CLUSTAL format seed alignment for MF_01405

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IXTPA_MYCMS       ------------MDKKVIYLATTNKNKVKEFSEIL---KDY-Q-------IKSLLDIPE-
A7I4V0_METB6      -------------MSQTLTMVTSNANKAREVAAFF---GGA---IE----VSHVA-----
B8D6D4_DESA1      -------------MSVKLLLLSGNRHKYLEIKDIA---REY-G-VN----VAPLE-----
IXTPA_PICTO       -----------------MLFITSNRHKYEEAAEFL---GNY-N-ID----IKWKN-----
IXTPA_THEAC       ----------------MYRFVTSNRHKFEEVSEMA---ALY-G-IE----IEWVR-----
IXTPA_KORCO       -----------------MIFASSNRHKYEEFRRML---SDL---ID----LKFLE-----
IXTPA_SACS2       ----------MLRRGVKIGVLTNNENKFIELKEIA---KNF-N-IE----LEHLR-----
IXTPA_PYRAE       ---------------MRIRLATNNPYKLAEVSHIL---APF-C-IE----VERLD-----
IXTPA_METTM       ---------------MKVTFITGNKHKLSEAEKIF---HDT-G-IE----LEHAD-----
IXTPA_METJA       ---------------MKIYFATGNPNKIKEANIIL---KDLKD-VE----IEQIK-----
IXTPA_METAC       --------------MHKIVFVTGNKGKFAEIRDIL---KTF-G-IE----VIQEK-----
IXTPA_METKA       ---------------MKVLFATGNIGKYHEAKQIL---ARY-G-IE----VERVD-----
A0B9H6_METTP      ----------------MIRFVTSNRGKFIEAQRIL-------G-------GIVQAD----
IXTPA_THEKO       ---------------MRLAFVTSNPGKVEEARKYF---EPL-G-VE----VYQLK-----
IXTPA_PYRHO       ---------------MKIFFITSNPGKVREVANFL---GTF-G-IE----IVQLK-----
IXTPA_PYRFU       ---------------MELFFITSNDGKVREAKKFL---EPL-G-IN----VIKKP-----
IXTPA_WOLSU       ---------------MKILIATGNRDKLQEIAQIF---SDH-E-------VMGYHEIME-
IXTPA_THEMA       ------------MKKLTVYLATTNPHKVEEIKMIA---PEW---ME----ILPSPE----
IXTPA_MYCPE       ---------------MKIILATQNKRKLDEFIELS---KNS-N-YPINFVIKPLKED---
IXTPA_BORBU       --------------MKTLFFATTNENKINEVKNIL----DI-PNLN----LIVPQNFN--
IXTPA_BORBP       --------------MKTLFFATTNENKINEVKNIL----DM-PNLN----LVVPKNFN--
IXTPA_BDEBA       ---------------MELWIATGNKGKLAEYKQLL---REL-PDLK----VFSQGDIAS-
IXTPA_LEPIC       -------------MKRQLALGTNNLNKVKEVSSIL---MEL-G-IQ----ILTPKDLKV-
IXTPA_LEPIN       -------------MKRQLALGTNNLNKVKEVSSIL---MEL-G-IQ----ILTPKDLKV-
IXTPA_CAMJE       ---------------MKIILATSNKHKVLELKEIL---KDF-E-------IYAFDEVLM-
IXTPA_CAMJR       ---------------MKIILATSNKHKVLELKEIL---KDF-E-------IYAFDEVLM-
IXTPA_PARUW       ---------------MEILLATTNLHKIREFKEMC---KAF-AHLE----ILSLHQFPA-
IXTPA_CHLMU       ---------------MKILIASSHGYKVRETKAFL---KKI-GEFD----IFSLVDYPS-
IXTPA_CHLTR       ---------------MKILIASSHGYKVRETKVFL---KKL-GEFD----IFSLVDYPS-
IXTPA_CHLCV       ---------------MKIVIASCHGYKIRETKTFL---KQL-GSFD----IFSLTDFPN-
IXTPA_CHLPN       ---------------MKIVIASSHGYKIRETKTFL---KRL-GDFD----IFSLSDFPD-
IXTPA_HELHP       ---------------MVIVLASANQHKICEFQAML-KNVKE-K-VK----VYAYGELLE-
IXTPA_TREDE       ---------------MKIYLASGNVNKKREVQELL---PSH-T-------IVLPKDEGI-
IXTPA_AQUAE       ---------------MKLLVATTNEGKYREIKEIL---SEY-G-IE----VLKPEE----
IXTPA_RHOBA       -----------MNRMFDLVLGTGNAKKLVELRMML---PEE-T-IA----LTALSEIEN-
IXTPA_TROWT       ---------------MEIVFVSENENKIAEAREIL---LPL-G-FQ----SIFC------
IXTPA_WIGBR       --------------MKKIILATSNKNKIIEFKKIL---SEL-N-IN----TISQKDLG--
IXTPA_ZYMMO       MTQTHSSEKRRRLEPGRLVLASHNQGKLREIRELL---SPF-G-LE----TVSAAELG--
IXTPA_GLUOX       -------MMRKLSPGSKIVLASHNAGKLREFSTLL---AES-G-IT----VISAAELD--
IXTPA_CAUVC       -------------MGAKLVAATHNPGKVPEIAALL---DGR---FE----IVTAGQLG--
IXTPA_BRADU       ---------MHRRITGKLVIATHNPGKLAEMKELL---APY-G-IE----AVSAGELG--
IXTPA_RHOPA       ---------MHRRITGKLVIATHNPGKLAEMRELL---APY-G-IE----AISAGELG--
IXTPA_RUEPO       --------MTRAFDGDTLLIATHNKGKLEEMAHLL---QPF-G-VK----VVGAAEMN--
IXTPA_BARHE       ---------MRSIANKKLVIATHNIGKLQEITTLV---APF-G-LT----IQSAKELG--
IXTPA_BARQU       ---------MRSIASKKLVIATHNTGKLHEITTLV---APF-G-LE----IQSAKELD--
IXTPA_BRUME       ---------MRMLEKGKLIVASHNAGKLREFDGLI---GPF-G-FE----VSSVAALG--
IXTPA_AGRFC       ---------MRKLDTRTIVVASHNKGKIAEIADLI---GPF-G-FS----AKSAAELN--
IXTPA_RHIME       ---------MRRLIDKTLVVASHNAGKIREIRDLI---GPL-G-FE----AKSAADLN--
IXTPA_CHLTE       --------MEPKHPEITIVLATGNKDKVRELKPVL-EALAS-G-IH----VRSLHDLGL-
IXTPA_PORGI       --------------MEKLIFATNNPHKLNEIRHIL---EGK---VE----IVGLDEIGC-
IXTPA_BACFR       -------------MKRKLVFATNNAHKLEEVSAIL---GDK---VE----LLSLNDINC-
IXTPA_BACTN       -------------MKRKLVFATNNAHKLEEIAAIL---GDK---VE----LLSLNDIDC-
IXTPA_PROMP       --------------MKKLYLASKNQGKIEEYKKLL---LNV-N-CQ----LLLQPE----
IXTPA_THEEB       -----------MPILAQAVLASHNAGKVKEFQGWL---QPWIG--E----LVALPA----
IXTPA_PROMA       ------MSFNLGKSLTKLIIASNNDGKIEEFIQLL---SGI-P-LV----VMGQPK----
IXTPA_PROMM       -------MSSNELTERVLVIASGNAGKIREFRQLL---AHL-P-LS----VQAQPK----
IXTPA_SYNPX       --------------MRTLVIASGNAGKIREFQGLL---QHL-P-LN----VQAQPQ----
IXTPA_GLOVI       -------------MMRFLILATNNQGKLQELRRLL---AGT-G-WV----VQAAPP----
IXTPA_NOSS1       -------------MTKILIVATSNAGKLREMQAYL---ANT-D-WE----LTLKPT----
IXTPA_SYNY3       --------------MPTLIVATGNPGKLAEMQTYL---EPL-G-CQ----LTLKPT----
IXTPA_CALS4       --------------MLRLIVATHNPNKAKEIKDFF---KGY-P-VE----VVSMKELGI-
IXTPA_DESPS       -------------MIPMIVLATTNQNKVKEFQEIL---KDF-A-IE----IRSLAEFGP-
IXTPA_CLOTE       --------------MKTVLLATNNENKVNEIKDIL---CEL-N-LK----VVSLKEVGI-
IXTPA_CLOAB       --------------MKKIIIASNNQNKIREIKQIL---KEF-D-FN----IVSLKEENI-
IXTPA_CLOPE       --------------MKKFILASNNAHKVKEIKEIL---KDF-N-LN----ILSLNEAGI-
IXTPA_DEIRA       ---MQQQTGGRRRQIRRVVVATSNAGKVRELQGAL---APL-G-WQ----CEGLGA----
IXTPA_THET2       -----------MLRGMKVVLTTGNPGKVRELKEGL---APL-G-WT----LLTLADFA--
IXTPA_THET8       -----------MLRGMKVVLATGNPGKVRELKEGL---APL-G-WT----LLTLADFA--
IXTPA_FRATT       --------------MKEIVLASSNKGKIREFTNIF---KQK-N-IK----ILPQTDFN--
IXTPA_LEGPH       --------------MKEIILATSNPGKIKELEQLL---APT----I----CIPQADLG--
IXTPA_LEGPA       --------------MKEIILATSNPGKIKELEQLL---APT----I----CIPQADLG--
IXTPA_ACIAD       ------MSAPHWLSQGTLVLASNNKGKITEFEKLF---AEL-Q-LPVD--VIPQGQLN--
IXTPA_COXBU       --------------MLEIVLASQNSSKLAEMQELL---RDL-E-IK----FIPQTEFS--
IXTPA_PSESM       ------------MNLTQLVLASHNGGKLKELQAML---GGS---VT----LRSVSEFS--
IXTPA_PSEPK       -----------MMNFQQLVLASHNAGKLKELQAML---GHS---VQ----LHSIGEFS--
IXTPA_PSEAE       -----------MIKLEQLVLASHNAGKLKELQAML---GAS---VK----VRSIGEFS--
IXTPA_XANOR       --------------MKHLVLASGNAGKLEELRAML---AGL-P-LR----IVAQGELG--
IXTPA_XYLFA       --------------MKQLVLASGNAGKLGELRAML---AGV-A-LQ----ITAQSEFG--
IXTPA_XYLFT       --------------MKKLVLASGNAGKLGELRAML---AGV-A-LQ----ITAQGEFG--
IXTPA_HAEDU       ------------MNRTKIVLATSNKGKVKEMADVL---SAF-G-FE----VIAQSEFG--
IXTPA_MANSM       -------------MKQKIVLATGNKGKVREMSDVL---ADF-G-FE----VVAQTDLD--
IXTPA_HAEIN       -------------MKQKIVLATGNKGKVKEMADVL---SDF-G-FE----VIAQTDLG--
IXTPA_PASMU       -------------MKQKIVLATGNLGKVKEMSDVL---ADF-G-FE----VIAQTELN--
IXTPA_IDILO       ------------MSQNTLVLATGNAGKVAELRHML---SQT-H-ATADWLVRPQSEWD--
IXTPA_SHEON       --------------MQQIVLASGNKGKLAEFDQML---AAY-G-VK----VLPQSQFN--
IXTPA_VIBCH       --------------MKKIVLATGNQGKVREMADLL---SDF-G-FD----VVAQSEFN--
IXTPA_PHOPR       --------------MSKLVLATGNQGKVKEMASLL---ADF-G-FD----VVAQSDFN--
IXTPA_VIBVU       --------------MKKIVLATGNQGKVREMADLL---ADF-G-FD----VVAQSEFN--
IXTPA_VIBPA       --------------MKKIVLATGNQGKVREMADLL---SDF-G-FE----VLAQSEFN--
IXTPA_PHOLL       --------------MQKVVLATGNPGKVRELAQLL---ADF-G-LD----IVAQTELG--
IXTPA_YERPE       --------------MQKIVLATGNPGKVRELANLL---ADF-G-LD----VVAQTELG--
IXTPA_PECAS       --------------MQKVVLATGNPGKVRELASLL---ADF-G-LD----IVAQTELG--
IXTPA_SALPA       --------------MQKVVLATGNAGKVRELASLL---SDF-G-LD----VVAQTELG--
IXTPA_SALTY       --------------MQKVVLATGNAGKVRELASLL---SDF-G-LD----VVAQTELG--
IXTPA_SALTI       --------------MQKVVLATGNAGKVRELASLL---SDF-G-LD----VVAQTKLG--
IXTPA_SHIFL       --------------MQKVVLATGNAGKVRELASLL---SDF-G-LD----IVAQTDLG--
IXTPA_ECOLI       --------------MQKVVLATGNVGKVRELASLL---SDF-G-LD----IVAQTDLG--
IXTPA_METCA       -------------MRRKLVLASNNAGKVRELQTLI---STS-G-FE----IVPQGALG--
IXTPA_AROAE       -------------MTARLVLASNNAKKAVEMTTLL---APL-G-IE----VLPQSAFD--
IXTPA_NEIMA       ----------MSEKPEKIVLASGNAGKLKEFGNLF---EPY-G-IT----VLPQSEFS--
IXTPA_NITEU       --------------MNKIVIASNNAGKLAEISRLL---APL-G-IE----VVTQSSLG--
IXTPA_CHRVO       -------------MFDQLVLASNNAGKLKEFGALF---AEL-G-VT----VRPQRDFD--
IXTPA_BORPE       -----MSAEILNPNLRRVVLASNNAGKLREFSALF---APL-G-IE----LVPQSELG--
IXTPA_BURPS       -----MSHASPDAARSRIVLASNNPGKLREFAALF---STA-G-ID----IVPQGELG--
IXTPA_RALSO       --------------MRRIVLASNNPGKLAEFNALL---APL-G-LD----VAPQGELG--
IXTPA_DESVH       ------------MTKATIVLATRNAGKVAELADAL---RAY-G-LD----VLGLDAFPQ-
IXTPA_LEIXX       --------------MVRVVLATHNRNKALEFQQIL-GDAVP-G-LQ----IVGYDG----
IXTPA_STRAW       --------------MTRLILATRNAGKITELRAIL---ADA-G-LTHD--LVGADAYPD-
IXTPA_STRCO       --------------MTRLILATRNAGKITELRAIL---ADA-G-LPHD--LVGADAYPH-
IXTPA_CUTAK       --------------MSRIVLASNNAKKLVELRRTFEGADTE---VE----IVGLSEVSD-
IXTPA_BIFLO       ---------------MQIVVATHNEGKLVEIRRIL--EEDL-GADAENIELVSAGSLH--
IXTPA_NOCFA       ------------MTMARVLVASRNAKKLAELRRIL-DDAGVAG-VQ----IVGLDDVPP-
IXTPA_MYCLE       -----------MALVTKLLVASRNWKKLAELRRVL---DNA-G-LS-GLTLVSLNDVVP-
IXTPA_MYCTU       -----------MALVTKLLVASRNRKKLAELRRVL-DGAGLSG-LT----LLSLGDVSP-
IXTPA_MYCBO       -----------MALVTKLLVASRNRKKLAELRRVL-DGAGLSG-LT----LLSLGDVSP-
IXTPA_MYCPA       --------------MSPLLVASRNRKKLAELRRVL-DAAGVTG-LT----LVSLDDVAP-
