CLUSTAL format seed alignment for MF_01416

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPD_AMOA5       ------------------------------------------------------------
ATPD_CYTH3       ------------------------------------------------------------
ATPD_PARD8       ------------------------------------------------------------
ATPD_BACV8       ------------------------------------------------------------
ATPD_FLAPJ       ------------------------------------------------------------
ATPD_GRAFK       ------------------------------------------------------------
ATPD_ALKOO       ------------------------------------------------------------
ATPD_CLOPD       ------------------------------------------------------------
ATPD_CLOK1       ------------------------------------------------------------
ATPD_HUNT2       ------------------------------------------------------------
ATPD_RUMCH       ------------------------------------------------------------
ATPD_MYCGA       ------------------------------------------------------------
ATPD_MYCPN       ------------------------------------------------------------
ATPD_MYCMS       ------------------------------------------------------------
ATPD_MESFL       ------------------------------------------------------------
ATPD_MYCH7       ------------------------------------------------------------
ATPD_MYCMO       ------------------------------------------------------------
ATPD_THEM4       ------------------------------------------------------------
ATPD_PSELT       ------------------------------------------------------------
ATPD_THENN       ------------------------------------------------------------
ATPD_FERNB       ------------------------------------------------------------
ATPD_CAMFF       ------------------------------------------------------------
ATPD_CAMHC       ------------------------------------------------------------
ATPD_ARCB4       ------------------------------------------------------------
ATPD_CAMLR       ------------------------------------------------------------
ATPD_NITSB       ------------------------------------------------------------
ATPD_SULDN       ------------------------------------------------------------
ATPD_SULNB       ------------------------------------------------------------
ATPD_HELHP       ------------------------------------------------------------
ATPD_WOLSU       ------------------------------------------------------------
ATPD_PERMH       ------------------------------------------------------------
ATPD_SULSY       ------------------------------------------------------------
ATPD_AQUAE       ------------------------------------------------------------
ATPD_HYDS0       ------------------------------------------------------------
ATPD_GALSU       ------------------------------------------------------------
ATPD_CYACA       ------------------------------------------------------------
ATPD_PYRYE       ------------------------------------------------------------
ATPD_GRATL       ------------------------------------------------------------
ATPD_CYAPA       ------------------------------------------------------------
ATPD_RHDSA       ------------------------------------------------------------
ATPD_PHATC       ------------------------------------------------------------
ATPD_VAULI       ------------------------------------------------------------
ATPD_SYNJA       ------------------------------------------------------------
ATPD_TRIEI       ------------------------------------------------------------
ATPD_GLOVI       ------------------------------------------------------------
ATPD_PROMP       ------------------------------------------------------------
ATPD_STRA1       ------------------------------------------------------------
ATPD_STRMU       ------------------------------------------------------------
ATPD_STRU0       ------------------------------------------------------------
ATPD_STRR6       ------------------------------------------------------------
ATPD_LEPBP       ------------------------------------------------------------
ATPD_LEPIC       ------------------------------------------------------------
ATPD_EHRRW       ------------------------------------------------------------
ATPD_WOLTR       ------------------------------------------------------------
ATPD_ANAMM       ------------------------------------------------------------
ATPD_ANAPZ       ------------------------------------------------------------
ATPD_ECOLI       ------------------------------------------------------------
ATPD_PSYIN       ------------------------------------------------------------
ATPD_BLOPB       ------------------------------------------------------------
ATPD_BUCAP       ------------------------------------------------------------
ATPD_BUCBP       ------------------------------------------------------------
ATPD2_PHOPR      ------------------------------------------------------------
ATPD2_VIBTL      ------------------------------------------------------------
ATPD2_VIBCB      ------------------------------------------------------------
ATPD_NEIM0       ------------------------------------------------------------
ATPD_PSYWF       ------------------------------------------------------------
ATPD_FRAP2       ------------------------------------------------------------
ATPD_XYLFT       ------------------------------------------------------------
ATPD_COXBN       ------------------------------------------------------------
ATPD_THISH       ------------------------------------------------------------
ATPD_LEGPH       ------------------------------------------------------------
ATPD_NITOC       ------------------------------------------------------------
ATPD_PSEU5       ------------------------------------------------------------
ATPD_MARMS       ------------------------------------------------------------
ATPD_ACIAD       ------------------------------------------------------------
ATPD_HYDCU       ------------------------------------------------------------
ATPD_CHRSD       ------------------------------------------------------------
ATPD_METCA       ------------------------------------------------------------
ATPD_AROAE       ------------------------------------------------------------
ATPD_DECAR       ------------------------------------------------------------
ATPD_LARHH       ------------------------------------------------------------
