CLUSTAL format seed alignment for MF_01415

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q1ZLW4_PHOAS          --------MTRQNLPSILIIFAHPDPDESVANRAMLQDIELLGHVTVHDLYATYPDFFID
Q5E8D2_ALIF1          ----------MTQLPKILVILAHPDPEQSIANKAILSAYSHLEHVTVHDLYAHYPDFFID
B6EPN0_ALISL          MTQSNDVLLTSTPLPKILVILAHPDPEHSIANKAILAAYQQLPHVTVHDLYATYPEFFID
A7MXA6_VIBCB          ------MAVATPIPPRVLVIYAHPEPQNSIANQVMIKKIESLGHVTVHDLYGAYPDFFID
Q9KNX3_VIBCH          ---MRNLVNREQTKAKVLVVYAHPDPQHSVANQVMMEKIADLEHVSIIDLYATYPNFFID
B4EYX0_PROMH          ----------MSNASNVLLVYVHPEPRQSIANKALLRAVRDLENITIHDLYATYPDFFID
A0A140NKH3_PROSM      ----------MSNKLKILVLYAHPDPDESVANKALLKAVEDLEHVTIHDLYATYPDYFID
A0A0H3DUU2_EDWTF      ----------MAHSPKVLLIYAHPESPSSVANQLLLQAARRLSNVTVHDLYAHYPDFFID
D3V6A9_XENBS          ----------MLLPPKILLLYIHPEPQISVANNVLLQPVRALEHVTLHDLYGCYPDFFID
KEFG_SALTY            ----------MSQPAKVLLLYAHPESQDSVANRVLLKPAIQHNNVTVHDLYARYPDFFID
KEFG_SALTI            ----------MSQPAKVLLLYAHPESQDSVANRVLLKPAIQHNNVTVHDLYARYPDFFID
KEFG_ECOLI            ---------MMSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFID
KEFG_SHIFL            ----------MSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFID
KEFG_YERPS            ----------MLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHYPDFFID
KEFG_YERPE            ---------MMLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHYPDFFID
E0SIZ8_DICD3          ---------MMSQPPKILLLFAHPESQDSVANKLLLHSARQLGHVTVHDLYAHYPDFFID
KEFG_PECAS            ----------MSQPPKILLLYAHPEPQDSVANRVLLQPAQQLANVTVHDLYAHYPDFFID
                                      :*::  **:.  *:**. ::       :::: ***. **::***

Q1ZLW4_PHOAS          VVAEHELIASHDIIIFQHPLYMYSCPSLLKEWFDRVLSKGFAHG-DGNETVGKYWRSVIT
Q5E8D2_ALIF1          VVFEHELLAQHDIIIFQHPLYLYSCPALLKEWMDCVLGKGFAYG-NGDALKGKQWRSVIT
B6EPN0_ALISL          VVYEHELLAQHDIIVFQHPLYLYSCPSLLKEWMDCVLGKGFAYG-EGNALKGKQWRSVIT
A7MXA6_VIBCB          VNYEHDLLITHDVIVFHHPLYMYSCPALLKEWMDRVLGKGFAFG-DGSALAGKYWRSVIT
Q9KNX3_VIBCH          VHAEQQRLREHDVLVLQHPLYMYSCPALLKEWIDRVLSKGFAFG-KQSELKGKLWRSVIT
B4EYX0_PROMH          IHREQALLCQHQVIVFQFPLQTYSCPALLKEWQDRVLTRPFANKVGRAQLKGKTFRCVVT
A0A140NKH3_PROSM      VTAEQKLLCQHDIIVFQHPLYTYSCPALLKEWFDRVLTRRFATDMGYQKLKGKYWRSIIT
A0A0H3DUU2_EDWTF      IHHEQHLLRNHQVIVFQHPLYNYSCPALLKEWLDRVLARGFASGVGGYALRDKYWRSVVT
D3V6A9_XENBS          VPLEQKLLREHEIIVFQHPLYTYSCPALLKEWMDRVLSRDFVSG-SELALTGKYWRSVIT
KEFG_SALTY            TPYEQALLREHDVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLVGKYWRSVIT
KEFG_SALTI            TPYEQALLREHDVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLVGKYWRSVIT
KEFG_ECOLI            IPREQALLREHEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRSVIT
KEFG_SHIFL            IPREQALLREHEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRNVIT
KEFG_YERPS            IHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGKHWRSVIT
KEFG_YERPE            IHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGKHWRSVIT
E0SIZ8_DICD3          IHHEQQLLREHQLIVFQHPLYTYSCPALLKEWLDRVLTRGFANGVGGNALAGKYWRSVVT
KEFG_PECAS            IHHEQQLLREHQIIVFQHPFYTYSCPALLKEWLDRVLSRGFANGIGGNALAGKYWRSVIT
                         *:  :  *::::::.*:  ****:***** * ** . *.         .* :* ::*

