CLUSTAL format seed alignment for MF_01413

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

H2IRU3_RAHAC          MDNHNLMIEGLIYLGSAALFVPIAVRLGLGSVLGYLIAGCIIGPWGLKLVSDAESILTFA
A8G9N2_SERP5          MDNHHMMIEGLIYLGSAALFVPIAVRLGLGSVLGYLIAGCIIGPWGLKLVSDAESILTFA
A0A097R619_HAFAL      MDNHGMMIEGLIYLGSAALFVPIAVRLGLGSVLGYLIAGCIIGPWGLKLVSDAESILTFA
KEFC_CROS8            MDSHT-LIQALIYLGSAALIVPVAVRLGLGSVLGYLIAGGLIGPWGLRLVTDAQAILHFA
R9VUH5_9ENTR          MDSHS-LIQALIYLGSAALIVPIAMRLGLGSVLGYLIAGGIIGPWGLRLVTDAESILHFA
KEFC_ENT38            MDSHT-LIQALIYLGAAALIVPVAVRLGLGSVLGYLIAGCIIGPWGFRLVTDAESILHFA
A0A0H3CEV3_ENTCC      MDSHT-LIQALIYLGAAALIVPVAVRLGLGSVLGYLIAGCVIGPWGFRLVTDAEAILHFA
E3G9Z0_ENTLS          MDSHT-LIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAESILHFA
KEFC_CITK8            MDSHT-LIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAEAILHFA
KEFC_ECOLI            MDSHT-LIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAESILHFA
D2TGF1_CITRI          MDSHT-LIQALIYLGSAALIVPVAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAESILHFA
KEFC_SALTY            MDSHT-LLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAESILHFA
KEFC_KLEP7            MDSHT-LIQALIYLGAAALIVPIAVRLGLGSVLGYLIAGCIIGPWALRLVTDAEAILHFA
KEFC_KLEAE            MDSHT-LIQALIYLGAAALIVPIASVLGLGSVLGYLIAGCIIGPWALRLVNDAEAILHFA
I2BCW4_SHIBC          MDSHS-MIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAQTILNFA
A0A1X7L2N1_9ENTR      MDSHS-LIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLGLVTDAETILHFA
A0A317PZG2_9ENTR      MDSHN-LIQVLIFLGAAAFIVPLAVRLGLGSVLGYLIAGCLIGPWGLRLVTDAHTIIAFA
A0A0B1Z2S1_9PSED      MQTHS-LIEMLIYLASATLIVPIAVRFGLGPVLGYLLAGCVIGPWGLKLITDVKAILEFA
G8Q9J7_PSEF3          METHS-LIEMLIYLASATLIVPIAVRFGLGPVLGYLLAGCIIGPWGLKLITDVKAILEFA
Q87XC4_PSESM          MDTHS-LIEMLIYLGSAALIVPIAVRLGLGPVLGYLLAGCLIGPWGLKLITDVESILHFA
I7CB29_PSEPT          MDTHS-LIEMLIYLGSAALIVPIAVRLGLGPVLGYLIAGCLIGPWGLKLVTDVESILHFA
                      *:.*  ::: **:*.:*:::**:*  :***.*****:** :****.: *:.*..:*: **

H2IRU3_RAHAC          EIGVVLMLFVIGLELDPKRLWTMRASVFGGGSIQMAGCGVVLSAFCYFLGLDWKIALLIG
A8G9N2_SERP5          EIGVVLMLFIIGLELDPKRLWTLRASVFGGGIIQMAACGLALSAFCYFLGLDWKVALLIG
A0A097R619_HAFAL      EIGVVLMLFVIGLELDPKRLWTLRASVFGGGSIQMIGCGLVLSLFCYLLGLSWQVAILIG
KEFC_CROS8            EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMGACGLLLGGFCVALGLRWQVALLIG
R9VUH5_9ENTR          EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMASCGLLLGGFCALLGLPWPVAVLIG
