CLUSTAL format seed alignment for MF_01401

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MSRA_MYCLE       --------------------------------------------MARTNTRKAILAGGCF
MSRA_MYCTU       ----------------------------------------------MTSNQKAILAGGCF
MSRA1_RHILO      ---------------------------------------------MATSTERAVLAGGCF
MSRA3_RHIME      ------------------------------------------------MTKRAVLAGGCF
MSRA_PSEFL       ---------------------------------------------MTRHTETAILAGGCF
MSRAB_TREPA      -------------------------------------------------<GTALFAAGCF
MSRA_LISIN       --------------------------------------------MTKESLEKATFAGGCF
MSRA_LISMO       --------------------------------------------MTKESLEKATFAGGCF
MSRA_BACSU       ---------------------------------------------MSEKKEIATFAGGCF
MSRA_BACHD       ---------------------------------------------MEKRLERAMFAGGCF
MSRA2_STAAW      -----------------------------------------------MTKEYATLAGGCF
MSRA2_LACLA      -----------------------------------------------MATERAIFAGGCF
MSRA_STRP1       -------------------------------------------------MERAIFAGGCF
MSRA1_LACLA      -----------------------------------------------MSTERAIFAGGCF
MSRA1_STAAM      -----------------------------------------------MNINTAYFAGGCF
MSRA2_CAUVC      -----------------------MRRLIVLFAAALAVLGATAPALAAPKTETAVFAGGCF
MSRA2_RHIME      ---------------------------MLRLLFGFLVTCFLLLPARAAEPQYAIFAGGCF
MSRAB_VIBCH      -----------MKRLFAWGAPLFALVALTLSLFSQADTKPSTIDSTSANYQQATLAGGCF
MSRA_DEIRA       ------------------MGWHPLGEHGAPHNSSMTQQTNSQGTQPGAAQEQAIFAGGCF
MSRA_PASMU       ------------------------------------------------MTQQAIFAGGCF
MSRA_CAMJE       -------------------------------------------------MKNIVLGGGCF
MSRA_SACS2       -------------------------------------------------MEVATLGGGCF
MSRA_HALSA       -----------------------------------------------MGTETATLGGGCF
MSRA_RALSO       --------------------------------------MQESTMTERQALETAVLGGGCF
MSRA2_RHILO      -----------------------------------------MDEKAAPGSETAIFAGGCF
MSRA2_SYNY3      --------------MGLAIAVGSFLISPFSKVIPDPVVDINPVSTTARGTEKAVFAGGCF
MSRA_SALTI       -----MSLFDKKHLVTQADALPG-RNTPMPIATLHAVNEHSMTNVP-AGMEIAYFAMGCF
MSRA_SALTY       -----MSLFDKKHLVTQADALPG-RNTPMPIATLHAVNEHSMTNVP-AGMEIAYFAMGCF
MSRA_ECOLI       -----MSLFDKKHLVSPADALPG-RNTPMPVATLHAVNGHSMTNVP-DGMEIAIFAMGCF
MSRA_DICD3       ----MIANFDKTQPIGQSDALPG-RTTPMPVARLHVVNQHSMTHVP-DHMEVAIFAMGCF
MSRA_YERPE       -----MQNVDNTAVIDAANALPG-RLTSIPVSPLHAVHGHSMTYIP-EGMDLAFFAMGCF
MSRA1_SYNY3      -MGFFDLFGKKTAMVAPNEALPG-RSATMPVPDKHFVNGNPLKAPFPQGMETALFGLGCF
MSRA2_NOSS1      --MALFGFGKKLALPTPEKALPG-RAQIMPVPANHYVNKNPLKPPFPDGFEKALFGLGCF
MSRA_PSEAE       MVLRSEILTKKSELPTPDQALPG-RESAMPVPEAHFVNGRPLTAPFPAGLQQVLFGMGCF
MSRA_XYLFA       ---MVLTIEALKHLWRLDESRVG-RSEPLPLDNRHYVKGHPLCDAF-TGLAQIQFGLGCF
MSRA_XANCH       ---MLGIGAFKQRMPRPGEALPG-REQALPLHNTHLVNGHPLRGEF-TGLAQVQFGLGCF