IXTPA_CORGL       ---------------MKLLLASNNAKKLKELQRIL-DQAGL-DSVE----LLALRDVEA-
IXTPA_CORDI       ---------------MKVLVASNNAKKLGELRTIL-ENAGL-SSVE----VVPLSAIDA-
IXTPA_LACPL       -----------MTKPQTLIIATNNANKAREFSAML---APY-D-IT----IKTLADFPN-
IXTPA_LACAC       -------------MSQKILFATGNKGKARELKEAF-KTAGV-D-VE----IITNSDLDN-
IXTPA_LACJO       --------------MDTLLFATNNKNKAREVEEAL-KKINF-P-IH----VITNQDLTD-
IXTPA_SYMTH       ------------MSQKRLVLATKNQGKVREFRSLL---AGA-G-FE----IVGLDPD---
IXTPA_GEOSL       --------------MTRLVVATRNKGKLREIAAIL---DGL-P-FT----LLSLEDFPD-
IXTPA_STAES       --------------MEDIVIATNNQGKINDFKAIF---KNQ-H-------VIGISELIE-
IXTPA_STAEQ       --------------MEDIVIATNNQGKINDFKAIF---KNQ-N-------VIGISELIE-
IXTPA_STAAR       --------------MKEIVIASNNQGKINDFKVIF---PDY-H-------VIGISELIL-
IXTPA_STAAC       --------------MKEIVIASNNQGKINDFKVIF---PDY-H-------VIGISELIP-
IXTPA_STAAS       --------------MKEIVIASNNQGKINDFKVIF---PDY-H-------VIGISELIP-
IXTPA_STAAW       --------------MKEIVIASNNQGKINDFKVIF---PDY-H-------VIGISELIP-
IXTPA_STAAM       --------------MKEIVIASNNQGKINDFKVIF---PDY-H-------VIGISELIP-
IXTPA_STAAN       --------------MKEIVIASNNQGKINDFKVIF---PDY-H-------VIGISELIP-
IXTPA_STRPN       -----------------MLIATRNEGKTKEFRAIF---DKL-G-YD----VENLNDYPD-
IXTPA_STRR6       -----------------MLIATRNEGKTKEFRAIF---DKL-G-YD----VENLNDYPD-
IXTPA_LACLA       -------------MEKTLIIATRNSGKTKEFKKLF---ADF-G-YE----IKDLTDYPE-
IXTPA_LISIN       --------------MSKIIIATANKGKAKEFEKIF---AKF-N-IE----VATLADFPE-
IXTPA_LISMF       --------------MSKIIIATANKGKAKEFEKIF---AKF-N-IE----VATLADFPE-
IXTPA_LISMO       --------------MSKIIIATANKGKAKEFEKIF---AKF-N-IE----VATLADFPE-
IXTPA_OCEIH       --------------MKKIIVATKNKGKAKEFKEFF---ASF-D-IE----AISLLDLPES
IXTPA_BACSK       --------------MNELVVATKNKGKLADFQTLF---TDR---YI----VKSLYDYPE-
IXTPA_BACCR       -----------MESMKQVVVATKNMGKVREFAELF---ERF-D-LE----VKSLHDFPH-
IXTPA_BACC1       --------------MKQVVVATKNMGKVREFAELF---ERF-D-LE----VKSLHDFPH-
IXTPA_BACCZ       -----------MENMKQVVVATKNMGKVREFAELF---ERF-D-LE----VKSLHDFPH-
IXTPA_BACHK       -----------MENMKQVVVATKNMGKVREFAELF---ERF-D-LE----VKSLHDFPH-
IXTPA_BACAN       --------------MKQVVVATKNMGKVREFAELF---ERF-D-LE----VKSLHDFPH-
IXTPA_BACLD       --------------MKEVIIATKNEGKVREFKAML---EPR-G-YD----VKSLLDIGY-
IXTPA_BACSU       -----------MIIMKEAIIATHNPGKVKEFKEIL---EPR-G-YD----VKSLAEIGF-
IXTPA_BACHD       --------------MKEWIVATKNKGKVAEFEAIL---GKR-G-FS----VKSLLDYPA-
IXTPA_GEOKA       --------------MKEIVIATKNAGKVREFAALF---AKR-G-VE----VKSLLDFPD-
                                       : :  *  :                              

IXTPA_MYCMS       YVEIEENKKTFKQNALLKAKHLAKY------------IN------GVAIGDDTGICVKAL
A7I4V0_METB6      LEIPELRSEDVRVIAREKARYAYDH------------IH------RPLIVDDTAFSINAL
B8D6D4_DESA1      GLKIEIQDDDLSNIALTAALIGYSL------------LR------KPVLVEDAGLFIRAL
IXTPA_PICTO       MKYEEIQGDTNKEISMDSCRKLMYK------------IK------DDFFIDDTGLYIDDL
IXTPA_THEAC       MKYEEIQDDSTERISYDSCNKLSRI------------VE------APYFVDDSGLFINAL
IXTPA_KORCO       VDYLEPQGEDTREIVVTSAKWLSNY------------IR------EPFFIEDSGLFIEAL
IXTPA_SACS2       GEKIEIQSDDLEEISRTAANLAYLI------------FR------RPLIVDDSGLFVQAL
IXTPA_PYRAE       AEKVEIQHDDVVVIARKAAEFLCSR------------YG------DFVVVDDTGLYIEAL
IXTPA_METTM       LGYPELQG-TLEEVARYGAEHAARI------------MD------GPVIVEDAGLFIRAL
IXTPA_METJA       ISYPEIQG-TLEEVAEFGAKWVYNI------------LK------KPVIVEDSGFFVEAL
IXTPA_METAC       NGYPELQEDELEPIAAHGAQYVANK------------LN------MPVMVDDSGIFINAL
IXTPA_METKA       LDYPELQSDSLEEIAAYGARYCAES------------LG------QPVIVEDSGLFIEAL
A0B9H6_METTP      LGYTEIQADTLEEVVLFGLKELSTR------------LD------SPFIIEDAGLFVEAL
IXTPA_THEKO       VSYPEIQADTLEEVAEYGAKWLAQR------------VD------GPFFLDDSGLFVEAL
IXTPA_PYRHO       HEYPEIQAEKLEDVVDFGISWLKGK------------VP------EPFMIEDSGLFIESL
IXTPA_PYRFU       LEYPEIQADTLEDVVVFGLNWLKDK------------VD------KPFIIEDSGLFIEAL
IXTPA_WOLSU       PFEIIEDGESFQANAIIKAKAIHER------------LSAQDRARYLILSDDSGISVPLL
IXTPA_THEMA       KIEVVEDGETFLENSVKKAVVYGKK------------LK------HPVMADDSGLVIYSL
IXTPA_MYCPE       IGEIEENGNSYFENALIKANAVFNY------------YK------EPVLSDDSGLELPEF
IXTPA_BORBU       ---IKETGKTFKENSLLKAKALFEI------------LN----NNQNVFGEDSGLCIEAL
IXTPA_BORBP       ---IKETGTTFKENSLLKAKALFAI------------LN----KNQNVFGEDSGLCIEAL
IXTPA_BDEBA       FTPRPEDGKTFEDNARIKAKTLRAV-----------KNN------VWVLGEDAGLVVEGL
IXTPA_LEPIC       SFNPEETGSTFKENALIKAKELFYL------------TK------IPSIADDSGICVSAL
IXTPA_LEPIN       SFNPEETGSTFKENALIKAKELFYL------------TK------IPSIADDSGICVSAL
IXTPA_CAMJE       PFEIEENGKTFKENALIKARAVFNA------------LDEKQKKDFIALSDDSGICVDVL
IXTPA_CAMJR       PFEIEENGKTFKENALIKARAVFNA------------LDEKQKKDFIALSDDSGICVDVL
IXTPA_PARUW       YMCPEEVGTNFKENAISKAEHAAKH------------LN------RWVLADDSGLVVPRL
IXTPA_CHLMU       YTPPKETGETPEENAIQKGVFAAQT------------FR------CWTIADDSMLIIPAL
IXTPA_CHLTR       YHPPKETGETPEENAIQKGLFAAQT------------FR------CWTIADDSMLIIPAL
IXTPA_CHLCV       YSAPKEIGCLPEENALAKGLHAAKE------------LN------SWVIADDTMLMVPAL
IXTPA_CHLPN       YKLPQEQEDSITANALTKGIHAANH------------LG------CWVIADDTMLRVPAL
IXTPA_HELHP       TFEIAENGNSFKENATLKVKAIYQALYTLSQSTMQENIRNLFAQPLAIIAEDSGLCVPVL
IXTPA_TREDE       EFDPEETGSTFFENAMIKAKALYHI------------VK------APVLADDSGLCVDFL
IXTPA_AQUAE       KLEVEETGCTFLENAYLKARAYYER------------YK------IPALADDSGLIVEAI
IXTPA_RHOBA       AIDVVEDGETFSANAAKKATEQAKH------------LE------RWVLAEDSGLSVDAL
IXTPA_TROWT       GVTCRETGLTFTENAVLKAQAAVGS------------VK-----DVPIMADDSGICVDAL
IXTPA_WIGBR       ICSIEENKSTFLENALIKARNASKY-------------G------FPALSDDSGLIIKTL
IXTPA_ZYMMO       LPEPVEDGNSFIANAEIKARFVAEK------------TG------SVALADDSGLCVEAL
IXTPA_GLUOX       LPEPEETEETFTGNAAIKALAAARA------------SG------LPALADDSGFCVSAL
IXTPA_CAUVC       LPEPDETESTFVGNALLKARHAADL------------SG------LPALADDSGLSVTAL
IXTPA_BRADU       LSEPDETGNDFRSNAAIKAIAAAHA------------SK------LPSFADDSGIVVDAL
IXTPA_RHOPA       LAEPDETGDSFQANARIKAEAAAKA------------AQ------LPAFADDSGLAVDAL
IXTPA_RUEPO       LPEPEETEDTFVGNARIKAHAAARA------------TG------LPALSDDSGITIDAL
IXTPA_BARHE       LPEPKETGTTFEENAYIKAFAAAKN------------TG------LPALSDDSGLEVDAL
IXTPA_BARQU       LPEPKETGVTFEENAYIKAFAAAKN------------TG------LPALSDDSGLEVDAL
IXTPA_BRUME       LPEPDETGTTFEENAYIKALAAAKA------------TG------FPALSDDSGLMVDAL
IXTPA_AGRFC       FSEPEETGTTFEENAAIKALASAKA------------SG------LPALSDDSGLVIDAL
IXTPA_RHIME       FVEPDETGTTFEENATIKALASAKA------------SG------LPALSDDSGLAVDAL
IXTPA_CHLTE       DIDVEETEPTLEGNARLKADAIFEL------------VAPRLDW-FIALADDTGLEVDAL
IXTPA_PORGI       REDIPETADTLQGNALLKAEFVHKR------------YG------LPCFADDTGLEVEAL
IXTPA_BACFR       HTDIPETAETLEGNAYLKSSFIYRN------------YG------LNCFADDTGLEVESL
IXTPA_BACTN       HTDIPETAETLEGNALLKSSFIYRN------------YQ------LDCFADDTGLEVEAL
IXTPA_PROMP       SIEVEENGITFRENAIKKASEVSKK------------TR------NYAIADDSGICIDAL
IXTPA_THEEB       AIEIAETADSFVANACLKAATAAKV------------MG------EWAIADDSGLAVHAL
IXTPA_PROMA       HLEVEETGVSFAENARIKAIAVAKA------------TG------EMALADDSGLSVGSL
IXTPA_PROMM       DLAVEETGQTFAENARIKALTVAQA------------TG------QWALADDSGLSVEAL
IXTPA_SYNPX       GFDVEETGSTFAANARIKATAVAAM------------AG------SWALADDSGLSVNAL
IXTPA_GLOVI       DFAVEETGTTFAENARLKALAAAER------------TG------EWSVGDDSGLAVDAL
IXTPA_NOSS1       ELEVEETGDTFASNACLKASEVAKA------------TG------NWAIADDSGLQVDAL
IXTPA_SYNY3       EIEVEETGSTFYENACLKASQVAKA------------VN------QWAIADDSGLAVDAL
IXTPA_CALS4       EEDIEEYGNTIEENALIKARFLRDK------------VK-----EGIVISDDTGLFVEYL
IXTPA_DESPS       IPEAIEDGKDFDENAYKKAIHTAKI------------LG------IPAIADDSGLEVHAL
IXTPA_CLOTE       NVEVEEDELTFMGNALKKALTLYNM------------ID---DKKYMVLADDSGLSVDVL
IXTPA_CLOAB       DIDVEEDGKTFIENAYKKAYEIYKM-----------RKD------CMVIADDSGLTVDEL
IXTPA_CLOPE       DIDVEEDGKTFEENSFKKANEIRKY------------LLSKGESDFIVMADDSGLEVDYL
IXTPA_DEIRA       VTLPEETGSTYEENAALKACAAAMA------------TG------LPALADDSGIEVLAL
IXTPA_THET2       LRMPKEEGATFLENALLKAAYVAKA------------TG------LPALADDSGLEVYAL
IXTPA_THET8       LRMPKEEGATFLENALLKAAYVAKA------------TG------LPALADDSGLEVYAL
IXTPA_FRATT       VSDADEIGLSFIENAILKARNCAKH------------TG------LPAIADDSGLEVFSL
IXTPA_LEGPH       ISDAEETGLSFIENAILKARHASSL------------AN------KPALADDSGLVVPSL
IXTPA_LEGPA       IFDAEETGLSFIENAILKARHASSL------------AN------KPALADDSGLVVPSL
IXTPA_ACIAD       IPDAIEDGLSFVENAIIKARHASKI------------SG------KPAIADDSGICVPVL
IXTPA_COXBU       VPDIEETGSTFVENAIIKARHAAKQ------------TG------LPALADDSGLTIAAL
IXTPA_PSESM       LVEPEETGLSFVENAILKARNASRL------------SG------LPALADDSGLAVDFL
IXTPA_PSEPK       QVEPEETGLSFVENAILKARNAARI------------SG------LPALADDSGLAVDFL
IXTPA_PSEAE       QVEPEETGLSFVENAILKARNAARL------------SG------LPALADDSGLAVDFL
IXTPA_XANOR       VDDVPETGLTFVENALIKARHASAV------------TG------LPALADDSGLIVDAL
IXTPA_XYLFA       VQDVPETGLTFIENALIKARHACLM------------TG------FPALADDSGLIVDAL
IXTPA_XYLFT       VQDVPETGLTFIENALIKARHACLM------------TG------FPALADDSGLIVDAL
IXTPA_HAEDU       LVSPPETGLTFVENALLKARYASKM------------TG------LPAIADDSGLAVDAL
IXTPA_MANSM       IESPEETGLTFVENALLKARYAAKV------------SG------LPAIADDSGLVVEAL
IXTPA_HAEIN       IESPEETGLTFVENALLKARYASEK------------SG------LPAIADDSGLVVSAL
IXTPA_PASMU       IESPEETGLTFVENALLKARYASKM------------SG------LPAIADDSGLVVPAL