KEFC_ENT38            EIGVVLMLFVIGLELDPRRLWKLRASVFGGGALQMIACGALLGGFCILLGMDWKVAELIG
A0A0H3CEV3_ENTCC      EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMAACGLLLGGFCILLGMDWKVAELIG
E3G9Z0_ENTLS          EIGVVLMLFVIGLELDPQRLWKLRVSVFGGGALQMVACGVLIGGFCMLLGLDWKVAELIG
KEFC_CITK8            EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIGLFCMFLGLRWQVAELIG
KEFC_ECOLI            EIGVVLMLFIIGLELDPQRLWKLRAAVFGCGALQMVICGGLLGLFCMLLGLRWQVAELIG
D2TGF1_CITRI          EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMAVCGGLIGLFCALLGLRWPVAALTG
KEFC_SALTY            EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMGVCGGLIGLFCMFLGLRWQVAELIG
KEFC_KLEP7            EIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVACGVLIGLFCMLLGLRWQVAELIG
KEFC_KLEAE            EIGVVLMLVAMGLELDPQRLWKLRASVFDGGALQMVACGVLIGLFCMLLGLRWQVAELIG
I2BCW4_SHIBC          EIGVVLMLFVIGLELDPRRLWTLRASVFGGGVLQMALCGLALGGFCMFLGLRWQVAVLIG
A0A1X7L2N1_9ENTR      EIGVVLMLFVIGLELDPQRLWTLRASVFGGGFLQMAACGLALGAFCIVMGLNWKIALLIG
A0A317PZG2_9ENTR      EIGVVLMLFVIGLELDPRRLWTLRASVFGGGALQMLACGLCLAAFCFTLGLSWQVAVLIG
A0A0B1Z2S1_9PSED      EIGVVLMLFIIGLELDPKRLWALRRMVFGGGALQMLACGGAIAAFCAALGLNWTAALLVG
G8Q9J7_PSEF3          EIGVVLMLFIIGLELDPKRLWALRKMVFGGGALQMLACGAAIGLFCTALGLNWTAALLVG
Q87XC4_PSESM          EIGVVLMLFIIGLELDPKRLWAMRRMVFGGGALQMLACGAAIAAFCAALGLNWTAALLVG
I7CB29_PSEPT          EIGVVLMLFIIGLELDPKRLWSMRRMVFGGGALQMLACGAAIAIFCAALGLSWTAALLVG
                      ********. :******:*** :*  **. * :**  **  :. **  :*: *  * * *

H2IRU3_RAHAC          LTLALSSTAIAMQAMSERSLTASPIGRSAFAVLLFQDIAAIPLVAMIPLLASTGEATTLM
A8G9N2_SERP5          LTLALSSTAIAMQAMSERNLTPSPIGRSAFAALLFQDIAAIPLVAMIPLLASSGAVTTLA
A0A097R619_HAFAL      LTLALSSTAIAMQAMNERNLTPSPIGRSSFAVLLFQDIAAIPLVAMIPLLASSGATTTMG
KEFC_CROS8            LTLALSSTAIAMQAMNERNLTASQMGRSAFAVLLFQDIAAIPLVAMIPLLAASGEATTAS
R9VUH5_9ENTR          LTLALSSTAIAMQAMNERNLTISQMGRSAFSVLLFQDIAAIPLVAMIPLLAASGGAMTLS
KEFC_ENT38            MTLALSSTAIAMQAMNERNLTVSQMGRSTFSVLLFQDIAAIPLVAMIPLLAVSGSSTTLG
A0A0H3CEV3_ENTCC      MTLALSSTAIAMQAMNERNLTVSQMGRSAFSVLLFQDIAAIPLVAMIPLLAASGASTTLG
E3G9Z0_ENTLS          LTLALSSTAIAMQAMNERNLTVSQMGRSAFAVLLFQDIAAIPLVAMIPLLAASGASTTFG
KEFC_CITK8            MTLALSSTAIAMQAMDERNLTVSQMGRSTFAVLLFQDIAAIPLVAMIPLLAASSASTTLG
KEFC_ECOLI            MTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLVAMIPLLATSSASTTMG
D2TGF1_CITRI          MTLALSSTAIAMQAMNERNLTVSQMGRSAFAVLLFQDIAAIPLVAMIPLLATSGAATTLG
KEFC_SALTY            MTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLVAMIPLLAASGASTTLG
KEFC_KLEP7            MTLALSSTAIAMQAMNERNLTVSQMGRSAFAVLLFQDIAAIPLVAMIPLLAASGGATSLM
KEFC_KLEAE            MTLALSSTAIAMQAMNERNLTVSQMGRSAFAVLLFQDIAAIPLVAMIPLLAASGGATSLM
I2BCW4_SHIBC          LTLALSSTAIAMQAMGERNLTLSLMGRRAFAVLLFQDIAAIPLVAMIPLLASSGASTTTG
A0A1X7L2N1_9ENTR      LTLALSSTAIAMQAMNERNLTVTPMGRGAFAVLLFQDIAAIPLVAMIPLLASSGGTMTFA
A0A317PZG2_9ENTR      LTLALSSTAIAMQAMNERNLALSPMGRSAFAVLLFQDIAAIPLVAMIPLLANSGASTTLA
A0A0B1Z2S1_9PSED      LTLSLSSTAIAMQAMSERNLTATAVGRSSFAVLLFQDIAAIPLVAMIPLLSAHGQTPSGM
G8Q9J7_PSEF3          LTLSLSSTAIAMQAMSERNLTATAVGRSSFAVLLFQDIAAIPLVAMIPLLSAHGDTPSGT
Q87XC4_PSESM          LTLSLSSTAIAMQAMNERNMTSTAVGRSSFAVLLFQDIAAIPLVAMIPLLAANGGTPSGA
I7CB29_PSEPT          LTLSLSSTAIAMQAMNERNVTSTAVGRSSFAVLLFQDIAAIPLVAMIPLLAANGGTPSGS
                      :**:***********.**.:  : :** :*:.******************:  .   :  

H2IRU3_RAHAC          SFGLSAAKVAGALVLVVLLGRYVTRPLLHFVARSGMREVFSAVALFLVFGFGILLEMAGM
A8G9N2_SERP5          TFALSAAKVVGALVIVVLLGRYVTRPLLHFVARSGMREVFSAVALFLVFGFGILLEMAGL
A0A097R619_HAFAL      AFALSAAKVVGALAIVILLGRYVTRPLLHFVARSGMREVFSAVALFLVFGFGVLLEMAGM
KEFC_CROS8            AFFLSALKVVGALALVVLLGRFVARPALRFVARSGLREVFSAVALFLVFGFGLLLEEAGL
R9VUH5_9ENTR          AFALSALKVVAALTLVVLIGRYVARPALRFVARSGLREVFCAVALFLVFGFGLLLEEAGL
KEFC_ENT38            AFALSALKVAGALALVILLGRYVTRPLLRFVARSGLREVFSAVALFLVFGFGLLLEEAGL
A0A0H3CEV3_ENTCC      AFALSALKVVGALALVVLLGRYVTRPLLRFVARSGLREVFSAVALFLVFGFGLLLEEAGL
E3G9Z0_ENTLS          VFLLSALKVAGALVLVVLLGRYVTRPVLRFVARSGLREVFSAVALFLVFGFGLLLEEVGL
KEFC_CITK8            VFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAVALFLVFGFGLLLEEVGL
KEFC_ECOLI            AFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAVALFLVFGFGLLLEEVGL
D2TGF1_CITRI          AFALSALKVAGALVLVILLGRYVTRPALRFVARSGLREVFSAVALFLVFGFGLLLEEVGL
KEFC_SALTY            AFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAVALFLVFGFGLLLEEVGL
KEFC_KLEP7            AFALSALKVAAALALVVVLGRYLTRPLLRFVARSGLREVFSAVALFLVFGFGLLLEEVGL
KEFC_KLEAE            AFALSALKVAAALALVVVLGRYLTRPLLRFVARSGLREVFSAVACSWSSALGLLLEEVGL
I2BCW4_SHIBC          AFLLSAAKIAGALVAVLLLGRYLTRPLLHFVARSGLREVFSAMALFLVFGFGLLLEEAGL
A0A1X7L2N1_9ENTR      TFLISALKVAAALALVVLLGRYVTRPVLRFVARSGLREVFSAVALFLVFGFGLLLEEAGL
A0A317PZG2_9ENTR      AFLISAAKVVSALALVVVLGRYVTRPLLRFVARSGLREVFSAMALFLVFGFGVLLEEAGL
A0A0B1Z2S1_9PSED      ALALSIVKIVAAISVVVLLGRYVTRPLLRFAARSGLREIFSAVALFLVFGFGFLLEEAGL
G8Q9J7_PSEF3          ALLLSIGKIVAAIAIVVLLGRYVTRPLLRFAARSGLREIFSAVALFLVFGFGFLLEEAGL
Q87XC4_PSESM          ELALSIAKIVGAVVAVVLLGRYVSRPVLRFVARSGLREIFSAVALFLVFGFGLLLEEAGL
I7CB29_PSEPT          ELALSIAKIVGAIVAVVLLGQYVSRPVLRFVARSGLREIFSAVALFLVFGFGLLLEGAGL
                       : :*  *:..*:  *:::*::::** *:*.****:**:*.*:*     .:*.*** .*:

H2IRU3_RAHAC          SMAMGAFLAGVLLASSEYRHALESDIQPFKGLLLGLFFIGVGMSIDFGTLVHQPLLIATL
A8G9N2_SERP5          SMAMGAFLAGVMLASSEYRHALESDIQPFKGLLLGLFFIGVGMSIDFGTLFHHPLLIASL
A0A097R619_HAFAL      SMAMGAFLAGVLLASSEYRHALESDIQPFKGLLLGLFFIGVGMSIDFGTLFSHPLLIATL
KEFC_CROS8            SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLVAHPLRVLTL
R9VUH5_9ENTR          SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLVTHPLRILLL
KEFC_ENT38            SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSVDFGTLVTHPLRILIL
A0A0H3CEV3_ENTCC      SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLVTHPLRILIL
E3G9Z0_ENTLS          SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSVDFGTLVSHPLRIVVL
KEFC_CITK8            SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLIDNPLRILIL
KEFC_ECOLI            SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLLENPLRIVIL
D2TGF1_CITRI          SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLIENPLRIAIL
KEFC_SALTY            SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLVENPLRILLL
KEFC_KLEP7            SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLVTHPLRIVIL
KEFC_KLEAE            SMAMGAFLAGVLLASSEYRHALENDIEPVKGLLLGLFFIGVGMSIDFAPWSPNPLRIVIL
I2BCW4_SHIBC          SMAMGAFLAGVLLASSEYRHALENDIEPFKGLLLGLFFIGVGMSVDFGTLLDNPLRVLVL
A0A1X7L2N1_9ENTR      SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLLDNPLRILVL
A0A317PZG2_9ENTR      SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSVDFGTLAHYPLRILLL
A0A0B1Z2S1_9PSED      SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLINAPLKVITL
G8Q9J7_PSEF3          SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLINSPLKVVTL
Q87XC4_PSESM          SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLIDEPLRVLTL
I7CB29_PSEPT          SMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLIDAPLKVITL
                      ***********:***********.**:*.***************:**..    ** :  *

H2IRU3_RAHAC          LIGFMALKAALLWLVAPWLGVPKKQRGQFAILIGQGSEFAFVIFGAAKMAGILPEDWSKA
A8G9N2_SERP5          LLGFMLIKAALLWLIAPWLGVPKRQRGMFAILLGQGSEFAFVIFGAAQLAGVLPPEWAKS
A0A097R619_HAFAL      LFGFLILKAALLWLVAPILGVPRKQRTLFAVLLGQGSEFAFVVFGAAQMAGVLPGEWAKS
KEFC_CROS8            LFGFLIIKTVTLWLVAKPLKVPGRQRRWFAVLLGQGSEFAFVIFGAARSAEVLDAEWAKA
R9VUH5_9ENTR          LVGFLVIKSAVLWLIARPLRVPGKQRLWFAALLGQGSEFAFVVFGTAQTAQVLDSEWAKA