MSRA_BRUME       -MSFFDSYRKKMQMPSKEEVLPG-RVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCF
MSRA_OCHAN       -MSFLDSYRKKTLMPSTDEALPG-RAQPIPTSATHFVNSRPLKEPWPEGYKQVLFGMGCF
MSRA1_RHIME      -MFLIDMFNKKTILPDAATALPG-REEEIPTATTHFVSGRPLQGPYPEGMKKVLFGMGCF
MSRA1_CAUVC      ----MLSLHKTLEMPSADTALPG-RAAPIPTAQTHFVNGHALKGPYPEGLETAIVAMGCF
MSRA_VIBCH       -------MLDKQTMVTAHNALPG-RTTAMSIDDTHFVNGSSLTAAPQSGQQQILIGMGCF
MSRA_CORML       ---MAWFFAPEPVMVTADEALKGGRHTVLENPAPHTVLGTPVTGPWKEGQQRIWIGLGCF
MSRA_MYCGE       -------------------------------------------------MKEIYFGGGCF
MSRA_MYCPN       -------------------------------------------------MKQIYFGGGCF
MSRA_CLOAB       -------------------------------------------------MKKIIFAGGCF
MSRA_CLOPE       -------------------------------------------------MKKIILAGGCF
MSRAB_HAEIN      ----MKLSKTFLFITAL--CCATPTLAIQNSTSSSGEQK--MAMENTQNIREIYLAGGCF
MSRAB_AGGAC      ----MKKSKLVVALAAILSCAAIPTTVMAESNVQQTMEK-SNMSEAKKDLHEIYLAGGCF
MSRAB_HELPY      -------MKVLSYLKNFYLFLAIGAIMQASENMGSQHQK---TD-----ERVIYLAGGCF
MSRAB_HELPJ      -------MKILSYLKKFYLFLLIGAIMQANESMGAKLPK---TD-----ERVIYLAGGCF
MSRAB_STRGC      -------------------------------------------------MAEIYLAGGCF
MSAB1_STRPN      -------------------------------------------------MAEIYLAGGCF
MSAB2_STRPN      -------------------------------------------------MHEIYLAGGCF
MSRAB_STRP1      ---------------------------------------------------MIYLAGGCF
MSRAB_CAMFE      ----------------MKKILFVVATIFMALFLNAKEND---MR----NLKDIYLAGGCF
MSRAB_NEIMA      -------------------------------------------------<RTIYLAGGCF
MSRAB_NEIMB      -------------------------------------------------<RTIYLAGGCF
MSRAB_NEIGO      -------------------------------------------------<RTIYLAGGCF
MSRA_UREPA       ------------------------------------------------MIKSIWIAGGCF
MSRA_MYCPU       ------------------------------------------------MQKEIFIAGGCF
MSRA_METTH       -------------------------------------------MMCLSRYEKATFGAGCF
MSRA1_NOSS1      --------------------------------------MELKIGSTEAPMEKATFGAGCF
MSRA_THEVU       ---------------------------------------------------MATFGAGCF
                                                                       .. ***

MSRA_MYCLE       WGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHGM----HAEAVEIIYDPAITDYRTLLE
MSRA_MYCTU       WGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLE
MSRA1_RHILO      WGMQDLIRRYPGVISTRVGYSGGDVANATYRNHGT----HAEAIEINFDPAVISYRTLLE
MSRA3_RHIME      WGMQDLIRKLPGVIETRVGYTGGDVPNATYRNHGT----HAEGIEIIFDPERISYRRILE
MSRA_PSEFL       WGMQDLLRRYPGVLHTRVGYTGGDVPNATYRNHGN----HAEAIEIVFDPAVISYRQILE
MSRAB_TREPA      WSTEAYFRRVKGVLRVRVGYTGGTTKSPTYRNVCTGTTGHAEAVEILFDPQVISYEDLLK
MSRA_LISIN       WCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAVEITFDPAVFPYEKLVE
MSRA_LISMO       WCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVE
MSRA_BACSU       WCMVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQITFHPDVFPYEKLLE
MSRA_BACHD       WCMVQPFDKQPGIESVVSGYAGGTVENPTYEQVKTGTTGHYEVVHITYVPELFPFEKLLS
MSRA2_STAAW      WCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILD
MSRA2_LACLA      WCMVQPFEEREGILSVISGYTGGNVENPTYEQVKKHLTGHTEAVEIIFDNSKITYQSLVE
MSRA_STRP1       WCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVE
MSRA1_LACLA      WCMVEPFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAVEILFDNELISYDELLD
MSRA1_STAAM      WCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLE
MSRA2_CAUVC      WCMEHDMQGVPGVLKVESGYTGGHLKNPTYRDVTSETSGHYEAVRVTYDPAKLDYGFLLY
MSRA2_RHIME      WCVESDFDAVPGVLETISGYAGGKSANPTYEDYA--KGGHREVVRVKFDPDRVSYAELVG
MSRAB_VIBCH      WCTESDMEKLPGVVDVISGYAGGDVDNPTYKQVSSGKTGHIEVIQVTFDPKIVTYEQVLD
MSRA_DEIRA       WCTEAVMQDLRGVQKVESGYIGGTVPNPDYRSVCGGQTGHAEAVRVTFDPNQISYRDLLG
MSRA_PASMU       WCVEAVFNQIKGVEKATSGYINGTTENPTYKEVCTGETGHAEAVKVEFDATVISYEKLLD
MSRA_CAMJE       WCVEAVFERLKGVINTEVGYSGGK-PNPSYESVCNGD-GNIEVVKINYDEKQISLLEILT
MSRA_SACS2       WCTEAVYKRVKGVISVKPGYSGGHVPNPTYEDVCTDTTGHAEVVQITFDSSIISYREILE
MSRA_HALSA       WCTEAAMEELAGVTDVTSGYAGGDTADPSYRDVCSGTTGHAEVVQVEYDTAELAYEDVLE
MSRA_RALSO       WCTEAVFQQVQGVHSVVSGYAGGHLERPTYRAVCGGDTGHAEVVRVEFDPAVIPYREILD
MSRA2_RHILO      WGVQGVFQHVKGVSKAVSGYTGGAKDDAVYETVGTGRTGHAESVEITYDPSKVTYGQLLQ
MSRA2_SYNY3      WGLEAMFEEVRGVKDVQTGYSGGTEATANYARVSGGGTDHAESIEIVYDPAQVSYGELLK
MSRA_SALTI       WGVERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQ
MSRA_SALTY       WGVERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVISYEQLLQ
MSRA_ECOLI       WGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQ
MSRA_DICD3       WGVERLFWQQPGVYSTASGYCGGYTPNPTYREVCTGKTGHAEAVRVVFDPAVVSYPQLLQ
MSRA_YERPE       WGAERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQ
MSRA1_SYNY3      WGAERKFWQIPGVYSTAVGYAAGYTPNPTYQEVCTGMTGHNEVVLVAFDPQQVSYDQLLK
MSRA2_NOSS1      WGAERKFWQQQGVYSTAVGYAAGFTPNPTYDEVCTGLTGHNEVVLVVFDPKVISYTQLLK
MSRA_PSEAE       WGAERRLWQQPGVWVTAVGYAGGYTPNPTYDEVCSGLTGHSEVVLVVYNPQETSFEQLLK
MSRA_XYLFA       WGAERLFWQLPGVFSTAAGYAGGGVPYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQ
MSRA_XANCH       WGAERKFWNVPGVYTTAVGYAGGQTPNATYSEVCSGQTGHTEAVLVVFDEQAVSFAQLLR
MSRA_BRUME       WGAERLFWQVPGVYVTAVGYAGGITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLA
MSRA_OCHAN       WGAERLFWQVPGVYVTAVGYAGGVTPNPTYEETCTGLTGHAEVVLVVYDPKVVSLDELLT
MSRA1_RHIME      WGAERLLWEIPGVYVTAAGYSGGLTPNPTYQETTTGLTGHTEVVLVVYDPAKVSLQRLLK
MSRA1_CAUVC      WGVERVFWKVPGVYVTAAGYAAGITPNPTYEEVCTGRTGHTEVVLVVFDPKVVTYEALLK
MSRA_VIBCH       WGAERLFWQLDGVISTSVGYSGGFTPNPTYEEVCSGKTGHTEVVRVIFDPERLPLTELLR
MSRA_CORML       WGVEQMYWQMDGVEGTSVGYAGGFTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVA
MSRA_MYCGE       WGIEKYFQLIKGVKKTSVGYLNSRIRNPSYEQVCSGYTNAVEAVKVEYEEKEISLSELIE
MSRA_MYCPN       WGTQKYFDLIKGVQKTSVGYLNSNMKNPTYEQVCSGQTNAVEAVFVEYDENKVSLNELID
MSRA_CLOAB       WGVEAYFNTIDGVLNTKVGYANGNTEDPTYEDVCTDSTGYAEACYIEYDEKQLKLEKLID
MSRA_CLOPE       WGVEEFLSRINGVVSTEVGYANGRTENPTYEDICTKNTYFAEVCLVNYDENIISLKELLA
MSRAB_HAEIN      WGMEAYMERIHGVKDAISGYANGNTEKTSYQMI--GLTDHAETVKVTYDANQISLDKLLK
MSRAB_AGGAC      WGIEAYMERIYGVEDAISGYANGKSDKTNYQKI--GITDHAETVKVTYDRNKVSLDKLLK
MSRAB_HELPY      WGLEAYMERIYGVIDASSGYANGKTSSTNYEKL--HESDHAESVKVIYDPKKISLDKLLR
MSRAB_HELPJ      WGLEAYMERIYGVIDASSGYANGKTSSTNYEKL--HESDHAESVKVIYDPKKISLDKLLR
MSRAB_STRGC      WGLEEYFSRIEGVKKTTVGYANGQVESTNYQLI--HQTDHAETVHLIYDEKRVSLREILL
MSAB1_STRPN      WGLEEYFSRISGVLETSVGYANGQVETTNYQLL--KETDHAETVQVIYDEKEVSLREILL
MSAB2_STRPN      WGVEEYFSRVPGVTDAVSGYANGRGETTKYELI--NQTGHAETVHVTYDAKQISLKEILL
MSRAB_STRP1      WGVEEYFSQVDGVLDAVSGYANGRGDTTNYQLI--HQTGHAETVEVAYDANRISLKELLL
MSRAB_CAMFE      WGTQAYFDKIRGVIKTDVGYANGKSDKTDYHSL--HYSGHAETVHITFDENIVSLAEILA
MSRAB_NEIMA      WGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQ
MSRAB_NEIMB      WGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQ
MSRAB_NEIGO      WGLEAYFQRIDGVVDAVSGYANGNTENPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQ
MSRA_UREPA       WGIQKYFDSIIGVNHTVVGYSQGNVINPSYEQVCTQTTNHTETVQIDYDDRFVSLISILE
MSRA_MYCPU       WGVERYFQKVKGVLDTKACYINGGFEGVKYKEVC-EGSSHVEAVRVIYDNSKITEEDLWK
MSRA_METTH       WGVEDAFRKVDGVVSTRVGYMGGHLENPTYEDVCTGLTGHAEVVEVTFDPDVVGYSDLLD
MSRA1_NOSS1      WGVEAAFRKVKGVVSTSVGYMGGHFPNPCYLDVLSRITGHAEVVQIEYDPQLVSYEDLLA
MSRA_THEVU       WGVEETFRQVPGVIDTAVGYMGGTTENPTYEEVCTDKTGHAEVVQVEYDPEQVSYEELLN
                 *          *:  .   *  .      *           *   : :         :  

MSRA_MYCLE       FFFQI-HDPTTRNRQGNDQGTSYRSAIFYLDDEQKKVALDTIAAVEASSLWPGKVVTEVS
MSRA_MYCTU       FFFQI-HDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVS
MSRA1_RHILO      RFFQI-HDPTTRNRQGNDVGMSYRSAIYYTSDEQKRVAEDTIADVDASGLWPGKVVTEVA
MSRA3_RHIME      LFFQI-HDPTTKDRQGNDIGTSYRSAIYYVDDEQKRIAQETIADVEASGLWPGKVVTEVE
MSRA_PSEFL       FFFQI-HDPSTPNRQGNDLGPSYRSAIYYLNEQQRDIAEDTAADVDASHLWPGRVVTEIE
MSRAB_TREPA      HFFRM-HDPTSLNKQGGDVGTQYRSAIFYLSGTQKQQAETLMGRYAGAGKFTRPLVTTLE
MSRA_LISIN       VYWQQ-TDPTDAAGQFVDRGDSYRPVIFYHNEEQRQIAEKSKAALDASGRFKKPVVTEIA
MSRA_LISMO       VYWQQ-TDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIA
MSRA_BACSU       LFWQQ-IDPTDAGGQFADRGSSYRAAIFYHNDKQKELAEASKQRLAESGIFKDPIVTDIL
MSRA_BACHD       LYWPQ-IDPTDPDGQFHDRGPQYRTAIFYENEEQRALAERSREALEKSGKFKKPIVTSIL
MSRA2_STAAW      IYFKT-FDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIK
MSRA2_LACLA      LYWTL-TDPTDAFGQFEDRGDNYRPVIFVENEEQEKIAKESKAQLQASGNFDSPIVTSIE
MSRA_STRP1       LYWTQ-TDPTDAFGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIE
MSRA1_LACLA      IYWSL-IDPTDADGQIYDRGANYRPVIFVESEEQRIAAQKSKIALEKSGIWDKPIVVPIE
MSRA1_STAAM      IFFSV-IDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKIL
MSRA2_CAUVC      RYWRL-VDPTDDGGQFCDRGPSYRPAVFVTPAQRPIAEKS--RTEAAKRLKTGTMKTQIL
MSRA2_RHIME      VLFRT-TDPTDGDGQFCDRGFAYTTAIHALNERQAMDAKA--EKIKAEAELGRPIVTPVE