IXTPA_IDILO       FAEADETGTTFVENAIIKARHACQQ------------TG------LPAIADDSGLAVTAL
IXTPA_SHEON       VSEVAETGTTFVENAIIKARHAAQI------------TG------HAAIADDSGLEVDLL
IXTPA_VIBCH       VPEAAETGTTFIENAIIKARHAAQI------------TG------LPTIADDSGLEVDYL
IXTPA_PHOPR       VSSVAETGTTFIENAIIKARHAAKE------------TG------LPAIADDSGLEVDFL
IXTPA_VIBVU       VSEVAETGTTFIENAIIKARHAAKE------------TG------LAAIADDSGLEVDFL
IXTPA_VIBPA       VSEVAETGTTFIENAIIKARHAAQE------------TG------LPAIADDSGLEVDFL
IXTPA_PHOLL       VDSAEETGLTFIENAILKARHAAQV------------TG------LPAIADDSGLSVDIL
IXTPA_YERPE       VESAEETGLTFIENAILKARHAAQT------------TG------LPAIADDSGLAVDAL
IXTPA_PECAS       VDSAEETGLTFIENAILKARHAAQI------------TG------LPAIADDSGLAVDAL
IXTPA_SALPA       VDSAEETGLTFIENAILKARHAAKM------------TG------LPAIADDSGLAVDVL
IXTPA_SALTY       VDSAEETGLTFIENAILKARHAAKM------------TG------LPAIADDSGLAVDVL
IXTPA_SALTI       VDSAEETGLTFIENAILKARHAAKM------------TG------LPAIADDSGLAVDVL
IXTPA_SHIFL       VDSAEETGLTFIENAILKARHAAKV------------TG------LPAIADDSGLAVDAL
IXTPA_ECOLI       VDSAEETGLTFIENAILKARHAAKV------------TA------LPAIADDSGLAVDVL
IXTPA_METCA       IPEAEETGASFVENALIKAYHAARH------------SG------LPAIADDSGLEVDAL
IXTPA_AROAE       IPEADEPHPTFVENALAKARHAAAL------------SG------LPAVADDSGLCVAAL
IXTPA_NEIMA       IPECPEPYSTFVENALAKARHAAGH------------SG------LPALADDSGICAAAL
IXTPA_NITEU       VTEADEPHMTFVENALAKARHASLA------------TG------LPALADDSGICVSAL
IXTPA_CHRVO       VPECPEPHHTFLENALEKARHASRL------------TG------LPALADDSGICVEAL
IXTPA_BORPE       VSEAEEPHATFVENALAKARHASRH------------TG------LPALADDSGLCVVAL
IXTPA_BURPS       VSEADEPHATFVENALAKARHASRA------------TG------LPAVADDSGLCVPAL
IXTPA_RALSO       IPEAEEPHATFVENALAKARHASRL------------AG------LPALADDSGICAHAL
IXTPA_DESVH       VGEIEETGTTFEENALLKARAVAEA------------TG------HVAVADDSGLEVDAL
IXTPA_LEIXX       -PEPVEDGITFEQNALIKARAAAER------------TG------MIALADDSGICVDAM
IXTPA_STRAW       IPDVKETGVTFAENALLKAHALARA------------TG------LPAVADDSGLCVDVL
IXTPA_STRCO       IPDVKETGVTFAENALLKAHALAEA------------TG------LPAVADDSGLCVDVL
IXTPA_CUTAK       APAPEETGRTFVENALIKARAAAHE------------TG------LPALADDSGLEVDAL
IXTPA_BIFLO       LPDPVETGVTFQENALLKARAVAIR------------TG------LPAVADDSGLIVDVM
IXTPA_NOCFA       YDEAPETGATFEENALAKARDGAAA------------TG------LPCVADDSGLAVDAL
IXTPA_MYCLE       FDEAPEAGATFEDNALAKARDAFAA------------TG------LASVADDSGLEAAAL
IXTPA_MYCTU       LPETPETGVTFEDNALAKARDAFSA------------TG------LASVADDSGLEVAAL
IXTPA_MYCBO       LPETPETGVTFEDNALAKARDAFSA------------TG------LASVADDSGLEVAAL
IXTPA_MYCPA       FEEAPETGAVFEENALAKARDAFAA------------TG------LASVADDSGLEVAAL
IXTPA_CORGL       YDEPIEDGRTFADNAQIKARAGVTH------------TG------IATIADDSGIAVEEL
IXTPA_CORDI       YDEPVEDGRTFADNALIKARAGAHH------------SG------LITIADDSGFAVEEL
IXTPA_LACPL       IPEIKENGITFEENATKKATVVVEA------------TG------LPAIADDSGLMVKAL
IXTPA_LACAC       PPHPIESGRTFEANAKIKAHELADY------------SK------LPTIADDSGLMVDAL
IXTPA_LACJO       PPHVLETGTTFLANAKLKAHKMAEF------------SN------LPTLADDSGLSVDKL
IXTPA_SYMTH       APEVSETGDTFEENALIKARAASAL------------TG------LPALAEDSGIVVDAL
IXTPA_GEOSL       FPEVEEDGKTFEENALKKASVAANI------------TG------LPALADDSGLVVDAL
IXTPA_STAES       DFDVEETGATFEENARLKSEAAAHA------------LN------KRVIADDSGLEVFAL
IXTPA_STAEQ       DFDVEETGATFEENAKLKSEAAAHA------------LN------KRVIADDSGLEVFAL
IXTPA_STAAR       DFDVEETGSTFEENAILKSEAAAKA------------LN------KTVIADDSGLEVFAL
IXTPA_STAAC       DFDVEETGSTFEENAILKSEAAAKA------------LN------KTVIADDSGLEVFAL
IXTPA_STAAS       DFDVEETGSTFEENAILKSEAAAKA------------LN------KTVIADDSGLEVFAL
IXTPA_STAAW       DFDVEETGSTFEENAILKSEAAAKA------------LN------KTVIADDSGLEVFAL
IXTPA_STAAM       DFDVEETGSTFEENAILKSEAAAKA------------LN------KTVIADDSGLEVFAL
IXTPA_STAAN       DFDVEETGSTFEENAILKSEAAAKA------------LN------KTVIADDSGLEVFAL
IXTPA_STRPN       LPEVAETGMTFEENARLKAETISQL------------TG------KMVLADDSGLKVDVL
IXTPA_STRR6       LPEVAETGMTFEENARLKAETISQL------------TG------KMVLADDSGLKVDVL
IXTPA_LACLA       LSEIEETGTTFEENARLKAEQIAEI------------TG------QVVIGDDSGLCVDVL
IXTPA_LISIN       IGEIEETGTTFAENAALKAETVASL------------LN------QTVIADDSGLIVDVL
IXTPA_LISMF       IGEIEETGTTFAENAALKAETVASV------------LN------QTVIADDSGLIVDAL
IXTPA_LISMO       IGEIEETGTTFAENAALKAETVASV------------LN------QTVIADDSGLIVDAL
IXTPA_OCEIH       IPDIEETGTTFEENAALKAEQISER------------FN------TAVIADDSGLLIDAL
IXTPA_BACSK       VPEIIEDGDTFHENAAKKAETLAAY------------LQ------KLVIADDSGLLIDAL
IXTPA_BACCR       IEEVEETGETFEENAILKADSLSRQ------------LN------AIVIADDSGLIVDAL
IXTPA_BACC1       IEEVEETGETFEENAILKADSLSRQ------------LN------AIVIADDSGLIVDAL
IXTPA_BACCZ       IEEVEETGETFEENAILKADSLSRQ------------LN------AIVIADDSGLIVDAL
IXTPA_BACHK       IEEVEETGETFEENAILKADSLSRQ------------LN------AIVIADDSGLIVDAL
IXTPA_BACAN       IEEVEETGETFEENAILKADSLSRQ------------LN------AIVIADDSGLIVDAL
IXTPA_BACLD       TPEIEETGQTFEENAVIKAETISKE------------TG------KIVIADDSGLSVDYL
IXTPA_BACSU       TEEIEETGHTFEENAIMKAEAVAKA------------VN------KMVIADDSGLSIDNL
IXTPA_BACHD       IEDIEETGSTFNENATIKAEAIAER------------FQ------RPVLADDSGLIIDAL
IXTPA_GEOKA       APDVAETGSTFAENAVLKAEAASRR------------LK------RPVIADDSGLVVDAL
                                                                  . :*: :    :

IXTPA_MYCMS       NDFPGIYSKRWA----YPLT--N------HYDICNKLLDKLK--HIN-QLNK--RKAYMT
A7I4V0_METB6      KGFPGPYAAYVL-----------------STIGNTGVLRLMD----G-VQDR--TARFTT
B8D6D4_DESA1      NGFPGPYSSYVF-----------------KTLGLNGVLKLME----G-ISER--DACFKS
IXTPA_PICTO       NGFPGPYASYVN-----------------KTLGNKNIIRL--------ASGS--RAHFET
IXTPA_THEAC       RGFPGPYSNYVS-----------------STIGNEGILKIMD----D-VDDR--TAYFLT
IXTPA_KORCO       NGFPGPYSSYVF-----------------KKIGNEGVLKLMN----G-VENR--RAFFIS
IXTPA_SACS2       QNFPGPYTNFVK-----------------NTIGLKGILKLLE----G-IKDR--SAYFMT
IXTPA_PYRAE       GGFPGPYAEYVY-----------------RTIGLKGVLKLLE----G-AADR--RATFKC
IXTPA_METTM       KWFPGPYSAYVQ-----------------DTIGNRGILKLME----N-VEDR--YAEFRS
IXTPA_METJA       NGFPGTYSKFVQ-----------------ETIGNEGILKLLE----G-KDNR--NAYFKT
IXTPA_METAC       NGFPGPYSRFVE-----------------DKLGNLKVLKMME----G-EEDR--TAYFKT
IXTPA_METKA       NGFPGPYSAYVF-----------------DTIGNEGILKLLE----G-EENR--KAEFIS
A0B9H6_METTP      NGFPGVYSAYVQ-----------------KTIGNSGILRLMD----G-IENR--AASFRS
IXTPA_THEKO       KGFPGVYSAYVY-----------------KTIGYQGILKLLQ----G-EKNR--KAHFKS
IXTPA_PYRHO       KGFPGVYSSYVY-----------------RTIGLEGILKLME----G-AEDR--RAYFKS
IXTPA_PYRFU       NGFPGVYSAYVY-----------------KTIGLDGILKLME----G-IENR--KAYFKS
IXTPA_WOLSU       HGEPGIYSARYA----GEPL--S------SKRNLQKLIEEIQ--KRG-AERT--PAHYTA
IXTPA_THEMA       GGFPGVMSARFM----EEHS---------YKEKMRTILKMLE------GKDR--RAAFVC
IXTPA_MYCPE       KEILGIYSSRFA----GINA--T------DKENRYKLLDYLK--SKN-ITET--SAKYVC
IXTPA_BORBU       NLEPGIYSKRYDTYKLCKKL--S------TNEKNQLILDLMK----N-EKNR--KAYFIC
IXTPA_BORBP       NLEPGIYSKRYDTYKLCKKL--S------TNEKNQLILDLMK----N-EKNR--KAYFIC
IXTPA_BDEBA       NGLPGIHSARYA----GPKA--S------DSENVSKLLKMIT--LRP-MPNK--NAKFVC
IXTPA_LEPIC       KDEPGVYSARFG----GPEL--N------DEGRALLLLEKLK----G-NQNR--KAYYAC
IXTPA_LEPIN       KDEPGVYSARFG----GPEL--N------DEGRALLLLEKLK----G-NQNR--KAYYAC
IXTPA_CAMJE       EGNPGIYSARFS----GKGD---------DKSNRDKLVNEMI--KKG-FKQS--KAYYVA
IXTPA_CAMJR       EGNPGIYSARFS----GKGD---------DKSNRDKLVNEMI--KKG-FKQS--KAHYVA
IXTPA_PARUW       SGKPGIYSRRFA----GLEA--T------DEENRKKLLLEMR-QLIN-KEDR--TAYYEC
IXTPA_CHLMU       GGLPGKLSASFS----GEHA--S------DKDHRKKLLEEML-LLEN-PIDR--SAYFEC
IXTPA_CHLTR       GGLPGKLSASFA----GEQA--N------DKDHRKKLLENMR-LLEN-TIDR--SAYFEC
IXTPA_CHLCV       NGLPGKLSATFA----GEDA--C------DKDHRKKLLQEMQ-SLES-IVDR--SAYFEC
IXTPA_CHLPN       NGLPGPLSANFA----GVGA--Y------DKDHRKKLLDLMS-SLES-LVDR--SAYFEC
IXTPA_HELHP       NGEPGIYSARYA----HHKQFASMQYKNTDEANLYCLLNALT----H-CAPT--PAFFVA
IXTPA_TREDE       NGAPGIHSARYG-SIEGEHV--S------AEAGINKVLSELK----G-VKDR--SARFAC
IXTPA_AQUAE       SPYPGVYSSRFYDIDFGGRE--EVRTNK-DEANIRKLLRLLE----N-TENR--KAKFVA
IXTPA_RHOBA       KGAPGVYSARYA----GTHG--D------DEANNEKLLRELT--DVP-MDRR--GAQFNC
IXTPA_TROWT       NGMPGVLSSRWS----------Q------DGRNIDLLLWQMR--DVP-DVHR--TAHFVC
IXTPA_WIGBR       NGEPGVYSSRFS----GNQS--N------DIKNINMVLKKML--PFK-KMDR--QACMHC
IXTPA_ZYMMO       DEAPGIYSARWA----GEPR--D------FDKAMEKVHQELT--AKGAEASK--RAHFVC
IXTPA_GLUOX       DNRPGVYSARWG----GPTK--D------MQVAMERVHREMG----D-NPDQ--RAFFVA
IXTPA_CAUVC       DGAPGIFSARWA----GPGK--D------FALAMKKVEERLE--ETA-SDDR--TAWFTS
IXTPA_BRADU       DGAPGIYSARWA----GPT-----KDFTAAMTRIERLLQERG--ATA-PDKR--KAHFVS
IXTPA_RHOPA       DGAPGIYSARWA----GDA-----KDFAGAMARIERLLQERG--ATA-PERR--TAHFVS
IXTPA_RUEPO       DGAPGVYTADWA-----ETG--NGRDFLMAMTRAHDALEAKS----A-PHPR--LAQFRC
IXTPA_BARHE       NGAPGVYTADLA----LQSD--GTRDFLKAMQKIEEKLQKIG--AHK-KSQR--KCRFIS
IXTPA_BARQU       GGAPGVYTADWA----LQSD--GTRNFSKAMQKIEDELQKIG--AHE-KSQR--KARFIS
IXTPA_BRUME       DGEPGVYTANWA----ETED--GKRDFDMAMQKVENLLQEKG--ATT-PDKR--KARFVS
IXTPA_AGRFC       DGAPGVYTANWA----ETAD--GTRDFAMAMQKVEDALAERG--ASK-PEDR--TARFVS
IXTPA_RHIME       GGAPGVYTANWA----ERED--GSRDFQMAMEKVEEALRAKG--AVK-PESR--TARFVS
IXTPA_CHLTE       GGAPGVYSARYAPVPEGVAR--T------YEDNVRHLLSEMR----G-KSKR--TARFRT
IXTPA_PORGI       DRAPGVHSARYA----GEPT--N------ADANVRKLLEALS--SVP-HPRK---ACFRT
IXTPA_BACFR       GGAPGVYSARYA---GGEGH--N------AEANMLKLLHELE----G-KDNR--RAQFRT
IXTPA_BACTN       NGAPGVYSARYA---EGEGH--D------AQANMRKLLHELE----G-KENR--KAQFRT
IXTPA_PROMP       DGRPGIYSSRYA-------E--N------DQKRIERVLHELD----G-EKNR--GAFFIA
IXTPA_THEEB       QGAPGIYSARYG-------A--T------DAERIERLLREMA----D-VSDR--AAEFIC
IXTPA_PROMA       GGAPGVFSARYA------NT---------DLERVSRLLKELE----M-VDDR--SAFFSA
IXTPA_PROMM       AGAPGVYSARYA-------A--S------DALRIERLLQELK----G-IDDR--RAHFSA
IXTPA_SYNPX       GGAPGVHSARYA------PT---------DPERIEKLLGALS----N-ASER--HAQFCA
IXTPA_GLOVI       GGAPGVYSARYG-------R--N------DGERISRLLAALA----G-QADR--GARFIC
IXTPA_NOSS1       NGLPGVYSARYG-------K--T------DGERISRLLKELG----S-EVNR--QAQFVC
IXTPA_SYNY3       DGAPGLYSARYG------NT---------DRERIAKLLQALE----G-VSQR--QAQFIC
IXTPA_CALS4       GGQPGVYSARFA----GENA--T------YEENNRKLLKLLE--GVP-YEKR--KAYFKT
IXTPA_DESPS       NGAPGVYSARYS----GEGA--T------DASNCDKLLEELA----G-KEDR--SANFTC
IXTPA_CLOTE       GGAPGVFSARYA----GEHG--N------SKANNEKLLEDMK----G-LKNR--KGKFIC
IXTPA_CLOAB       EGAPGIYSARFA----GIHG--D------DKKNNEKLLSLLE--GVP-FEKR--NAQFVC
IXTPA_CLOPE       NGAPGIYSARYA----GEHG--N------DSKNNEKLLEELK--NVK-DDER--KANFIC
IXTPA_DEIRA       GGQPGVYSARFG----NVNS---------DVERNVLLLEKMR----R-HTDR--RAKFVS
IXTPA_THET2       GGEPGVYSARYG----GRAT---------DRERNVYLLERMR--HLK-GEER--KARFVA
IXTPA_THET8       GGEPGVYSARYG----GRAT---------DRERNVYLLERMR--HLK-GEER--KARFVA
IXTPA_FRATT       NGEPGIYSARYS----GEHG--N------DKANIQKLLAKLT----G-NDNR--NARFVC
IXTPA_LEGPH       NGEPGIYSARYA----GIKA--N------DEDNIQQLLSKMA--DLS-QEQR--QAYFFC
IXTPA_LEGPA       NGEPGIYSARYA----GRKA--N------DEDNIQQLLSKMA--DLS-QEQR--QAYFFC
IXTPA_ACIAD       GGAPGIYSARYA----GDHG--N------DAANNEKLLHDLK--PFR-NAEQAIQGMFVC
IXTPA_COXBU       NSAPGVFSSRYA----GKNA--T------DAERIQKVLEALE--AAD-DSDR--SASFHC
IXTPA_PSESM       GGAPGIYSARYA----DGQG---------DAANNAKLLEALK--DVP-DEQR--GAQFVC
IXTPA_PSEPK       GGAPGIYSARYA----DGKG---------DAANNAKLLEALK--DVP-EAER--SAQFVC
IXTPA_PSEAE       GGAPGIYSARYA----DGRG---------DAANNAKLLEAMK--DVP-DAER--GAQFVS
IXTPA_XANOR       DGAPGLYSARYA----GSPT--N------ALANNAKLLDAMR--GVP-AERR--SARFYA
IXTPA_XYLFA       GGAPGLYSARYA----GTPT--D------AAANNAKLLEMLR--DVP-VGRR--SARFYA
IXTPA_XYLFT       GGAPGLYSARYA----GTPT--D------AAANNAKLLEMLR--DVP-AGRR--CARFYA
IXTPA_HAEDU       AGAPGLYSARYA----GIED--D------DTANRRKLLAEMQ--NVP-DGQR--AAKFVS
IXTPA_MANSM       NGAPGLYSARYA----GIDGETA------DAENRRKLLRDLA--DVP-VGKR--QAKFVS
IXTPA_HAEIN       NGAPGLYSARYA----GEEG--N------DAKNREKLLAELA--HIA-QEQR--QAKFVS
IXTPA_PASMU       GGAPGLYSARYA----GVDGPDA------DAKNRAKLLHVLH--HIA-PTHR--QAKFVS
IXTPA_IDILO       NGAPGVYSARYA----GGNA--T------DSDNINKLLKALE--GVE-ESQR--QASFHC
IXTPA_SHEON       QGVPGIYSARYA----GENA--K------DQDNVLKLLDTLK--DYP--APR--TARFQC
IXTPA_VIBCH       NGAPGIYSARYA----GEHA--S------DGDNLNKLLMAMQ--DVP-DDQR--SARFHC
IXTPA_PHOPR       QGAPGIYSARFA----GEDA--T------DQQNLEKLLADME--GVP-AEQR--TARFHC
IXTPA_VIBVU       QGAPGIYSARYA----GEKA--S------DQENLEKLLTAME--GVP-EAQR--TARFHC
IXTPA_VIBPA       KGAPGIYSARYA----GEKA--S------DQENLEKLLAAME--GVP-EAER--TARFHC
IXTPA_PHOLL       GGAPGIYSARYA----GENA--T------DQQNLEKLLDTMK--DIP-DDQR--QAQFNC
IXTPA_YERPE       GGAPGIYSARYA----GTDA--S------DQENLEKLLVALQ--NVP-DEKR--GAQFHC
IXTPA_PECAS       GGAPGIYSARYA----GAEA--S------DQQNLDKLLLTVK--DVP-DEQR--RASFHC
IXTPA_SALPA       GGAPGIYSARYS----GENA--T------DQQNLEKLLHTLR--DVP-DDKR--QARFHC
IXTPA_SALTY       GGAPGIYSARYS----GENA--T------DQQNLEKLLHTLR--DVP-DDKR--QARFHC
IXTPA_SALTI       GGAPGIYSARYS----GENA--T------DQQNLEKLLHTLR--DVP-DDKR--QARFHC
IXTPA_SHIFL       GGAPGIYSARYS----GEDA--T------DQKNLQKLLETLK--DVP-DDQR--QARFHC
IXTPA_ECOLI       GGAPGIYSARYS----GEDA--T------DQKNLQKLLETMK--DVP-DDQR--QARFHC
IXTPA_METCA       GGEPGVHSARYA----GPAA--S------DDDNIDRLLAALD--GVE-AGRR--GARFRC
IXTPA_AROAE       GGAPGVQSARFA----GEPK--S------DARNNALLVERLA----G-SADR--RAFFYS
IXTPA_NEIMA       NGAPGIHSARYA--G-SNPK--S------DTANNLKLAAELA----G-KADK--SCCYVC
IXTPA_NITEU       RGDPGVFSARYA----GEPR--S------DERNNRKLVEALH----G-QSDR--RAYYYC
IXTPA_CHRVO       GGAPGVFSARFA----GEPK--S------DARNNALLVEKLQ----G-EANR--RAWYYC
IXTPA_BORPE       GGAPGVHSARYAQQP-GGAR--S------DAANNALLVRELA----A-AGDR--RAWYVA
IXTPA_BURPS       LGAPGVYSARYAQRA-GREK--S------DAANNAYLVEQLR----E-VADR--RAYYYC
IXTPA_RALSO       GGAPGVYSARYAQLAGGPKS---------DAANNARLVRELA----G-HADR--GAHYVC
IXTPA_DESVH       ERRPGVYSARYS----DDTP--DLPGDTRDARNNAKLLLELD--GVP-AERR--TARFRC
IXTPA_LEIXX       GGAPGIFSARWA----GRHG--D------AQANLRLLLDQLA--DLP-DSSR--AAHFTA
IXTPA_STRAW       GGAPGIFSARWS----GRHG--D------DRANLDLLLAQLS--DIS-EAHR--GAHFAC
IXTPA_STRCO       NGAPGIFSARWA----GRHG--D------DQANLDLLLAQIA--DIA-DEHR--GAHFAC
IXTPA_CUTAK       NRMPGIRSARWS----GPHA--H------DERNLQLLLDQTF--DLP-DERR--HGRFVC
IXTPA_BIFLO       GNAPGILSARWA----GAHG--H------DKANNALLLAQIE--DIP-DDKR--TARFRC
IXTPA_NOCFA       NGMPGVLSARWS----GTHG--D------DAANNALLLAQLR--DVP-DERR--GARFVS
IXTPA_MYCLE       GGMPGVLSARWS----GSYG--D------DAGNTALLLAQLC--DVP-DERR--SAAFVS
IXTPA_MYCTU       GGMPGVLSARWS----GRYG--D------DAANTALLLAQLC--DVP-DERR--GAAFVS
IXTPA_MYCBO       GGMPGVLSARWS----GRYG--D------DAANTALLLAQLC--DVP-DERR--GAAFVS
IXTPA_MYCPA       NGMPGVLSARWS----GRHG--D------DAANTALLLAQLR--DVP-DERR--AASFVS
IXTPA_CORGL       NGMPGVLSARWS----GAHG--N------DTANNELLLAQME--HVP-DERR--NAAFVS
IXTPA_CORDI       NGMPGVLSARWS----GQHG--N------DATNNELVLAQMK--HVP-EERR--HAAFVS
IXTPA_LACPL       HGDPGVFSARYA----GDHD---------DAANNAKLLANLG--GVP-EAER--TATFHT
IXTPA_LACAC       NGEPGVRSARYA----GEAH--N------DAKNNAKLLANLG--GIP-DEKR--TAKFWT
IXTPA_LACJO       NGAPGVHSARYG----GEAH--N------DALNNAKLLAELG--GVP-REKR--QATFHT
IXTPA_SYMTH       GGEPGVHSARWV------PG--S------DEDRVRALLARMA--EVP-AERR--TARYVS
IXTPA_GEOSL       DGKPGVYSARYS----GENA--S------DEANNAKLLSELE--SVP-YEER--TAAFRC
IXTPA_STAES       NGEPGVYSARYA----GLGK--N------DEDNIEKLLTNLE----D-VQDR--RAQFVC
IXTPA_STAEQ       NGEPGVYSARYA----GLGK--N------DEDNIEKLLTNLE----D-VQDR--RAQFVC
IXTPA_STAAR       NGEPGIYSARYA----GENK--S------DEANIEKLLNKLG----N-TTDR--RAQFVC
IXTPA_STAAC       NGEPGIYSARYA----GENK--S------DEANIEKLLNKLG----N-TTDR--RAQFVC
IXTPA_STAAS       NGEPGIYSARYA----GENK--S------DEANIEKLLNKLG----N-TTDR--RAQFVC
IXTPA_STAAW       NGEPGIYSARYA----GENK--S------DEANIEKLLNKLG----N-TTDR--RAQFVC
IXTPA_STAAM       NGEPGIYSARYA----GENK--S------DEANIEKLLNKLG----N-TTDR--RAQFVC
IXTPA_STAAN       NGEPGIYSARYA----GENK--S------DEANIEKLLNKLG----N-TTDR--RAQFVC
IXTPA_STRPN       GGLPGVWSARFA----GVGA--T------DRENNAKLLHELA-MVFE-LKDR--SAQFHT
IXTPA_STRR6       GGLPGVWSARFA----GVGA--T------DRENNAKLLHELA-MVFE-LKDR--SAQFHT
IXTPA_LACLA       GGLPGIWSHRFS----APDP--T------DEKNIAKLLHELAPTAIT-PERR--SAHFHT
IXTPA_LISIN       NGAPGVYSARYA----GVAH--D------DAKNNEKLLKNLE--GVE-PAKR--TARFHC
IXTPA_LISMF       DGAPGVYSARYA----GIAH--D------DAKNNEKLLKNLE--GVE-PDKR--TARFHC
IXTPA_LISMO       DGAPGVYSARYA----GVAH--D------DAKNNEKLLKNLE--GVE-PDKR--TARFHC
IXTPA_OCEIH       DGRPGLYSARYA----GEPT--N------DQANIEKVLKEMQ--DVP-DNDR--SARFIC
IXTPA_BACSK       GGKPGVYSARYA----GEPK--N------DQANIDKVLSELD--GVP-TQKR--TARFFC
IXTPA_BACCR       NGKPGVYSARFA----GEPK--D------DQANIDKVLQELN--EIP-FDKR--KARFYC
IXTPA_BACC1       NGKPGVYSARFA----GEPK--D------DQANIDKVLQELN--DVA-FEKR--KARFYC
IXTPA_BACCZ       NGKPGVYSARFA----GEPK--D------DQANIDKVLQELN--EVA-FEKR--KARFYC
IXTPA_BACHK       NGKPGVYSARFA----GEPK--D------DQANIDKVLQELN--EVA-FEKR--KARFYC
IXTPA_BACAN       NGKPGVYSARFA----GEPK--D------DQANIDKVLQELN--EVA-FEKR--KARFYC
IXTPA_BACLD       GGSPGVYSARYA----GEEK--N------DLANLKKLLKELE--GVE-KEDR--SARFRC
IXTPA_BACSU       GGRPGVYSARYA----GEQK--D------DQANIEKVLSELK--GIE-KEQR--TARFRC
IXTPA_BACHD       DGRPGIFSARYA----GEEK--D------DQKNIEKVLRELQ--DIP-WKAR--TARFHC
IXTPA_GEOKA       GGRPGVHSARYA----GEDK--N------DARNIAKLLRELD--GVP-MEQR--TARFHC
                      *  :                                                    

IXTPA_MYCMS       TAIALY-----------DA---INKKQFV---YQAR------------------------
A7I4V0_METB6      AIAFS-----------------DESGIEV---FSGT------------------------
B8D6D4_DESA1      VAVAVI-----------HG---EIIR------GEGE------------------------
IXTPA_PICTO       VISLFY-----------------SGKIYQ---FSGI------------------------
IXTPA_THEAC       VVSMNE----------------GH-SITQ---FIGK------------------------
IXTPA_KORCO       VIALSY----------------GRGIEV----FEGR------------------------
IXTPA_SACS2       ALTFTD----------------GKIIKT----FIGI------------------------
IXTPA_PYRAE       AAAICI----------------GG-RVEV---FVGE------------------------
IXTPA_METTM       AVGFCA----------------PKSEPEV---FLGV------------------------
IXTPA_METJA       VIGYCD----------------ENGVRL----FKGI------------------------
IXTPA_METAC       VIGYCE----------------PGKEPLV---FPGV------------------------
IXTPA_METKA       VVGYCE----------------PGGRPVT---FTGE------------------------
A0B9H6_METTP      VVGYSA----------------PGMEPVL---FKGE------------------------
IXTPA_THEKO       VIAYWD----------------GELHI-----FTGR------------------------
IXTPA_PYRHO       VIGFYI-----------------DGKAYK---FSGV------------------------
IXTPA_PYRFU       VIGFYD----------------GEIHL-----FVGE------------------------
IXTPA_WOLSU       AMAMIL-----------------EGRIYT---VHGW------------------------
IXTPA_THEMA       SATFFD-----------PV---ENTLISV----EDR------------------------
IXTPA_MYCPE       VLVYIF----------------NQGEALS---FKGE------------------------
IXTPA_BORBU       NISYIS----------------KNGQILN---FEGI------------------------
IXTPA_BORBP       NISYIS----------------KDRQILN---FEGI------------------------
IXTPA_BDEBA       TTVVYT-----------PT---GEEW--V---FNGE------------------------
IXTPA_LEPIC       AIAYVD-----------ES---TEQS------FEGR------------------------
IXTPA_LEPIN       AIAYVD-----------ES---TEQS------FEGR------------------------
IXTPA_CAMJE       AIAMVG-----------LM---GEFS------THGT------------------------
IXTPA_CAMJR       AIAMVG-----------LM---GEFS------THGT------------------------
IXTPA_PARUW       CLALSS-----------PT---GLQKC-----VQGI------------------------
IXTPA_CHLMU       CVVLVS-----------PF---GKIFK-----AHAS------------------------
IXTPA_CHLTR       CVALIS-----------PF---GKIFK-----AHAS------------------------
IXTPA_CHLCV       CIVLAS-----------PE---GKFFK-----ARGI------------------------
IXTPA_CHLPN       CVVLVS-----------PN---QEIFK-----TYGI------------------------
IXTPA_HELHP       HIALIFIKPYFCTYTLPPL---EQCVIEH---FEGI------------------------
IXTPA_TREDE       CMVCLL----------------DENRFYS---VQET------------------------
IXTPA_AQUAE       FIVVY-----------------GGSWGIF---AEGE------------------------
IXTPA_RHOBA       HLCLSD-----------PD---GNVRLAE----SGI------------------------
IXTPA_TROWT       SIACVM-----------PN---TEVR--T---VSSV------------------------
IXTPA_WIGBR       VLIYIR-----------NP---NDPIPII---SSGT------------------------
IXTPA_ZYMMO       ALSLCW-----------PD---GHVE--N---FEGH------------------------
IXTPA_GLUOX       ALCLAW-----------PD---GETR--T---VQGE------------------------
IXTPA_CAUVC       ALAVAW-----------PN---GPAV--V---VEGR------------------------
IXTPA_BRADU       ALCVAW-----------PD---DHLE--E---VEAR------------------------
IXTPA_RHOPA       ALCVAW-----------PD---GHIE--E---VEAR------------------------
IXTPA_RUEPO       TLVLAW-----------PD---GHDE--V---FEGV------------------------
IXTPA_BARHE       VICIAW-----------PD---AHAD--Y---FHGR------------------------
IXTPA_BARQU       VICIAW----------------SDAYADY---FRGS------------------------
IXTPA_BRUME       VICLAW-----------PD---GEAE--Y---FRGE------------------------
IXTPA_AGRFC       VLCLAW-----------PD---GHVE--Y---FRGE------------------------
IXTPA_RHIME       VLCLAW-----------PD---GHVE--L---FRGE------------------------
IXTPA_CHLTE       VIAMKG-----------RLPAANGSAVEIEETTDGH------------------------
IXTPA_PORGI       VIALID-----------DH---GKHF------FEGK------------------------
IXTPA_BACFR       AISLIL-----------------DEKEYL---FEGI------------------------
IXTPA_BACTN       AISLIL-----------------DGKEYL---FEGV------------------------
IXTPA_PROMP       NVCVCS-----------PS---RDVILES----EAK------------------------
IXTPA_THEEB       VIALAR-----------PD---GTIAVTT----EGR------------------------
IXTPA_PROMA       ALCLAS-----------SK---GEVLLEL----DGR------------------------
IXTPA_PROMM       ALCIAS-----------ET---NEVLLEV----EGR------------------------
IXTPA_SYNPX       ALCVAA-----------PD---GSVLIEV----EGR------------------------
IXTPA_GLOVI       AIALAE-----------P----GRVLKEV----EAE------------------------
IXTPA_NOSS1       VVAIAS-----------PD---GAIALQA----EGI------------------------
IXTPA_SYNY3       VVSIAA-----------PD---GSIQLST----KGI------------------------
IXTPA_CALS4       IIAVIE----------------GEKEVLL----EGV------------------------
IXTPA_DESPS       VISIAT-----------PG---GPAL--T---YEGR------------------------
IXTPA_CLOTE       AMALVI----------------DKDNIIK---VQGE------------------------
IXTPA_CLOAB       SIVLII----------------DEANSIK---VEGE------------------------
IXTPA_CLOPE       VIVAVT----------------DKGEKIV---AEGK------------------------
IXTPA_DEIRA       VLVLAY-----------PD---GKLEE-----YRGE------------------------
IXTPA_THET2       VLVLAY-----------PD---GHAEA-----YEGS------------------------
IXTPA_THET8       VLVLAY-----------PD---GHAEA-----YEGS------------------------
IXTPA_FRATT       ALAYVK-----------HE---FDPAPIL---AYGF------------------------
IXTPA_LEGPH       AIALMR-----------HA---KDPTPLI---ATGV------------------------
IXTPA_LEGPA       AIALMQ-----------HA---KDPTPII---ATGI------------------------
IXTPA_ACIAD       VLALVE-----------HA---EDPLPQI---FQGF------------------------
IXTPA_COXBU       VIALME-----------NE---NDPAPLI---CHGV------------------------
IXTPA_PSESM       VLALVR-----------HA---DDPLPIL---CEGL------------------------
IXTPA_PSEPK       VLALVR-----------HA---DDPLPIL---CEGL------------------------
IXTPA_PSEAE       VLALVR-----------HA---DDPLPIL---CEGI------------------------
IXTPA_XANOR       VIVLLR-----------HP---EDPQPLI---AEGS------------------------
IXTPA_XYLFA       VIVLLR-----------HA---EDPQPLI---ADGC------------------------
IXTPA_XYLFT       VIVLLR-----------HA---EDPQPLI---ADGC------------------------
IXTPA_HAEDU       CIVMLK-----------HE---TDPTPKI---AFGE------------------------
IXTPA_MANSM       CIVMLR-----------HE---TDPSPII---AEGE------------------------
IXTPA_HAEIN       CIVFLQ-----------HP---TDPSPII---AEGE------------------------
IXTPA_PASMU       CIVMLQ-----------HE---HDPSPII---AEGE------------------------
IXTPA_IDILO       VLVYMQ-----------SA---EDPTPII---CQGR------------------------
IXTPA_SHEON       VLVYMR-----------HA---KDPTPII---CQAS------------------------
IXTPA_VIBCH       VLVLMR-----------HA---DDPTPIV---CHGK------------------------
IXTPA_PHOPR       VLVMMR-----------HE---NDPTPLV---CHGS------------------------
IXTPA_VIBVU       VLVLMR-----------HE---NDPTPIV---CHGK------------------------
IXTPA_VIBPA       VLVLMR-----------HE---NDPTPIV---CHGK------------------------
IXTPA_PHOLL       VLVYIR-----------HA---EDPTPLV---FHGR------------------------
IXTPA_YERPE       VLVYMR-----------HA---EDPTPLV---FHGQ------------------------
IXTPA_PECAS       VLVYLR-----------HA---EDPTPIV---CHGS------------------------
IXTPA_SALPA       VLVYLR-----------HA---EDPTPIV---CHGS------------------------
IXTPA_SALTY       VLVYLR-----------HA---EDPTPIV---CHGS------------------------
IXTPA_SALTI       VLVYLR-----------HA---EDPTPIV---CHGS------------------------
IXTPA_SHIFL       VLVYLR-----------HA---EDPTPLV---CHGS------------------------
IXTPA_ECOLI       VLVYLR-----------HA---EDPTPLV---CHGS------------------------
IXTPA_METCA       VMVFVR-----------DA---EDTGPLI---AEGC------------------------
IXTPA_AROAE       VVALVR-----------HA---DDPRPLI---ADGE------------------------
IXTPA_NEIMA       VLVFVR-----------HK---DDPRPII---AEGV------------------------
IXTPA_NITEU       VIVLLR-----------HG---QDPQPVI---IEDT------------------------
IXTPA_CHRVO       VLVLVR-----------HA---DDPQPLV---ADGI------------------------
IXTPA_BORPE       LLALVR-----------TE---NDPCPLI---GEGL------------------------
IXTPA_BURPS       VLALVR-----------HA---DDPEPLI---AEGR------------------------
IXTPA_RALSO       VLVYVR-----------HA---DDPQPII---AEGS------------------------
IXTPA_DESVH       VMAACT-----------PD---GRHV--F---AEGA------------------------
IXTPA_LEIXX       TLALVT-----------PE---GETT--V---VEGV------------------------
IXTPA_STRAW       AAALAL-----------PD---GTER--V---VEGQ------------------------
IXTPA_STRCO       AAALAL-----------PD---GTER--V---VEGQ------------------------
IXTPA_CUTAK       AMAFVD-----------PD---GTEITKV-----AT------------------------
IXTPA_BIFLO       AAALVV-----------PD---TETGADV---TGGVAADGITVHTTAADGSPAPVHARYA
IXTPA_NOCFA       ACALVV-----------PG---GTET--V---VRGE------------------------
IXTPA_MYCLE       ACALV-----------------SESDEVV---VRGV------------------------
IXTPA_MYCTU       ACALVS----------------GSGEVVV----RGE------------------------
IXTPA_MYCBO       ACALVS----------------GSGEVVV----RGE------------------------
IXTPA_MYCPA       ACALVS-----------AS---GEVV------VRGE------------------------
IXTPA_CORGL       VCVLAL-----------PD---GQEF--V---QEGR------------------------
IXTPA_CORDI       VCALVT-----------PD---GDEH--I---VEGR------------------------
IXTPA_LACPL       TLVALK-----------PS-----GEKLV---VNGE------------------------
IXTPA_LACAC       TIVVSM-----------PG---EFEKDLV---VSGT------------------------
IXTPA_LACJO       TMVVSW-----------PG---RFDDDLV---TQGE------------------------
IXTPA_SYMTH       VIAVVL-----------PS---GREE--L---FRGE------------------------
IXTPA_GEOSL       TIALCS-----------PG---GKRY--T---FSGE------------------------
IXTPA_STAES       VISMSA-----------PN---EKTK--T---FKGT------------------------
IXTPA_STAEQ       VISMSA-----------PN---EKTK--T---FKGT------------------------
IXTPA_STAAR       VISMSG-----------PD---METK--V---FKGT------------------------
IXTPA_STAAC       VISMSG-----------PD---METK--V---FKGT------------------------
IXTPA_STAAS       VISMSG-----------PD---METK--V---FKGT------------------------
IXTPA_STAAW       VISMSG-----------PD---METK--V---FKGT------------------------
IXTPA_STAAM       VISMSG-----------PD---METK--V---FKGT------------------------
IXTPA_STAAN       VISMSG-----------PD---METK--V---FKGT------------------------
IXTPA_STRPN       TLVVAS-----------PN---KESL--V---VEAD------------------------
IXTPA_STRR6       TLVVAS-----------PN---KESL--V---VEAD------------------------
IXTPA_LACLA       TLVAAK-----------PG---RESL--V---VEAD------------------------
IXTPA_LISIN       TLAVAT-----------PS---EKTS--F---YTGE------------------------
IXTPA_LISMF       TLAVAT-----------PS---EKTS--F---YTGE------------------------