KEFC_ENT38            LVGFLVIKMGMLWLIARPLNVPNRQRRWFAVLLGQGSEFAFVVFGAAQMANVLDPEWAKA
A0A0H3CEV3_ENTCC      LVGFLVIKMVMLWLIARPLNVPGRQRLWFAVLLGQGSEFAFVVFGAAQMANVLDPEWAKA
E3G9Z0_ENTLS          LFGFLVIKTLMLWLIARPLGVPKAQRRWFAVLLGQGSEFAFVVFGAAQMANVLDPEWAKA
KEFC_CITK8            LVGFLVIKTVMLWLVARPLRVPNKQRLWFAVLLGQGSEFAFVVFGAAQMANVLDPEWAKA
KEFC_ECOLI            LLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAFVVFGAAQMANVLEPEWAKS
D2TGF1_CITRI          LAGFLVIKIGILWLIARPLSVPNKQRRWFAVLLGQGSEFAFVVFGAARMAEVLDPEWAKA
KEFC_SALTY            LAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQGSEFAFVVFGAAQMADVLEPEWAKA
KEFC_KLEP7            LVGFLAIKMLMLWLIARPLGVPRAQRRWFAVLLGQGSEFAFVVFGAARMADVLDGEWAKA
KEFC_KLEAE            LVGFPAIKMLMLWLIAQPLGVPRAQHRWFAVLLGQGSEFAFVVFGPARMADVLDGEWPKA
I2BCW4_SHIBC          LAGFLVIKSLMLWILSIALRVPGRQRGWFTVLLGQGSEFAFVVFGAARMANVLDADWAKA
A0A1X7L2N1_9ENTR      LVGFLVIKTLVLWLVAKPLKVPRRQRRWFAVLLGQGSEFAFVIFGAAHMAQVLDDGWSKS
A0A317PZG2_9ENTR      LVGFLLIKALVLWLVARPLQVPRRQWRWFAVLLGQGSEFAFVVFSAAQNAQVLDDSWARS
A0A0B1Z2S1_9PSED      TLGFILIKLLVIKTVSRFLNVPAGQRSWQAVLLGQGSEFAFVVFGAATLAGILTDQWGKS
G8Q9J7_PSEF3          TLGFILIKLLVIKMAGRFLNVPAGQRSWQAVLLGQGSEFAFVVFGAATVAGILTDQWGKS
Q87XC4_PSESM          TLGFIVIKLVMIKLLGRFLNVPSDQRSWQAVFLGQGSEFAFVVFGAATVAGILIEPWGKS
I7CB29_PSEPT          TLGFILIKLLVIKLLGRFLSVPSDQRSWQAVFLGQGSEFAFVVFGAATVAGILVDPWGKS
                        **  :*   :   .  * **  *    : ::*********:*..*  * :*   * ::

H2IRU3_RAHAC          LTLAVALSMAVTPLLLVLSARLERNAPKDDRPHDTIDDENAQVIIAGFGRFGQIAGRLLL
A8G9N2_SERP5          LTLAVALSMAVTPLLLVVAARIEKNAPKDERPADEIDDENASVIIAGFGRFGQIAGRLLL
A0A097R619_HAFAL      LTLAVALSMAVTPILLVIYTRMEKNVKQDERPQDIIDDDNASVIIAGFGRFGQIAGRLLL
KEFC_CROS8            LTLAVALSMAATPLLLVLLTRLEKSGQQQAREADEIDEEQPRVIIAGFGRFGQIAGRLLL
R9VUH5_9ENTR          LTLTVALSMAATPLLLVLLARLEASGSQQEREADEIDEEDARVIIAGFGRFGQIAGRLLL
KEFC_ENT38            LTLAVALSMAVTPILLVLLTRLEQSGSEQDREADEIDEEQPRVIIAGFGRFGQISGRLLL
A0A0H3CEV3_ENTCC      LTLAVALSMAATPILLVLLTRLEKTGSEQEREADEIDEEQPRVIIAGFGRFGQITGRLLL
E3G9Z0_ENTLS          LTLAVALSMAATPLLLVVLSRLEKTGREQEREADEIDEEQPRVIIAGFGRFGQITGRLLL
KEFC_CITK8            LTLTVALSMAATPIFLVLLSRLEKSATGEAREADEIDAEQPRVIIAGFGRFGQITGRLLL
KEFC_ECOLI            LTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQPRVIIAGFGRFGQITGRLLL
D2TGF1_CITRI          LTLAVALSMAATPVLLVILSRLEASAAGDEREADEIDEEQPRVIIAGFGRFGQIAGRLLL
KEFC_SALTY            LTLAVALSMAATPIFLVLLTRMEKTATGEAREADEIDEEQPRVIVAGFGRFGQIAGRLLL
KEFC_KLEP7            LTLAVALSMAATPILLVLLTRLEKSSSGQARDADEIDEEQPRVIVAGFGRFGQIAGRLLL
KEFC_KLEAE            LTLAVALSMATTPILLVLLTRLEKSSSGQARDADEIDEEQPRVIVAGFGRFGQIAGRLLL
I2BCW4_SHIBC          LTLAVALSMAATPLLLVLLSALEGRSKAESREADEIDAEQPRVIVAGFGRFGQIAGRLLL
A0A1X7L2N1_9ENTR      LTLAVALSMAATPLLLVLLNRLEKTGSEQAGEADEIDEEQPRVIIAGFGRFGQIAGRLLL
A0A317PZG2_9ENTR      LTLAVALSMAATPLLLVLLNRLECAETASEQEADVIDDQHPSVIIAGFGRFGQIAGRLLL
A0A0B1Z2S1_9PSED      LTLAVALSMCLTPLLILLLDRVESTTKKNRQESDLVDQQNPRVIIAGFGRFGQIAGRLLM
G8Q9J7_PSEF3          LTLAVALSMCLTPLLIVLLDRFESVAKKNKRESDLVDQQNPRVIIAGFGRFGQIAGRLLM
Q87XC4_PSESM          LTLAVALSMCVTPLLILLLNYLESSKKQDSKEADTIDQSNPRVIIAGFGRFGQIAGRLLM
I7CB29_PSEPT          LTLAVALSMCVTPLLILLLNHLDSSGKQGSKESDIIDQSNPRVIIAGFGRFGQIAGRLLM
                      ***:*****. **:::::   .:          * :* ... **:*********:****:

H2IRU3_RAHAC          ANNVHTVVLDHDPDHIETLRKFGTKVFYGDATRVDLLESAGAAQAKVLINAIDDVEANLQ
A8G9N2_SERP5          ANGVHTVVLDHDPDHIETLRKFDTKVFYGDATRADLLEAAGAEHAKVLINAIDDVEANLQ
A0A097R619_HAFAL      ANDVHTVVLDHDPDHVETLRKFGMKVFYGDATRVDLLESAGAAKAKVLINAIDDVDANLQ
KEFC_CROS8            SSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRVDLLESAGVAKAEVLINAIDDPQANLQ
R9VUH5_9ENTR          SSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRVDLLESAGAGRAEVLINAIDDPQASLQ
KEFC_ENT38            SSGVKMVILDHDPDHIETLRKFGMKVFYGDATRVDLLESAGAAKAEVLINAIDDPLTNLQ
A0A0H3CEV3_ENTCC      SSGVKMVILDHDPDHVDTLRKFDMKVFYGDATRVDLLESAGAAKAEVLINAIDDPQTSMQ
E3G9Z0_ENTLS          SSGVKMVILDHDPDHVDTLRKFDMKVFYGDATRVDLLESAGAANAEVLINAIDDPKANLE
KEFC_CITK8            SSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINVIDDPQTSLQ
KEFC_ECOLI            SSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQ
D2TGF1_CITRI          SSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMELLESAGAAKAEVLINAIDDPQTSLQ
KEFC_SALTY            SSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQ
KEFC_KLEP7            SSGVKMVILDHDPDHVDTLRKFDMKVFYGDATRVDLLESAGAEKAEVLINAIDDPHVSLE
KEFC_KLEAE            SSGVKMVILDHDPDHVDTLRKFDMKVFYGDATRVDLLESAGAEKAEVLINAIDDPHVSLE
I2BCW4_SHIBC          SSGVKMVILDHDPDHIETLRKFGMKVFFGDATRLDTLESAGAQKAEVLINAIDDPAISLE
A0A1X7L2N1_9ENTR      SSGVNVVILDHDPDHIETLRKFGTKVFYGDATRVDLLESAGAAGAEVLINAIDDPEASMQ
A0A317PZG2_9ENTR      ASGVPVVVLDHDPDHIEILRKFGTQVFYGDATREDLLRSAGAEKASVLINAIDDPDVSLQ
A0A0B1Z2S1_9PSED      SCGVDVVVLDHDPDNIETLRKFGVKVFYGDATRLDLLHAAGAAQAVVLINAIDDQQDNLA
G8Q9J7_PSEF3          SCGVEVVVLDHDPDNIETLRKFGVKVFYGDATRLDLLHAAGAAQAVVLINAIDDREDNLT
Q87XC4_PSESM          SCGFEVVVLDHDPDHIETLRKFGVKVFYGDATRLDLLHAAGAAQAVVLINAIDNQDDNLL
I7CB29_PSEPT          SCGFEVVVLDHDPDHIETLRKFGVKVFYGDATRLDLLHAAGAAKAVVLINAIDNQDDNLA
                      : ..  *:******::: ****. :**:***** : *.:**.  * ****.**:   .: 

H2IRU3_RAHAC          LTALAKEHFPNLKIIARARDVDHWYQLRQLGVEAPERELFEGSLRVGRDVLEALGLDAYE
A8G9N2_SERP5          LTELAKRHFPHLKVVARARDVDHWYQLRQLGVESPERETFESSLRIGRETLELLGLDAYE
A0A097R619_HAFAL      LTELAQEHFPHLKIVARARDVDHYYQLRQRGVEFVERELFEGSLRVGRNVLEHLGCGAYE
KEFC_CROS8            LTELVQTHFPQVRIIARARDVDHYIRLRQAGVAQPERETFEGALRVGRMALEELGIGSYE
R9VUH5_9ENTR          LTELAKEHFPDLRIIARARDVDHYIRLRQAGVEKPERETFEAALKTGRLALEGLGLGSYE
KEFC_ENT38            LAELAKEHFPNLKIISRARDVDHYIKLRQAGVETPERETFEGALKTGRMALEGLGLGAYE
A0A0H3CEV3_ENTCC      LVELVKEHFPNLTIISRARDVDHYIQLRQAGVDAPERETFEGALKSGRMALESLGLGAYE
E3G9Z0_ENTLS          LTELAKAHFPNLRIIARARDVDHYIQLRQAGIDAPERETFEGALKSGRMALEALGLGAYE
KEFC_CITK8            LTEMVKAHFPDLQIIARARDVDHYIRLRQAGVEMPERETFEGALKTGRQALEKLGLGRYE
KEFC_ECOLI            LTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKTGRLALESLGLGPYE
D2TGF1_CITRI          LTEMVKAHFPNLHIIARARDVDHYIRLRQVGVAQPERETFEGALKSGRLALESLGLGRYE
KEFC_SALTY            LSELVKSHFPHLQIIARARDVDHYIRLRQAGVAMPERETFEGALKSGRQALEALGLGRYE
KEFC_KLEP7            LVARVKEHFPHLQIISRARDVDHYIQLRQAGVEAPERETFEAALKSGRMTLEALGLGAYE
KEFC_KLEAE            LVARVKEHFPHLQIISRARDVDHYIQLRQAGVEAPERETFEAALKSGRMTLEALGLGAYE
I2BCW4_SHIBC          LTEMVKNHFPHLQVIARARDVEHYIQLRHAGVDRPERETFEGALKVGRYALEALGVGSYE
A0A1X7L2N1_9ENTR      LTELAKEHFPHLQILARARDINHYIRLRQAGVEMPERETFESSLKIGRRALEGLGVGKYE
A0A317PZG2_9ENTR      LTEMVHEHFPDLHIIARARDLEHYIHLRQNGVQA-ERETFESAILVGRHALEALGVGRYE
A0A0B1Z2S1_9PSED      LTRMAQEHFPALKLIVRARDMAHLITLRQLGVESAERETFESALAMGRSALVQMGVGAYE
G8Q9J7_PSEF3          LTRLAQEHFPALQLIVRARDMGHLITLRQMGVEAAERETFESALSLGRSALEHMGVGAYE
Q87XC4_PSESM          LTKLAQEHFPSLKLVVRARDMGHIITLRQMGIEAVERETFESALSLGRRALEHLGVGRYE
I7CB29_PSEPT          LTELAQEHFPSLKLVVRARDMGHSITLRQMGIEAVERETFESALSLGRRALEQLGVGRYE
                      *   .: *** : :: ****: *   **: *:   *** **.::  ** .*  :* . **

H2IRU3_RAHAC          AREKADLFRRYNLKMLEAT-IENYEDTEFRIASMQRAKDMLTAAIEQDQERLASGQQQGW
A8G9N2_SERP5          AREKADTFRRYNLKMLEET-LENYQDTEFRLAGLQRAKEMLSAAIEQDQNRLARVQQSGW
A0A097R619_HAFAL      AREKADIFRRYNLRMLEET-VPNYEDAEFRLASLQRAKEMLSQAIEQDKARLTIAQQSGW
KEFC_CROS8            ARERADLFRCYNQQMVDEM-AEGDNDTSARAATFRRTSAMLTEIISEDRAHLSLIQRHGW
R9VUH5_9ENTR          ARERADHFRRFNTSMVEEM-AQVENDTQARAAVFKRTSAMLTEIISEDRAHLSLTQRHGW
KEFC_ENT38            ARERADLFRRFNLDMVEEMVEMADGDASSRAAAVKRTSAMLTEIINEDRNHLSLTQRHGW