MSRAB_VIBCH      NFFRH-IDPTDDQGSFVDRGEQYRPAIFYHNAEQLEVAKRFMMEIDQLGIFKKPLKTELI
MSRA_DEIRA       LFFAT-HDPTSLNRQGADVGTQYRSALFPLTQEQEQTAREMIEQLGTEDVFGRPIVTSIE
MSRA_PASMU       IFFSI-HNPTQLNHQGEDVGTQYRTGIYYLNDEQEQLANKKIAELQPH--FAEKIVTEVL
MSRA_CAMJE       LFFKI-HDPTSIDKQGGDIGIQYRSIIFYENEEDKILAQNFIEEQQKI--FSKKIVTKIS
MSRA_SACS2       IFFEI-HDPTTLNRQGNDVGTQYRSIILYHNEEQRKIAEEMIREVEKR--IGKKVVTELK
MSRA_HALSA       VFFTV-HDPTTVDREGPDVGSQYRSIVLPHDDQQHERATAFVDELAAADAFDGSIVTEIE
MSRA_RALSO       IFFAT-HDPTTLERQGNDIGPQYRSAVFAQSPEQFAEAGATIRALSAANVFDAPIVTEVV
MSRA2_RHILO      VYFSVAHNPTQLNFQGPDSGTQYRSTIFAENDTQKQIAQSYIDQLDKAKLYPAPIVTTIE
MSRA2_SYNY3      IFFSVGHDPTQVNRQGVDQGRQYRSAIFATTPEQKQVAQAYIDQLEESQAFDQAIATEVN
MSRA_SALTI       TFWEN-HDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAAGDHRPITT
MSRA_SALTY       TFWEN-HDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMTAAGDHRPITT
MSRA_ECOLI       VFWEN-HDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAADDDRHITT
MSRA_DICD3       LFWEN-HNPAQGMRQGNDIGTQYRSAIYTLTTEQETAAKESYQRFQQAMRDAGNDHDITT
MSRA_YERPE       IFWEN-HDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQAMEKAGDQRVITS
MSRA1_SYNY3      VFWES-HNPTQGMRQGNDVGTQYRSGIYTYSEAQQQAALASKQAYQQALQQAGYGEITTE
MSRA2_NOSS1      VFWES-HNPTQGMRQGNDVGTQYRSGIYVYSEAQKQLAEASRDAYQQALSSAGYEKITTE
MSRA_PSEAE       VFWEA-HDPTQGMRQGGDIGTQYRSVIYTFDAAQKAAAMASRESFQAELAKAGYDRITTE
MSRA_XYLFA       TFWES-HDPTQGMRQGNDIGTQYRSVIHCTTSKQYAAASTSREVYQQQLNTAGYTAITTE
MSRA_XANCH       TFWES-HDPTQGMQQGNDVGTQYRSAIYCTTQAQYDAALASRDAYQQQLTASGYGDITTE
MSRA_BRUME       LFWEE-HDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGLG-PVTT
MSRA_OCHAN       LFWEE-HDPTQGMRQGNDIGTTYRSVIYTFDKADRDVAEKSREAYSQALAGRGLG-PITT
MSRA1_RHIME      TFFEE-HDPTQGMRQGNDVGTTYRSAIYVYDEEQLAEANAARNAFQKALRVYNHDREITT
MSRA1_CAUVC      TFWEN-HDPTQGMRQGNDIGTQYRSGLYVTSDAQAAAAAESKAAYQQALSARGLG-TITT
MSRA_VIBCH       AFWER-HDPTQGMRQGNDRGTQYRSAIYTFSEDQREIAEASKAAYQALLTAQHRPSITTE
MSRA_CORML       RGLEA-HDPTQGFRQGNDVGTQYRSAYYTENEEGAARVKAVVDAYGETLKQHGFGEITTE
MSRA_MYCGE       ALFEV-IDPTIRNRQGNDIGTQYRTGIYWTDSSDEKIINDKFLKLQKNYSKP-----IVT
MSRA_MYCPN       AFFKV-IDPTIRNRQGNDIGTQYRTGVYWVDPQDEQLITQKFRELQANYPKP-----IVT
MSRA_CLOAB       AYWKV-VDPTLKNRQGHDEGTQYRTGIYYVDEEDLKVILESKDKEQEKYDAP-----IVT
MSRA_CLOPE       KFWTI-IDPTSLNKQGNDVGSQYRTGIYYVDSSDLEDILNSKEELQKSYSKK-----IVT
MSRAB_HAEIN      YYFKV-IDPTSVNKQGNDRGRQYRTGIYYQDGADKAVIGQALAQLQTKYKKP-----VQI
MSRAB_AGGAC      YYFQV-IDPTSVNKQGNDRGRQYRTGIYYQDTADKSIIEKEITALQGKYKNK-----IQI
MSRAB_HELPY      YYFKV-VDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGK-----IAI
MSRAB_HELPJ      YYFKV-IDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDNALKALQKEVKGK-----IAI
MSRAB_STRGC      YYFRV-IDPLSVNKQGNDVGRQYRTGVYYTNQADKAVIEQVFAEQEKQLGQK-----IAV
MSAB1_STRPN      YYFRV-IDPLSINQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGRK-----IAV