Q1ZLW4_PHOAS          TGGGAEAYSPDGYNRYGIDTILKPFEICADLCQMHWLPPLILHWARRVTQDELNQHARAY
Q5E8D2_ALIF1          AGGIEEAFSKTGYNQHSMDDILVPFKITAALCQMEWLPPSIQYWARKITVEKRQQYIDEY
B6EPN0_ALISL          AGGIEEAFSETGYNQHSMDDILIPFKITAALCQMEWITPSVQYWARKITIEKRQSYINDY
A7MXA6_VIBCB          TGGKEDAFSPMGYNKYPLEQILQPFELTAALCQMHWIEPLVLYWSRNVSDIERYQHAEQY
Q9KNX3_VIBCH          TGGNHTAYDQRGYNRYPLNEILQPFELSAALCQMHWIEPLVLYWSRNISDQERAQHAERY
B4EYX0_PROMH          TGEPEHAYQHNGKNHYTLSELLRPIELMAEMCGMRWLSPMIIYSARQQSKTTLGHISDAY
A0A140NKH3_PROSM      TGEPQEAYQYGGYNHYPLSDILRPFELTAAMCDMQWLEPSVIYAARRQDKKQLQQIIAGY
A0A0H3DUU2_EDWTF      TGEPEGAYQLAGYNHYTMGEVLRPFELTALRCHMRWLPPLTIYWARRQRLEMLHAQAHDY
D3V6A9_XENBS          TGEPEGAYRKGGYNLYPMEEILRPFELTASMCHMHWLSPMIIYWARRQRPEVLASHAKAY
KEFG_SALTY            TGEPESAYRYDALNRYPMSDVLRPFELTAAMCRMHWMPPIIVYWARRQSPQTLASHAKAY
KEFG_SALTI            TGEPESAYRYDALNRYPMSDVLRPFELTAAMCRMHWMPPIIVYWARRQSPQTLASHAKAY
KEFG_ECOLI            TGEPESAYRYDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAQELASHARAY
KEFG_SHIFL            TGEPESAYRYDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAKELASHARAY
KEFG_YERPS            TGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPETLASHAQAY
KEFG_YERPE            TGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPETLASHAQAY
E0SIZ8_DICD3          TGEQQDAYRSAGVNRYTMDDVLRPFEMTATMCHMHWLSPLVIYWARRLPPDVLQEHARAY
KEFG_PECAS            TGEPEDAYHADGNNRYPMDDLLRPFELTAAMCRMHWMRPMIVYWARRLQPDVLSSQARAY
                      :*    ::   . * : :  :* *::: *  * * *: *   : :*.            *

Q1ZLW4_PHOAS          QSWLANP--L----IIEPRISLTKKETNNE
Q5E8D2_ALIF1          KAWLLNP--------KGGI-----------
B6EPN0_ALISL          RNWLLNP--------KGEL-----------
A7MXA6_VIBCB          RQWLNNP--LREWDEQGGRHGDNQ------
Q9KNX3_VIBCH          RQWLQEIAHW----QGEPYDATDQ------
B4EYX0_PROMH          RQWLQAP--L----EGEHADGR--------
A0A140NKH3_PROSM      REWIQQP--L----QIGGLS----------
A0A0H3DUU2_EDWTF      AEWLAAP--L----PAGGDDER--------
D3V6A9_XENBS          RKWLKSP--L----SLGGM-----------
KEFG_SALTY            GEWLANP--V----SAGGY-----------
KEFG_SALTI            GEWLANP--V----SAGGY-----------
KEFG_ECOLI            GDWLANP--L----SPGGR-----------
KEFG_SHIFL            GDWLANP--L----SPGGR-----------
KEFG_YERPS            VQWLQSP--L----TRGL------------
KEFG_YERPE            VQWLQSP--L----TRGL------------
E0SIZ8_DICD3          GDWLASP--F----PRGES-----------
KEFG_PECAS            GEWLSSP--L----PEEER-----------
                        *: