGP-KTTGERFCVNSVSLIFNKI--------ETNE--------
MSRB_VIBPA       TEIRCASCDSHLGHVFEDGP-KTTGERYCVNSVSLIFNKS--------DE----------
MSRB_VIBCH       TEIRCAACDSHLGHVFEDGP-KTTGLRFCVNSVSLIFNKK--------------------
MSRB_RALSO       IEVQCKQCGAHLGHVFEDGP-APTGLRYCINSAALKFGD---------------------
                  *  .   ..* **:* ***      *:*:*. .: :                       

MSRB_BRUME       --
MSRB_BRUSU       --
MSRB2_RHIME      --
MSRB_DEIRA       --
MSRB_BACHD       --
MSRB_BACSK       --
MSRB_BACSU       --
MSRB_LISMF       --
MSRB_LISMO       --
MSRB_LISIN       --
MSRB_HATHI       EL
MSRB_CLOPE       --
MSRB_MYCGE       --
MSRB_MYCPN       --
MSRB_STAAM       --
MSRB_STAAN       --
MSRB_STAAR       --
MSRB_STAAS       --
MSRB_STAA8       --
MSRB_STAAW       --
MSRB_STAES       --
MSRB_STAEQ       --
MSRB_STAHJ       --
MSRB_STAS1       --
MSRB_CLOAB       --
MSRB_LACLA       --
MSRB_ENTFA       --
MSRB_LACPL       --
MSRB_STRA3       --
MSRB_STRA5       --
MSRB_STRP1       --
MSRB_STRP3       --
MSRB_STRP8       --
MSRB_STRP6       --
MSRB_AGRFC       --
MSRB1_RHIME      --
MSRB_THEEB       --
MSRB_PSEPK       --
MSRB_PSESM       --
MSRB_PSEAE       --
MSRB_METTH       --
MSRB_LEPIC       --
MSRB_LEPIN       --
MSRB_BRADU       --
MSRB_XYLFA       --
MSRB_XYLFT       --
MSRB_CAUVC       --
MSRB_ECOLI       --
MSRB_ECO57       --
MSRB_ECOL6       --
MSRB_SHIFL       --
MSRB_SALTY       --
MSRB_SALTI       --
MSRB_YERPE       --
MSRB_YERPS       --
MSRB_PECAS       --
MSRB_PASMU       --
MSRB_VIBVU       --
MSRB_VIBVY       --
MSRB_VIBPA       --
MSRB_VIBCH       --
MSRB_RALSO       --