MSAB2_STRPN      HYFRI-INPTSKNKQGNDVGTQYRTGVYYTDDKDLEVINQVFDEVAKKYDQP-----LAV
MSRAB_STRP1      HFFRI-IDPTSLNKQGNDRGSQYRTGIYYTDKADLAIIDEVFKEKAKDYKKK-----IVV
MSRAB_CAMFE      HYFRI-IDPFSVNKQGNDVGSQYRTGIYYNDSSLKNSISEFIKHEQTKYDKK-----IAV
MSRAB_NEIMA      YFFRV-VDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLP-----LVV
MSRAB_NEIMB      YFFRV-VDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLP-----LVV
MSRAB_NEIGO      YYFRV-VDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLP-----LVV
MSRA_UREPA       HLYQI-IDPFSLNKQGDDVGSQYRSGIYYVDHDDEFIIKDFLLKKQNQTPKK-----IMI
MSRA_MYCPU       LYLRI-INPYSLNKQGNDRGVQYRIGLYSYDKDLLKKFSDLNEAFMKSEGKK-----NYI
MSRA_METTH       VFWSI-HDPTTLNRQGPDVGEQYRSVIFYHSDEQRRAAIESRRRLEESGRFR----DRIV
MSRA1_NOSS1      VFWDI-HDPTTLNRQGPDKGEQYRSVIFFHNEQQAEAAQQSKAKVQVSGRFE----LDIV
MSRA_THEVU       VFWDN-HNPTTLNRQGPDVGTNIARLFFTTLKSKEIPQKNPKRKWIKAGVGK----IRL-
                        :*     .  * *                                        

MSRA_MYCLE       LAE----DFWEAEPEHQDYLQHYPNGYTCHFVRPNWKLPRRAPADAKADS----------
MSRA_MYCTU       PAG----DFWEAEPEHQDYLQRYPNGYTCHFVRPGWRLPRRTAESALRASLSPELGT---
MSRA1_RHILO      PAG----AFWEAEPEHQDYLEKYPNGYTCHFVRPGWKLPVREKAVS--------------
MSRA3_RHIME      PVR----DFWEAEPEHQNYLERYPNGYTCHFPRPNWVLPRRSAAE---------------
MSRA_PSEFL       PAG----PFWEAEPEHQDYLERIPNGYTCHFIRRMEAPQARLKVEFVRRRGDRFRPFSAL
MSRAB_TREPA      EAR----DFYPAEEYHQDYLTKNPGGYCHVSLHLASEPLE--------------------
MSRA_LISIN       KAE----TFYPAEEYHQDFYKKEKAHYEGYQVASGRAAFIDANWKG--------------
MSRA_LISMO       KAE----TFYPAEEYHQDFYKKEKAHYEGYQVASGRAAFIDANWKG--------------
MSRA_BACSU       KAE----PFYEAEGYHQHFYKKNPAHYQRYRTGSGRAGFISEHWGAK-------------
MSRA_BACHD       PMA----TFYPAEEEHQQFYKKNPMAYKEDREKSGRDEFIYKHWGK--------------
MSRA2_STAAW      PYK----NFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA-----------
MSRA2_LACLA      TVQ----KFWPAEDYHQGFYKKNPEDYAQ--SSKIRHDFLEKQWKK--------------
MSRA_STRP1       PAE----PFYLAEDYHQGFYKKNPKRYAQ--SSAIRHQFLEENWS---------------
MSRA1_LACLA      EAK----TFWPAEEYHQQYYKKDPKRYQA--MHKARERYLALQRFKGKFKFLRKNTR---
MSRA1_STAAM      PAS----QFYKAEDYHQDFYKKNPERYAE--EQKIRQEYKNKQ-----------------
MSRA2_CAUVC      PAQ----TFYLAEEYHRDYAKRNKLNYFAYRTGCGRDARLKQVWGG--------------
MSRA2_RHIME      GAA----KFWPAEDYHQDFGKRNPIRYWYYRNGCGRNRTVEKLWGDRAYAGVSH------
MSRAB_VIBCH      EFK----KFWPAEDYHQDYYKKNKVRYNYYRYA>--------------------------
MSRA_DEIRA       PAS----TFYVAEDYHQNYYKNNPGQGYCMAVISPKVAKLRQYYGDKLR-----------
MSRA_PASMU       PAQ----TFYPAEDYHQGYLLQNPQNSYCNLVATPKFLKAKVKFEEIWK-----------
MSRA_CAMJE       RLQ----TYYKAENYHQHYFINNPDQGYCQAVIAPKLQKIQSD-----------------
MSRA_SACS2       PFE----VFYEAEDYHHDFYDKHKYNPYCRLVISPKVKKFMKLFPDKVKIHEG-------
MSRA_HALSA       PLE----TFYPAAEKHQNYFEKNPDAAYCTVNVAPKVSKVREQFGARTE-----------
MSRA_RALSO       DASGGKVPFWQAEDEHQNYFRDHPAQGYCAFVISPKVAKFRERFAHRLQA----------
MSRA2_RHILO      TGK----TFYPAENYHQDFLTLNPTYPYIVYNDLPKVANLKQLFPALYSEKPVLVLSASN