A0A0H3CEV3_ENTCC      ARERADLFRRFNTDMVEEMVAMAGSTATERAAVFKRTSAMLTEIINEDRNHLSLVQRHGW
E3G9Z0_ENTLS          ARERADLFRRFNLRMVEEMVDIAEEDDASFAAAFKRTSAMLTDIINEDRSNLSLIQRHGW
KEFC_CITK8            ARERADLFRRFNTQMVEEM-AKGENDPTSRAAVYKRTSAMLSEIITEDREHLSLIQRHGW
KEFC_ECOLI            ARERADVFRRFNIQMVEEM-AMVENDTKARAAVYKRTSAMLSEIITEDREHLSLIQRHGW
D2TGF1_CITRI          ARERAYLFRRYNTRMVEEM-AKGENDATSRAAVYKRTSAMLSEIITEDREHLSLIQRHGW
KEFC_SALTY            ARERADLFRHFNTRMVEEM-AKGENDPLSRAAAYKRTSAMLSEIITEDREHLSLIQRHGW
KEFC_KLEP7            ARERADLFRRFNLQMVEEMVAMAENDAASRVAVFKRTSDMLTGIINEDRHHLSLVQRHGW
KEFC_KLEAE            ARERPDLFRRFNLQMVEEMVAMAENDPRRGVAVFKRTSDMLTGIINEDRHHLSLVQRHGW
I2BCW4_SHIBC          ARERADHFRRFNGRMLEEM-AAEDHDDKSLVALSKRTSAMLSDIISEDRALLDDTQRNGW
A0A1X7L2N1_9ENTR      ARERADHFRRFNLQMLEEM-VPTDDKTAERADVFKRNSAMLTEVINEDRAHLHVIQRDGW
A0A317PZG2_9ENTR      ARERADHFRRFNTRMVEEM-VAASDDMQARAAALRRASAMLSESIEQDRNQLDVMQRHGW
A0A0B1Z2S1_9PSED      ARERADQFRRLNLQMLEEIVAQPEDDLKFRHDAYRRANALLTEMFNEDRAHPVDSWPDHH
G8Q9J7_PSEF3          ARERADQFRRLNLKMLEEIVAQPEDDLKFRHDAYRRANALLTDMFNEDRARPVDNWQEHH
Q87XC4_PSESM          ARERADTFRRLNLEMLEEMAAQPVDDTEFRYDAYKRANVLLTELFNEDRTHPIDGEAKKN
I7CB29_PSEPT          ARERADRFRRLNLEMLEEMAAQPVDDTEFKYDAYKRANALLTEIFNEDRAHPIDTGPGEN
                      ***:.  **  *  *::                 :* . :*:  : :*:           

H2IRU3_RAHAC          RGSIDGKAP---------EKEVIEAKG------
A8G9N2_SERP5          RGSIDGKAP---------EDEVVEAKG------
A0A097R619_HAFAL      RGSIDGKSPDLDPMVTIHEEDVPELQKDA----
KEFC_CROS8            QGTREGKHTG-------NDADEPEVKPQP----
R9VUH5_9ENTR          QGTEEGRHTG-------DPADEPAVKPQA----
KEFC_ENT38            QGTEEGKHTG-------DPRDEPESKPTV----
A0A0H3CEV3_ENTCC      QGTEEGKHTG-------DPADEPESKPSA----
E3G9Z0_ENTLS          QGTDEGKHTG-------NPADEPESKPSA----
KEFC_CITK8            QGTDEGKHTG-------DAADEPEVKPST----
KEFC_ECOLI            QGTEEGKHTG-------NMADEPETKPSS----
D2TGF1_CITRI          QGTEEGKHTG-------NPADEPEVKPSARVKV
KEFC_SALTY            QGTAEGKHSG-------EVADEPEVKPSI----
KEFC_KLEP7            QGTEEGRHTG-------DIADEPENKPSA----
KEFC_KLEAE            QGTEEGRHTG-------DIADEPENKPSA----
I2BCW4_SHIBC          QGTAEGLHSG-------NENDEPDVKPRS----
A0A1X7L2N1_9ENTR      QGTKEGLHSG-------KLSDEPPVRPAE----
A0A317PZG2_9ENTR      QGTDQGKHGG-------SLQDDPDKLSDK----
A0A0B1Z2S1_9PSED      RNEKEQARS------------------------
G8Q9J7_PSEF3          RNETEKTAG------------------------
Q87XC4_PSESM          DPTTLRDR-------------------------
I7CB29_PSEPT          GLRNRENNDRTD---------------------