IXTPA_LISMO       TLAVAT-----------PS---EKTS--F---YTGE------------------------
IXTPA_OCEIH       VLAIAQ-----------PG---KETN--F---CTGY------------------------
IXTPA_BACSK       VIALAE-----------PG---KETI--F---AEGA------------------------
IXTPA_BACCR       ALAVAF-----------PE---GDKKPVI---VNGT------------------------
IXTPA_BACC1       ALAVAF-----------PE---GDKKPVI---VNGT------------------------
IXTPA_BACCZ       ALAVAF-----------PE---GDKKPVI---VNGT------------------------
IXTPA_BACHK       ALAVAF-----------PE---GDKKPVI---VNGT------------------------
IXTPA_BACAN       ALAVAF-----------PE---GDKKPVI---VNGT------------------------
IXTPA_BACLD       ALAICI-----------PG---QETK--T---VEGS------------------------
IXTPA_BACSU       ALAVSI-----------PG---EETK--T---VEGH------------------------
IXTPA_BACHD       SIALAR-----------PQ---AETI--V---FEGT------------------------
IXTPA_GEOKA       ALAVAI-----------P----GRPTAVV----EAT------------------------
                                                                              

IXTPA_MYCMS       ----------VNGYIDFQVNE-SEF-GFGYDFIFIP-KGY--------------DKAYSL
A7I4V0_METB6      ----------IEGRIIHG-TR-GTG-GFGYDPIFEV-G----------------EKTLAE
B8D6D4_DESA1      ----------VCGYITTT-PR-GNK-GFGFDPVFAPREQP--------------YRTFGE
IXTPA_PICTO       ----------LNGTISDH-ES-GSM-NFGYDPIFIP-DGY--------------DKSLAE
IXTPA_THEAC       ----------VMGKIARS-IR-GSN-GFGYDPIFIP-EGS--------------DRTFAE
IXTPA_KORCO       ----------VQGTIARE-VR-GG--GWGFDPIFIP-NGS--------------NKTYGE
IXTPA_SACS2       ----------VKGAISEE-IR-GNL-GFGFDPIFIP-EGE--------------KRTFAE
IXTPA_PYRAE       ----------VRGYIAHE-PR-GRG-GFGYDPIFIP-EGM--------------TATYAE
IXTPA_METTM       ----------VKGRIGTE-ER-GTR-GFAFDPLFYP-EGM--------------DRSFGE
IXTPA_METJA       ----------VKGRVSEE-IR-SKGYGFAYDSIFIP-EEE--------------ERTFAE
IXTPA_METAC       ----------VEGKIAYE-ER-GTG-GFGYDPIF---EYQ--------------GLTFGE
IXTPA_METKA       ----------IRGRIAEE-PR-GEE-GFGYDPIFIP-EGE--------------DSTFAE
A0B9H6_METTP      ----------LRGVIGFE-AR-GTG-GFGYDPIFEV-DG----------------RTLAE
IXTPA_THEKO       ----------VDGKIATE-PR-GSG-GFGFDPIFIP-EGF--------------DRTFAE
IXTPA_PYRHO       ----------TWGRISNE-KR-GTH-GFGYDPIFIP-EGS--------------EKTFAE
IXTPA_PYRFU       ----------VRGRISNE-KR-GLH-GFGYDPIFVP-DGF--------------DKTFAE
IXTPA_WOLSU       ----------MHGEAIIA-PR-GER-GFGYDPMFIP-QGE--------------NRTLGE
IXTPA_THEMA       ----------VEGRIANE-IR-GTG-GFGYDPFFIP-DGY--------------DKTFGE
IXTPA_MYCPE       ----------WEGKIIVS-DNLNLDTGFGYDPMFVP-KEY--------------TITVSE
IXTPA_BORBU       ----------IKGKIALS-LNDKKNYGFGYDSIFLT-KN---------------NKKLSD
IXTPA_BORBP       ----------IKGEIALS-LNDDKNYGFGYDSIFLT-KN---------------NKKLSD
IXTPA_BDEBA       ----------MKGTIASK-PA-GLH-GFGYDPVFIP-EGQ--------------TQTLAE
IXTPA_LEPIC       ----------CEGLISEEYDRIGIY-GFGYDPIFIF-PPL--------------QKPFSQ
IXTPA_LEPIN       ----------CEGLISEEYDRIGIY-GFGYDPIFIF-PPL--------------QKPFSQ
IXTPA_CAMJE       ----------MHGKVIDT-EK-GEN-GFGYDSLFIP-KGF--------------DKTLAQ
IXTPA_CAMJR       ----------MHGKVIDT-EK-GEN-GFGYDSLFIP-KGF--------------DKTLAQ
IXTPA_PARUW       ----------CEGFILNE-AR-GRN-GFGYDSLFVK-NDY--------------EKSFAE
IXTPA_CHLMU       ----------CEGTIVFK-ER-GSS-GFGYDPLFSK-HDY--------------KQTYAE
IXTPA_CHLTR       ----------CEGTIAFE-ER-GSS-GFGYDPLFVK-HDY--------------KQTYAE
IXTPA_CHLCV       ----------CEGYISNQ-EK-GSS-GFGYDSLFLK-YDY--------------KQTFAE
IXTPA_CHLPN       ----------CEGYISHQ-EK-GSS-GFGYDPIFVK-YDY--------------KQTFAE
IXTPA_HELHP       ----------LNGEVINE-MR-GNE-GFGYDPLFIP-AEHNPQ-----------SLTLAE
IXTPA_TREDE       ----------CEGHITEA-PS-GSG-GFGYDPIFFV-EKF--------------GKTFAE
IXTPA_AQUAE       ----------VRGEITKE-PR-GDR-GFGYDPVFVP-EGY--------------NKTMAE
IXTPA_RHOBA       ----------CRGRIATE-RS-GGA-GFGYDPLFVI-PEY--------------HKTFGE
IXTPA_TROWT       ----------WHGRILHA-PD-GTG-GFGYDPVFLP-DGY--------------SVSAAG
IXTPA_WIGBR       ----------IYGKISNSISK-INF-GFGYDSIFFL-PKK--------------KKTISE
IXTPA_ZYMMO       ----------VWGNLIWP-PR-GDR-GFGYDPMFVA-DGH--------------QQSFAE
IXTPA_GLUOX       ----------CHGTVVWP-PR-GDH-GHGYDPMFVP-EGE--------------SRTFAE
IXTPA_CAUVC       ----------VDGTLVFP-GR-GTR-GFGYDPIFVP-EGH--------------ALTFGE
IXTPA_BRADU       ----------VDGTLVWP-PR-GTA-GFGYDPMFRP-DGH--------------TRTFGE
IXTPA_RHOPA       ----------ADGTLVWP-PR-GTA-GFGYDPVFLP-EGH--------------SRTFGE
IXTPA_RUEPO       ----------APGHLVWP-IR-GAA-GFGYDPMFVP-EGY--------------DVTFAE
IXTPA_BARHE       ----------VEGSFIWP-PR-GDK-GFGFDPVFLP-DGY--------------KNTFGE
IXTPA_BARQU       ----------VEGTFIWP-PR-GDK-GFGFDPIFLP-DGY--------------ENTFGE
IXTPA_BRUME       ----------VEGTLVWP-PR-GNI-GFGYDPVFLP-DGY--------------GKTFGE
IXTPA_AGRFC       ----------VEGTVVWP-PR-GTS-GFGYDPIFKP-DGY--------------DTTFGE
IXTPA_RHIME       ----------VEGYVVWP-PR-GTS-GFGYDPVFQP-KGY--------------DTTFGE
IXTPA_CHLTE       ----------IDGLITTE-PK-GNG-GFGYDPVFAP-EGM--------------DRTFAQ
IXTPA_PORGI       ----------IEGTIASE-CR-GSG-GFGYDPVFIP-EGH--------------TLSFAE
IXTPA_BACFR       ----------IKGEIIKE-KR-GDS-GFGYDPVFVP-EGY--------------DRTFAE
IXTPA_BACTN       ----------IKGEIIKE-KR-GDS-GFGYDPIFKP-EGY--------------EQTFAE
IXTPA_PROMP       ----------CFGNIILS-PR-GKG-GFGYDPIFEE-RST--------------RLTFAE
IXTPA_THEEB       ----------CAGEILTA-PR-GQG-GFGYDPVFWV-PSQ--------------QRTFAE
IXTPA_PROMA       ----------CDGIITTT-PR-GKF-GFGYDPIFEV-KGT--------------GLTFSE
IXTPA_PROMM       ----------CEGLITHA-AR-GEK-GFGYDPIFEV-DAT--------------GTTFAE
IXTPA_SYNPX       ----------CDGWITTT-PR-GDG-GFGYDPIFEV-SCT--------------GLTFAQ
IXTPA_GLOVI       ----------CRGVILHA-PR-GNG-GFGYDPIFLV-PEL--------------DKTFAE
IXTPA_NOSS1       ----------CRGEILHA-PL-GSG-GFGYDPIFYV-PEK--------------QLTFAE
IXTPA_SYNY3       ----------CSGEITHS-PR-GDQ-GFGYDPIFWL-PEH--------------KKTFAE
IXTPA_CALS4       ----------LEGHILDH-LQ-GEN-GFGYDPVFFV-DGI--------------GKTLAE
IXTPA_DESPS       ----------CDGKILTE-KR-GKS-GFGYDPLFYF-AEY--------------DKTFAE
IXTPA_CLOTE       ----------VEGSIGYE-EK-GDN-GFGYDPLFFV-SKY--------------NMTFAE
IXTPA_CLOAB       ----------ISGFITDK-EI-GTK-GFGYDPLFYV-PEF--------------KKTFAE
IXTPA_CLOPE       ----------SYGLILEA-LS-GNE-GFGYDPLFFV-PEY--------------KKTFAE
IXTPA_DEIRA       ----------VTGQLLEG-PR-GES-GFGYDPLFLP-DGS--------------ELSMGE
IXTPA_THET2       ----------VEGVILEA-PR-GEG-GFGYDPLFYV-PEA--------------GKTFAE
IXTPA_THET8       ----------VEGVILEA-PR-GEG-GFGYDPLFYV-PEA--------------GKTFAE
IXTPA_FRATT       ----------LEGKIAHK-IS-GSN-GFGYDPIFIL-PQL--------------QKTLAE
IXTPA_LEGPH       ----------FHGLISVK-PS-GTN-GFGYDPVFYL-NEY--------------QCTAAE
IXTPA_LEGPA       ----------FHGIISVK-PS-GTN-GFGYDPVFYL-NEY--------------QCTAAE
IXTPA_ACIAD       ----------WHGEILEQ-AR-GEH-GFGYDPLFWL-SEL--------------KMSSAE
IXTPA_COXBU       ----------WEGEIARE-PR-GKN-GFGYDPIFYV-PSH--------------QRTAAE
IXTPA_PSESM       ----------WHGRILHA-AS-GEY-GFGYDPLFWV-PER--------------NCSSAE
IXTPA_PSEPK       ----------WHGRILFE-AS-GDQ-GFGYDPLFWV-PER--------------NCSSAD
IXTPA_PSEAE       ----------WEGRILRE-AR-GAH-GFGYDPLFWV-PER--------------DCSSAE
IXTPA_XANOR       ----------WEGTITTE-PR-GDG-GFGYNPVFLD-PVY--------------GLTAAE
IXTPA_XYLFA       ----------WEGEIVFE-PC-GSG-GFGYNPIFFD-PLY--------------GMTAAQ
IXTPA_XYLFT       ----------WEGEIAFE-PC-GSG-GFGYNPIFFD-PLY--------------GMTAAQ
IXTPA_HAEDU       ----------CFGEILRE-ER-GQN-GFGYDALFFY-PAK--------------QCTFAE
IXTPA_MANSM       ----------CIGEIIFA-EK-GEN-GFGYDSLFFT-PEK--------------GCTFAE
IXTPA_HAEIN       ----------CCGVIGFE-EK-GEN-GFGYDSLFFS-PEQ--------------GCTFAE
IXTPA_PASMU       ----------CYGEIGFA-EK-GEN-GFGYDSLFFS-PEV--------------NCTFAE
IXTPA_IDILO       ----------WDGHILTH-PV-GEE-GFGYDPVFWV-KEK--------------NCSAAQ
IXTPA_SHEON       ----------WEGQIDFV-QR-GDN-GHGYDPIFIP-EHH--------------DCSAAQ
IXTPA_VIBCH       ----------WEGKILTA-PH-GSN-GFGYDPIFWV-PEE--------------NCASAE
IXTPA_PHOPR       ----------WEGSILTQ-AQ-GEN-GFGYDPVFWV-PED--------------QCASAQ
IXTPA_VIBVU       ----------WEGRILTQ-AH-GDN-GFGYDPIFFV-PED--------------NCASAE
IXTPA_VIBPA       ----------WEGRILTE-AH-GEN-GFGYDPIFFV-PED--------------NCASAE
IXTPA_PHOLL       ----------WPGFIAHK-SA-GNG-GFGYDPIFYI-PEL--------------GCTAAE
IXTPA_YERPE       ----------WPGVIAHQ-PA-GAA-GFGYDPIFYV-PAL--------------GKTAAE
IXTPA_PECAS       ----------WQGVLTHQ-SS-GSG-GFGYDPIFFV-PEL--------------GKTAAE
IXTPA_SALPA       ----------WPGVITRQ-AA-GNG-GFGYDPIFFV-PSE--------------GKTAAE
IXTPA_SALTY       ----------WPGVITRQ-AA-GNG-GFGYDPIFFV-PSE--------------GKTAAE
IXTPA_SALTI       ----------WPGVITRQ-AA-GNG-GFGYDPIFFV-PSE--------------GKTAAE
IXTPA_SHIFL       ----------WPGVITRE-PA-GTG-GFGYDPIFFV-PSE--------------GKTAAE
IXTPA_ECOLI       ----------WPGVITRE-PA-GTG-GFGYDPIFFV-PSE--------------GKTAAE
IXTPA_METCA       ----------WEGWIGEN-RR-GSG-GFGYDPVFLV-PGT--------------GLSAAE
IXTPA_AROAE       ----------WHGTILYA-PR-GAN-GFGYDPLFFL-PEL--------------GQTAAE
IXTPA_NEIMA       ----------WHGQWNGV-PA-GEN-GFGYDPYFYL-PGH--------------GKTAAE
IXTPA_NITEU       ----------WRGEIIAE-PI-GQG-GFGYDPHFFL-PEL--------------GKTAAE
IXTPA_CHRVO       ----------WLGEVRDE-AA-GEG-GFGYDPHFHL-PGY--------------GVSVAE
IXTPA_BORPE       ----------WHGEIVDA-PA-GEH-GFGYDPHFYL-PQQ--------------GCTAAQ
IXTPA_BURPS       ----------WAGEIVDA-PR-GAH-GFGYDPHFFV-PAL--------------GATAAE
IXTPA_RALSO       ----------WFGEVIDA-PR-GDG-GFGYDPHFLL-PAL--------------GKTAAE
IXTPA_DESVH       ----------WEGHIALA-PE-GDN-GFGYDPLFID-PQS--------------GLHSAQ
IXTPA_LEIXX       ----------WPGRIARE-AR-GGH-GHGYDPIFLP-DGH--------------DVTAAE
IXTPA_STRAW       ----------LRGTLRHT-PT-GTN-GFGYDPVLQP-EGE--------------TRTCAE
IXTPA_STRCO       ----------LKGTLRHA-PA-GTG-GFGYDPILQP-EGE--------------TRTCAE
IXTPA_CUTAK       ----------MEGRIISE-AR-GKN-GFGYDPMFVP-DAQPG------------DLTSAE
IXTPA_BIFLO       IKSETVELGDMPGRIIRE-AR-GVH-GFGYDPLFVP-DDQPAGRVSTEPDHEGEPLTSAE
IXTPA_NOCFA       ----------WPGTIGRK-PM-GEG-GFGYDPLFVP-DGG--------------DVTAAQ
IXTPA_MYCLE       ----------WPGTIARE-PR-GYG-GFGYDSIFIP-DGP--G---------LGGRTVAQ
IXTPA_MYCTU       ----------WPGTIARE-PR-GDG-GFGYDPVFVP-YGD--------------DRTAAQ
IXTPA_MYCBO       ----------WPGTIARE-PR-GDG-GFGYDPVFVP-YGD--------------DRTAAQ
IXTPA_MYCPA       ----------WPGRIARE-PR-GDG-GFGYDPVFVPDDAA--------------GRTAAQ
IXTPA_CORGL       ----------WEGQLLRG-PK-GEN-GFGYDPLFIP-AEE-ID---------GQGRSSAE
IXTPA_CORDI       ----------WEGRMLTA-PR-GAN-GFGYDPLFVP-AEEDAA---------GTGRTSAE
IXTPA_LACPL       ----------LAGRILIA-PR-GDN-GFGYDPLFWS-SKF--------------QKSLAE
IXTPA_LACAC       ----------CSGRILAA-PR-GDD-GFGYDPLFFV-PKK--------------DKTFAQ
IXTPA_LACJO       ----------IRGEILTY-PR-GDG-DFGYDPLFFV-PDK--------------GKTFAE
IXTPA_SYMTH       ----------LEGRLAEA-PR-GTG-GFGYDPIFVV-AD---------------GRTVAE
IXTPA_GEOSL       ----------LHGVILDS-PR-GTG-GFGYDPLFFV-SEK--------------GATMAE
IXTPA_STAES       ----------VSGVITTE-RH-GKN-GFGYDPIFFV-PEL--------------NKTMAE
IXTPA_STAEQ       ----------VSGVITTE-RH-GKN-GFGYDPIFFV-PEL--------------NKTMAE
IXTPA_STAAR       ----------VSGEIADG-KY-GEN-GFGYDPIFYV-PKL--------------DRTMAQ
IXTPA_STAAC       ----------VSGEIADG-KY-GEN-GFGYDPIFYV-PKL--------------DKTMAQ
IXTPA_STAAS       ----------VSGEIADG-KY-GEN-GFGYDPIFYV-PKL--------------DKTMAQ
IXTPA_STAAW       ----------VSGEIADG-KY-GEN-GFGYDPIFYV-PKL--------------DKTMAQ
IXTPA_STAAM       ----------VSGEIADG-KY-GEN-GFGYDPIFYV-PKL--------------DKTMAQ
IXTPA_STAAN       ----------VSGEIADG-KY-GEN-GFGYDPIFYV-PKL--------------DKTMAQ
IXTPA_STRPN       ----------WSGYINFE-PK-GEN-GFGYDPLFLV-GET--------------GESSAE
IXTPA_STRR6       ----------WSGYINFE-PK-GEN-GFGYDPLFLV-GET--------------GESSAE
IXTPA_LACLA       ----------WDGYIALA-PK-GEN-GFGYDPIFMV-DAF---------------RTAAE
IXTPA_LISIN       ----------VEGVIAEQ-LC-GTN-GFGYDPLFFL-PEF--------------GLTMAE
IXTPA_LISMF       ----------VEGVIAEQ-LC-GTN-GFGYDPLFFL-PEF--------------GLTMAE
IXTPA_LISMO       ----------VEGVIAEQ-LC-GTN-GFGYDPLFFL-PEF--------------GLTMAE
IXTPA_OCEIH       ----------CEGHIHSK-QK-GDH-GFGYDPIFIP-KKY--------------DVTMAE
IXTPA_BACSK       ----------CEGRITEK-PT-GSN-GFGYDPIFFV-PSH--------------GQTMAE
IXTPA_BACCR       ----------CEGFILEQ-RR-GEN-GFGYDPIFYV-EEY--------------KKAMAE
IXTPA_BACC1       ----------CEGFILEQ-RR-GEN-GFGYDPIFYV-EEY--------------KKAMAE
IXTPA_BACCZ       ----------CEGFILEQ-RR-GEN-GFGYDPIFYV-EEY--------------KKAMAE
IXTPA_BACHK       ----------CEGFILEQ-RR-GEN-GFGYDPIFYV-EEY--------------KKAMAE
IXTPA_BACAN       ----------CEGFILEQ-RR-GEN-GFGYDPIFYV-EEY--------------KKAMAE
IXTPA_BACLD       ----------VEGYITEE-PR-GTN-GFGYDPVFLV-KDK--------------DQTMAE
IXTPA_BACSU       ----------VEGYIAEE-PR-GEY-GFGYDPIFIV-KDK--------------DKTMAE
IXTPA_BACHD       ----------CEGYITTE-PK-GTG-GFGYDPIFYV-PSH--------------DKTMAE
IXTPA_GEOKA       ----------CDGYIAEA-PR-GEG-GFGYDPVFYL-PER--------------GKTMAE
                              *             . .::  :                        . 

IXTPA_MYCMS       MNSELKN--------QISARKKAID-------KLIEYIDNVK------------------
A7I4V0_METB6      IPLEEKS--------AISHRAKALS-------AFSTWFMNRQDPGLRDTNR---------
B8D6D4_DESA1      MDVEEKN--------KYSHRAKAVK-------AVFEKIKEKAG-----------------
IXTPA_PICTO       LSISEKN--------RISHRSKALE-------IMVEFLKKQ-------------------
IXTPA_THEAC       MDIKAKN--------AISHRSIAFR-------GLFEYIKMNQTAKK--------------
IXTPA_KORCO       LG-DEKD--------RFSHRGASCR-------KLREFLMRFGSDRLP-------------
IXTPA_SACS2       MSLEEKN--------RYSHRARAFA-------KFAEFLESYTEKE---------------
IXTPA_PYRAE       LGEEVKN--------KISHRAKAFS-------QLGAWLTNRNLFK---------------
IXTPA_METTM       LSTIEKN--------RFSHRSRALK-------KFAQWYTENYEVI---------------
IXTPA_METJA       MTTEEKS--------QISHRKKAFE-------EFKKFLLDRI------------------
IXTPA_METAC       LGDTEKN--------KVSHRRRAVD-------EFLEWFTSKA------------------
IXTPA_METKA       LGVEEKC--------KISHRTKALE-------RFAEWYKNNVAGR---------------
A0B9H6_METTP      MDLEEKN--------MISHRGRSMK-------ALKRWLESQ-------------------
IXTPA_THEKO       MTTEEKN--------RISHRGRALR-------EFANWLKENLK-----------------
IXTPA_PYRHO       MTIEEKN--------ALSHRGKALK-------AFFEWLKVNLKY----------------
IXTPA_PYRFU       MSTEEKN--------SVSHRGKALK-------EFYRWMKENLKK----------------
IXTPA_WOLSU       MEESEKN--------AISHRAKALK-------LARKLLQSLTKTEG--------------
IXTPA_THEMA       I-PHLKE--------KISHRSKAFR-------KLFSVLEKILESENR-------------
IXTPA_MYCPE       MSISEKN--------LISHRAKAVN-------QFLNFLKDKK------------------
IXTPA_BORBU       LTLEEKN--------KISHRGIAFL-------KFKKFLLKSLFNS---------------
IXTPA_BORBP       LTLEEKN--------KISHRGIAFS-------KFKKFLLKSLFNN---------------
IXTPA_BDEBA       LGTGYKS--------LLSHRAMALK-------AFLEKLQTVNP-----------------
IXTPA_LEPIC       IQEETKN--------SVSHRKKALD-------ELLKFLKTKP------------------
IXTPA_LEPIN       IQEETKN--------SVSHRKKALD-------ELLKFLKTKP------------------
IXTPA_CAMJE       LSVDEKN--------NISHRFKALE--------LAKIILKILNKG---------------
IXTPA_CAMJR       LSVDEKN--------NISHRFKALE--------LAKIILKILNKG---------------
IXTPA_PARUW       IDEAVKN--------RISHRRKAFE-------RLSAFLENLRD-----------------
IXTPA_CHLMU       LPEEIKN--------QVSHRAKALA-------KLQPYVEMAFANHLLARNESL-------
IXTPA_CHLTR       LPEAIKN--------QVSHRAKALV-------KLQPYVETVLANHLLAGKESL-------
IXTPA_CHLCV       LSEDVKN--------QVSHRAKALQ-------KLAPYLQNLLEKQLVSRN----------
IXTPA_CHLPN       LSEDVKN--------QVSHRAKALQ-------KLAPHLQSLFEKHLLTRD----------
IXTPA_HELHP       FDMSAKN--------TISHRKKALS-------QCINRLFDKS------------------
IXTPA_TREDE       LTSEQKN--------SISHRGRALF-------SISRFIKGS-------------------
IXTPA_AQUAE       LSPEEKN--------KISHRGRALR-------KLVHVLKNCEKAF---------------
IXTPA_RHOBA       LNLTVKR--------ALSHRSRALR-------LFIPQLLRLVQSNSTSA-----------
IXTPA_TROWT       LGSDLKN--------RISHRYKALR-------LMSSLLKRTYFSCHA-------------
IXTPA_WIGBR       LTLEEKI--------KISHRGIAMK-------KMIKFLKNEKY-----------------
IXTPA_ZYMMO       IGAEAKK--------AISHRSEAFK-------QLLAACLR--------------------
IXTPA_GLUOX       MSEAEKN--------AVSHRGRALT-------AFLNTCLDTSTQKTERK-----------
IXTPA_CAUVC       MEPAAKD--------AMSHRARAFA-------KLKAALFD--------------------
IXTPA_BRADU       MTSIEKHGLPPL-GLALSHRARAFV-------KLAEICLEPR------------------
IXTPA_RHOPA       MTSIEKHGLPPL-GLGLSHRAKAFV-------KLAEICLAG-------------------
IXTPA_RUEPO       MDRWEKN--------KISHRARAVE-------KFVKGCFGG-------------------
IXTPA_BARHE       MTTEQKHGWKLNDQTPLSHRACAFK-------LLAENLLKLS------------------
IXTPA_BARQU       MSTEQKHGWKLNDKTPLSHRARAFK-------LLAENLLTLS------------------
IXTPA_BRUME       MTAEEKHGWKPGDASALSHRARAFK-------LFAEKALNVVSAPAE-------------
IXTPA_AGRFC       MSADEKHGWKHGDAFALSHRARAFK-------KFVETCLEA-------------------
IXTPA_RHIME       MSAEEKHGWKPGDSEALSHRARAFK-------LFAETCLGA-------------------
IXTPA_CHLTE       LGIDEKN--------AISHRGRAVV-------AAAKRIGEYLSQCGIQ------------
IXTPA_PORGI       MGEETKN--------QISHRALAVA-------QLRDFLLCAK------------------
IXTPA_BACFR       LGNEIKN--------QISHRALAVN-------KLCEFLRSI-------------------
IXTPA_BACTN       LGNETKN--------KISHRALAVQ-------KLCEFLQR--------------------
IXTPA_PROMP       MNNVIKD--------SCSHRGRALK-------KIIPGLLEIFS-----------------
IXTPA_THEEB       MSPVEKQ--------QVSHRGQALQ-------RLREYFQTLNP-----------------
IXTPA_PROMA       MDSKQKR--------ELSHRGLAVK-------KLIPSLKKILDS----------------
IXTPA_PROMM       MTIEQKR--------QWSHRGCAFA-------LLDPALQELLHKQNKP------------
IXTPA_SYNPX       MPLTEKK--------SHGHRGKAFA-------LLEPQLQDLLSAEPR-------------
IXTPA_GLOVI       LDIVEKE--------RHSHRGRAVR-------KLLSGCSRGTFIVDH-------------
IXTPA_NOSS1       MTPELKK--------SVSHRGKAFA-------ALLPKMAAMLSSSAE-------------
IXTPA_SYNY3       MTKVEKQ--------KVSHRGKAFN-------KLIHQWPGLKFDSF--------------
IXTPA_CALS4       LSLEEKN--------KISHRGKALL-------KLKEYILKRLEEN---------------
IXTPA_DESPS       LSMEEKN--------RVSHRGKALAEIKAEAPQIIKWLEQRLSEEKPAKPDHSEFEGNDW
IXTPA_CLOTE       MDKDIKN--------SISHRRDALN-------KIKEKLKSYIEDK---------------
IXTPA_CLOAB       LTEDEKN--------SISHRAIALE-------KLCSEMKKLNWGE---------------
IXTPA_CLOPE       MTSDEKN--------AISHRGRALE-------KLKDNLKGILK-----------------
IXTPA_DEIRA       MTLEQKQ--------AISHRGQALA-------ALLAAHGA--------------------
IXTPA_THET2       MGLEEKA--------RYSHRGKALR-------ALLEAYKDGPPPREVSKLE---------
IXTPA_THET8       MGLEEKA--------RYSHRGKALR-------ALLEAYKDGPPPREVSKLE---------
IXTPA_FRATT       ISETDKN--------KISHRAIALD-------KIMQLL----------------------
IXTPA_LEGPH       LPAKIKN--------RISHRAKALN-------QLRALLPD--------------------
IXTPA_LEGPA       LPAKIKN--------RISHRAKALN-------QLRALLPD--------------------
IXTPA_ACIAD       MSKEEKN--------KISHRGQAMQ-------RFRESLMTRE------------------
IXTPA_COXBU       LDPQEKN--------AISHRGQALE-------QLSTVLTEAFLV----------------
IXTPA_PSESM       LGPSEKN--------QLSHRARAMV-------LLRQRLGLQ-------------------
IXTPA_PSEPK       LAPADKN--------QLSHRARAMA-------LLRKRLGLA-------------------
IXTPA_PSEAE       LAPEEKN--------RLSHRARAMA-------LLKQRLGL--------------------
IXTPA_XANOR       MDSALKN--------RLSHRAVALA-------TLQHKLHALSL-----------------
IXTPA_XYLFA       MGAELKN--------KISHRARALE-------QLRDCLHTFMA-----------------
IXTPA_XYLFT       MGAELKN--------KISHRARALE-------RLRDCLHTFMA-----------------
IXTPA_HAEDU       LDSTEKK--------QISHRALALV-------ALQKQL----------------------
IXTPA_MANSM       LETVEKK--------KISHRARALA-------VLKSKLGA--------------------
IXTPA_HAEIN       LETAEKK--------KISHRAKALS-------VLKSKL----------------------
IXTPA_PASMU       LATSEKK--------KISHRAKALS-------VLQTKLATKGA-----------------
IXTPA_IDILO       LSKTEKQ--------ALSHRGQALK-------QLLEQLAK--------------------
IXTPA_SHEON       MSSDEKN--------TLSHRGKALV-------QLITAMQEKGVFTDRNAQ----------
IXTPA_VIBCH       LEPVRKK--------QLSHRGKALQ-------KLFKAIEEQRTC----------------
IXTPA_PHOPR       LESPRKK--------ELSHRGKALQ-------KLFAALKDA-------------------
IXTPA_VIBVU       LEPVRKK--------QLSHRGKALK-------QLFATLREQPLV----------------
IXTPA_VIBPA       LEPARKK--------QLSHRGKALK-------SLFAQLSAQTAQ----------------
IXTPA_PHOLL       LTGEQKN--------AVSHRGQALK-------MMLDTLRNA-------------------
IXTPA_YERPE       LTREEKH--------AVSHRGQALK-------LMLDALRDA-------------------
IXTPA_PECAS       LTREEKN--------AQSHRGQALR-------LLLDALRNA-------------------
IXTPA_SALPA       LTREEKS--------AISHRGQALK-------LLLDALRNG-------------------
IXTPA_SALTY       LTREEKS--------AISHRGQALK-------LLLDALRNG-------------------
IXTPA_SALTI       LTREEKS--------AISHRGQALK-------LLLDALRNG-------------------
IXTPA_SHIFL       LTREEKS--------AISHRGQALK-------LLLDALRNG-------------------
IXTPA_ECOLI       LTREEKS--------AISHRGQALK-------LLLDALRNG-------------------
IXTPA_METCA       LPPEDKN--------RLSHRGQAAA-------VLASRLRALTGG----------------
IXTPA_AROAE       LDAQLKN--------TLSHRGAAMR-------HLLARLSTAPL-----------------
IXTPA_NEIMA       LDSEVKN--------RESHRAQALA-------ELLRKLAL--------------------
IXTPA_NITEU       LSIEEKN--------RISHRGKALA-------RLVQMLSENETVPVVPV-----------
IXTPA_CHRVO       LDAAEKN--------RVSHRGQALA-------ALMAKLKALA------------------
IXTPA_BORPE       LAPEHKN--------RISHRAQALA-------QLLDKLRATGPVDRP-------------
IXTPA_BURPS       LDPAAKN--------AASHRALALK-------ALVARLGEIR------------------
IXTPA_RALSO       LSKAEKN--------AVSHRAQALA-------QLVERLRLFENA----------------
IXTPA_DESVH       LSRDEKN--------ARSHRGKALR-------RLLELWPAFWRG----------------
IXTPA_LEIXX       LGPEAKN--------AESHRARAFA-------AIVPVLRALSRPGN--------------
IXTPA_STRAW       LSAEEKN--------AISHRGKAFR-------ELVPVVRELLG-----------------
IXTPA_STRCO       LTAEEKN--------AISHRGKAFR-------ALVPVVRELLG-----------------
IXTPA_CUTAK       MTPEVKD--------AISHRGQAVR-------AIVPAVVAHLEGR---------------
IXTPA_BIFLO       MTPAEKN--------AISHRGKALK-------ALVPAIEALLH-----------------
IXTPA_NOCFA       LTPAAKD--------AASHRGRALR-------HLLPALAALADRTE--------------
IXTPA_MYCLE       LRPAEKD--------AFSHRFRALT-------LLMPALRVLAMRT---------------
IXTPA_MYCTU       LSPAEKD--------AVSHRGRALA-------LLLPALRSLATG----------------
IXTPA_MYCBO       LSPAEKD--------AVSHRGRALA-------LLLPALRSLATG----------------
IXTPA_MYCPA       LSPAEKD--------AVSHRGRALR-------LLVPALETLARARG--------------
IXTPA_CORGL       LSAEEKD--------ALSHRGQALR-------GLVEKIAQVAAAS---------------
IXTPA_CORDI       MSPAEKN--------AISHRGKALQ-------QLVPIIAGYSTFF---------------
IXTPA_LACPL       LTPAQKN--------QISHRGAALR-------QLMTKFDEWWAKA---------------
IXTPA_LACAC       MTTDEKN--------EISHRGNVVR-------ELLKVLPALA------------------
IXTPA_LACJO       MTVDEKN--------AISHRGQALR-------KLLAELPTWWKKMENE------------
IXTPA_SYMTH       MALEEKN--------GISHRSRALA-------RCLERLPALLEEG---------------
IXTPA_GEOSL       LPLEAKN--------AVSHRGRALA-------LLKDHLGWQGIE----------------
IXTPA_STAES       ITNDEKG--------KISHRGNAIR-------LLKEYLEGEQHV----------------
IXTPA_STAEQ       ITNDEKG--------KISHRGNAIL-------LLKEYLEGEQHV----------------
IXTPA_STAAR       LSKEQKG--------QISHRRNAIN-------LLEAYLAGDQNV----------------
IXTPA_STAAC       LSKEQKG--------QISHRRNAIN-------LLQAFLEGDKNV----------------
IXTPA_STAAS       LSKEQKG--------QISHRRNAIN-------LLQAFLEGDKNV----------------
IXTPA_STAAW       LSKEQKG--------QISHRRNAIN-------LLQAFLEGDKNV----------------
IXTPA_STAAM       LSKEQKG--------QISHRRNAIN-------LLQAFLEGEKNV----------------
IXTPA_STAAN       LSKEQKG--------QISHRRNAIN-------LLQAFLEGEKNV----------------
IXTPA_STRPN       LTLEEKN--------SQSHRALAVK-------KLLEVFPSWQSKPSL-------------
IXTPA_STRR6       LTLEEKN--------SQSHRALAVK-------KLLEVFPSWQSKPSL-------------
IXTPA_LACLA       LSEKEKN--------QVSHRGQALR-------KLMAELPEWLYK----------------
IXTPA_LISIN       IPAEKKN--------EISHRANAIK-------QLEKDLAEVVEKVTKK------------
IXTPA_LISMF       IPAEKKN--------EISHRANAIK-------QLEKDLAEVVEKVTKK------------
IXTPA_LISMO       IPAEKKN--------EISHRANAIK-------QLEKDLVEVVEKVTKK------------
IXTPA_OCEIH       LDPAKKN--------QISHRKNAID-------QLEKWLHTI-------------------
IXTPA_BACSK       LSAGTKN--------QLSHRARALT-------ALKETIEGVWPK----------------
IXTPA_BACCR       LSSDEKN--------AISHRGRALR-------KLEEKIPEWFLGE---------------
IXTPA_BACC1       LSSDEKN--------AISHRGRALR-------KLEEKIPEWFLGE---------------
IXTPA_BACCZ       LSSDEKN--------AISHRGRALR-------KLEEKIPEWFLGE---------------
IXTPA_BACHK       LSSDEKN--------AISHRGRALR-------KLEEKIPEWFLGE---------------
IXTPA_BACAN       LSSDEKN--------AISHRGRALR-------KLEEKIPEWFLGE---------------
IXTPA_BACLD       LSSGEKN--------KISHRAEALK-------KLSALLDQA-------------------
IXTPA_BACSU       LTSDEKN--------KISHRADALK-------KLSKLLEA--------------------
IXTPA_BACHD       LTQEEKN--------KLSHRYHALK-------QLDKWLD---------------------
IXTPA_GEOKA       LAPEEKN--------QISHRAKALT-------KLDEQWEEIVGGKGRTE-----------
                  :    *           . *                                        

IXTPA_MYCMS       --
A7I4V0_METB6      --
B8D6D4_DESA1      --
IXTPA_PICTO       --
IXTPA_THEAC       --
IXTPA_KORCO       --
IXTPA_SACS2       --
IXTPA_PYRAE       --
IXTPA_METTM       --
IXTPA_METJA       --
IXTPA_METAC       --
IXTPA_METKA       --
A0B9H6_METTP      --
IXTPA_THEKO       --
IXTPA_PYRHO       --
IXTPA_PYRFU       --
IXTPA_WOLSU       --
IXTPA_THEMA       --
IXTPA_MYCPE       --
IXTPA_BORBU       --
IXTPA_BORBP       --
IXTPA_BDEBA       --
IXTPA_LEPIC       --
IXTPA_LEPIN       --
IXTPA_CAMJE       --
IXTPA_CAMJR       --
IXTPA_PARUW       --
IXTPA_CHLMU       --
IXTPA_CHLTR       --
IXTPA_CHLCV       --
IXTPA_CHLPN       --
IXTPA_HELHP       --
IXTPA_TREDE       --
IXTPA_AQUAE       --
IXTPA_RHOBA       --
IXTPA_TROWT       --
IXTPA_WIGBR       --
IXTPA_ZYMMO       --
IXTPA_GLUOX       --
IXTPA_CAUVC       --
IXTPA_BRADU       --
IXTPA_RHOPA       --
IXTPA_RUEPO       --
IXTPA_BARHE       --
IXTPA_BARQU       --
IXTPA_BRUME       --
IXTPA_AGRFC       --
IXTPA_RHIME       --
IXTPA_CHLTE       --
IXTPA_PORGI       --
IXTPA_BACFR       --
IXTPA_BACTN       --
IXTPA_PROMP       --
IXTPA_THEEB       --
IXTPA_PROMA       --
IXTPA_PROMM       --
IXTPA_SYNPX       --
IXTPA_GLOVI       --
IXTPA_NOSS1       --
IXTPA_SYNY3       --
IXTPA_CALS4       --
IXTPA_DESPS       SK
IXTPA_CLOTE       --
IXTPA_CLOAB       --
IXTPA_CLOPE       --
IXTPA_DEIRA       --
IXTPA_THET2       --
IXTPA_THET8       --
IXTPA_FRATT       --
IXTPA_LEGPH       --
IXTPA_LEGPA       --
IXTPA_ACIAD       --
IXTPA_COXBU       --
IXTPA_PSESM       --
IXTPA_PSEPK       --
IXTPA_PSEAE       --
IXTPA_XANOR       --
IXTPA_XYLFA       --
IXTPA_XYLFT       --
IXTPA_HAEDU       --
IXTPA_MANSM       --
IXTPA_HAEIN       --
IXTPA_PASMU       --
IXTPA_IDILO       --
IXTPA_SHEON       --
IXTPA_VIBCH       --
IXTPA_PHOPR       --
IXTPA_VIBVU       --
IXTPA_VIBPA       --
IXTPA_PHOLL       --
IXTPA_YERPE       --
IXTPA_PECAS       --
IXTPA_SALPA       --
IXTPA_SALTY       --
IXTPA_SALTI       --
IXTPA_SHIFL       --
IXTPA_ECOLI       --
IXTPA_METCA       --
IXTPA_AROAE       --
IXTPA_NEIMA       --
IXTPA_NITEU       --
IXTPA_CHRVO       --
IXTPA_BORPE       --
IXTPA_BURPS       --
IXTPA_RALSO       --
IXTPA_DESVH       --
IXTPA_LEIXX       --
IXTPA_STRAW       --
IXTPA_STRCO       --
IXTPA_CUTAK       --
IXTPA_BIFLO       --
IXTPA_NOCFA       --
IXTPA_MYCLE       --
IXTPA_MYCTU       --
IXTPA_MYCBO       --
IXTPA_MYCPA       --
IXTPA_CORGL       --
IXTPA_CORDI       --
IXTPA_LACPL       --
IXTPA_LACAC       --
IXTPA_LACJO       --
IXTPA_SYMTH       --
IXTPA_GEOSL       --
IXTPA_STAES       --
IXTPA_STAEQ       --
IXTPA_STAAR       --
IXTPA_STAAC       --
IXTPA_STAAS       --
IXTPA_STAAW       --
IXTPA_STAAM       --
IXTPA_STAAN       --
IXTPA_STRPN       --
IXTPA_STRR6       --
IXTPA_LACLA       --
IXTPA_LISIN       --
IXTPA_LISMF       --
IXTPA_LISMO       --
IXTPA_OCEIH       --
IXTPA_BACSK       --
IXTPA_BACCR       --
IXTPA_BACC1       --
IXTPA_BACCZ       --
IXTPA_BACHK       --
IXTPA_BACAN       --
IXTPA_BACLD       --
IXTPA_BACSU       --
IXTPA_BACHD       --
IXTPA_GEOKA       --