MSRA2_SYNY3      DFD----AFYPAEDYHQDFVQRNPAHPYVLVHDLPKLRKFRQQYSDKLKAQS--------
MSRA_SALTI       EIA-HATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA-------------------
MSRA_SALTY       EIA-HATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA-------------------
MSRA_ECOLI       EIA-NATPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA-------------------
MSRA_DICD3       EIQ-PAGPFYYAEDEHQQYLHKNPDGYCGLGGIGVCLPPQG-------------------
MSRA_YERPE       EIT-VALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV-------------------
MSRA1_SYNY3      IL--PAPDFYYAEDYHQQYLAKNPNGYCGLGGTNVACPIGTEVSLGA-------------
MSRA2_NOSS1      IL--DAPEFYYAEAYHQQYLAKNPNGYCGLGGTNVACPVGVFESSANG------------
MSRA_PSEAE       IA--DVPPFYYAEAYHQQYLAKNPNGYCGLGGTGVCLPA---------------------
MSRA_XYLFA       ILH-PAPPFYYAENEHQQYLAKHPNGYCGLGGTGVTCPIRLQV-----------------
MSRA_XANCH       IRF-PAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA-----------------
MSRA_BRUME       QIT-DAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH-----------------
MSRA_OCHAN       EIE-DAPELYYAEDYHQQYLAKNPNGYCGLRGTGVSCPIPLAQ-----------------
MSRA1_RHIME      EIA-KAGPFYFAEDYHQQYLAKNPDGYCGLRGTGVSCPIGA-------------------
MSRA1_CAUVC      EIA-PAGPFYFAEDYHQQYLAKNPNGYCGIGGTGVVCPIGLGVEG---------------
MSRA_VIBCH       IL--PAGAYYFAETYHQQYLAKNPNGYCGLGGTGVCFPPHSTL-----------------
MSRA_CORML       IGVISPSEYFLAEDYHQQYLDKNPDGYCPHHSTGIPCGVEA-------------------
MSRA_MYCGE       ENK-KVENYYLAEEYHQDYLKKNPNGYCHIKFD---------------------------
MSRA_MYCPN       ENR-AMENYFLAEEYHQDYLKKNPHGYCHIKFD---------------------------
MSRA_CLOAB       EIL-PLKNFYDAEEYHQKYLDKNPNGYCHIPKELLKKH----------------------
MSRA_CLOPE       EVK-PLENYYKAEEYHQKYLKKNPNGYCHIKLD---------------------------
MSRAB_HAEIN      EVQ-PLKNYIVAEEYHQDYLKKNPNGYCHIDIT>--------------------------
MSRAB_AGGAC      EVE-PLHNYIVAEEYHQDYLKKNPNGYCHIDLE>--------------------------
MSRAB_HELPY      EVE-PLKNYVRAEEYHQDYLKKHPSGYCHIDLK>--------------------------
MSRAB_HELPJ      EVE-PLKNYVRAEEYHQDYLKKHPGGYCHIDLK>--------------------------
MSRAB_STRGC      ELE-PLRHYVLAEDYHQDYLKKNPGGYCHINVN>--------------------------
MSAB1_STRPN      EVE-QLRHYILAEDYHQDYLRKNPSGYCHIDVT>--------------------------
MSAB2_STRPN      EKE-NLKNFVVAEDYHQDYLKKNPNGYCHINVN>--------------------------
MSRAB_STRP1      EKA-PLKHFIKAEDYHQDYLKKNPNGYCHIDIN>--------------------------
MSRAB_CAMFE      EVE-PLKNYVLAEDYHQKYLDKNPGGYCHVDLS>--------------------------
MSRAB_NEIMA      ENE-PLKNFYDAEEYHQDYLIKNPNGYCHIDIR>--------------------------
MSRAB_NEIMB      ENE-PLKNFYDAEEYHQDYLIKNPNGYCHIDIR>--------------------------
MSRAB_NEIGO      ENE-PLKNFYDAEEYHQDYLIKNPNGYCHIDIR>--------------------------
MSRA_UREPA       EVE-RLRNFNIAEEYHQKYLDKNPNSYCHVDLSLSKKEFR--------------------
MSRA_MYCPU       EIQ-KVEDVTLAEEYHQNYLLKNVNGYCHINLDDIPEEYQKQ------------------
MSRA_METTH       TAIEPAGTFYEAEEYHQQYLEKNPRRRCYLMRLLSTR-----------------------
MSRA1_NOSS1      TEIKHKSEYYLATEEHQQYFEKQAKR----------------------------------
MSRA_THEVU       ------------------------------------------------------------
                                                                             

MSRA_MYCLE       -----------------------
MSRA_MYCTU       -----------------------
MSRA1_RHILO      -----------------------
MSRA3_RHIME      -----------------------
MSRA_PSEFL       TTGGNQPGARGGLTNNTCQHPRH
MSRAB_TREPA      -----------------------
MSRA_LISIN       -----------------------
MSRA_LISMO       -----------------------
MSRA_BACSU       -----------------------
MSRA_BACHD       -----------------------
MSRA2_STAAW      -----------------------
MSRA2_LACLA      -----------------------
MSRA_STRP1       -----------------------
MSRA1_LACLA      -----------------------
MSRA1_STAAM      -----------------------
MSRA2_CAUVC      -----------------------
MSRA2_RHIME      -----------------------
MSRAB_VIBCH      -----------------------
MSRA_DEIRA       -----------------------
MSRA_PASMU       -----------------------
MSRA_CAMJE       -----------------------
MSRA_SACS2       -----------------------
MSRA_HALSA       -----------------------
MSRA_RALSO       -----------------------
MSRA2_RHILO      -----------------------
MSRA2_SYNY3      -----------------------
MSRA_SALTI       -----------------------
MSRA_SALTY       -----------------------
MSRA_ECOLI       -----------------------
MSRA_DICD3       -----------------------
MSRA_YERPE       -----------------------
MSRA1_SYNY3      -----------------------
MSRA2_NOSS1      -----------------------
MSRA_PSEAE       -----------------------
MSRA_XYLFA       -----------------------
MSRA_XANCH       -----------------------
MSRA_BRUME       -----------------------
MSRA_OCHAN       -----------------------
MSRA1_RHIME      -----------------------
MSRA1_CAUVC      -----------------------
MSRA_VIBCH       -----------------------
MSRA_CORML       -----------------------
MSRA_MYCGE       -----------------------
MSRA_MYCPN       -----------------------
MSRA_CLOAB       -----------------------
MSRA_CLOPE       -----------------------
MSRAB_HAEIN      -----------------------
MSRAB_AGGAC      -----------------------
MSRAB_HELPY      -----------------------
MSRAB_HELPJ      -----------------------
MSRAB_STRGC      -----------------------
MSAB1_STRPN      -----------------------
MSAB2_STRPN      -----------------------
MSRAB_STRP1      -----------------------
MSRAB_CAMFE      -----------------------
MSRAB_NEIMA      -----------------------
MSRAB_NEIMB      -----------------------
MSRAB_NEIGO      -----------------------
MSRA_UREPA       -----------------------
MSRA_MYCPU       -----------------------
MSRA_METTH       -----------------------
MSRA1_NOSS1      -----------------------
MSRA_THEVU       -----------------------