ATPD_METFK       ------------------------------------------------------------
ATPD_THIDA       ------------------------------------------------------------
ATPD_BORPD       ------------------------------------------------------------
ATPD_POLAQ       ------------------------------------------------------------
ATPD_ACIFR       ------------------------------------------------------------
ATPD_LACJO       ------------------------------------------------------------
ATPD_LACDB       ------------------------------------------------------------
ATPD_LACPL       ------------------------------------------------------------
ATPD_PEDPA       ------------------------------------------------------------
ATPD_LACF3       ------------------------------------------------------------
ATPD_LACS1       ------------------------------------------------------------
ATPD_ENTHA       ------------------------------------------------------------
ATPD_LACSS       ------------------------------------------------------------
ATPD_LACCB       ------------------------------------------------------------
ATPD_LEUMM       ------------------------------------------------------------
ATPD_BACP3       ------------------------------------------------------------
ATPD_BACP2       ------------------------------------------------------------
ATPD_LYSSC       ------------------------------------------------------------
ATPD_OCEIH       ------------------------------------------------------------
ATPD_BACCN       ------------------------------------------------------------
ATPD_BACPE       ------------------------------------------------------------
ATPD_BACSK       ------------------------------------------------------------
ATPD_LISMO       ------------------------------------------------------------
ATPD_EXIS2       ------------------------------------------------------------
ATPD_STAEQ       ------------------------------------------------------------
ATPD_STACT       ------------------------------------------------------------
ATPD_MACCJ       ------------------------------------------------------------
ATPD_CARHZ       ------------------------------------------------------------
ATPD_NATTJ       ------------------------------------------------------------
ATPD_PELTS       ------------------------------------------------------------
ATPD_HELMI       ------------------------------------------------------------
ATPD_DESAP       ------------------------------------------------------------
ATPD_DESHY       ------------------------------------------------------------
ATPD_SYMTH       ------------------------------------------------------------
ATPD_SYNWW       ------------------------------------------------------------
ATPD_BREBN       ------------------------------------------------------------
ATPD_HALOH       ------------------------------------------------------------
ATPD_SALRD       ------------------------------------------------------------
ATPD_GEMAT       ------------------------------------------------------------
ATPD_CHLT3       ------------------------------------------------------------
ATPD_CHLCH       ------------------------------------------------------------
ATPD_MOOTA       ------------------------------------------------------------
ATPD_SORC5       ------------------------------------------------------------
ATPD_GEOSL       ------------------------------------------------------------
ATPD_PELPD       ------------------------------------------------------------
ATPD_DESDA       ------------------------------------------------------------
ATPD_LAWIP       ------------------------------------------------------------
ATPD_DESAL       ------------------------------------------------------------
ATPD_DESPS       ------------------------------------------------------------
ATPD_SYNFM       ------------------------------------------------------------
ATPD_SYNAS       ------------------------------------------------------------
ATPD_MYXXD       ------------------------------------------------------------
ATPD_BDEBA       ------------------------------------------------------------
ATPD1_PELCD      ------------------------------------------------------------
ATPD_SOLUE       ------------------------------------------------------------
ATPD_ACIC5       ------------------------------------------------------------
ATPD_KORVE       ------------------------------------------------------------
ATPD_PHEZH       ------------------------------------------------------------
ATPD_MARMM       ------------------------------------------------------------
ATPD_HYPNA       ------------------------------------------------------------
ATPD_GRABC       ------------------------------------------------------------
ATPD_GLUOX       ------------------------------------------------------------
ATPD_RHOCS       ------------------------------------------------------------
ATPD_METSB       ------------------------------------------------------------
ATPD_PARDP       ------------------------------------------------------------
ATPD_ZYMMO       ------------------------------------------------------------
ATPD_BARBK       ------------------------------------------------------------
ATPD_RENSM       -----MAGISSDSRAKVLAELESVLPTAT-----------AQLARELFSVLAVVDSSAGL
ATPD_KOCRD       -----MAEASNEPYRPLTVDVDRWAAAAT-----------PEIAHQLFEIVDIVDANGAL
ATPD_NOCSJ       -----MVQQLSSLRGSSAEALQVLGEQVDGD--RYTLEEFAALADDLFRAAALLRSEPAL
ATPD_LEIXX       -----MGSATREARARSVSALAGLGSKAD-----------LATAEDLFAAGRVVADSVQL
ATPD_CORU7       -----MHAASREAFERLIKTLDQGLKESDNA-----VGNGATTGTELFDVVDVLDQERSL
ATPD_NOCFA       -----MYAASREASSRSREALRAALTGSD--------SVAATTGSELFAVVAVLDDQRSL
ATPD_THEFY       -----MQGVSRTSLTEVIRRLDDILPSA-----NTAT-----LGHELFEVVALLDQEHSL
ATPD_ACIC1       -----MQGASRESLAAAWREAEELLVRP-----RPGAQPPEEVGTQLFSVTAILDEHPAL
ATPD_FRASN       -----MEGASRQSLAAARSVLDQVTAVPIGATAGTVAPEVRRIAGDLSAVATLVGGEPTV
ATPD_SACEN       -MSTLVNAASRDALAATELQLLQATDGA-------AAAEITGLADELFGVAELLRREATL
ATPD_KINRD       MSGELDAGVAKASLAAAQQVLDVQL-SAEGA-------DAGKTGEDLFAVTSLLDSSVGL
ATPD_SALTO       ----MQAATSRESYKIAADRLDEYVRGAESS-------AVATTAEDLLSVADLLRREPRL
ATPD_CUTAK       ----------MTTAVGASQQLDEVGDRRG---------TGTEFANEIFAVVDVLNRESGL
ATPD_CHLAD       ------------------------------------------------------------
ATPD_ROSS1       ------------------------------------------------------------
ATPD_LACP7       ------------------------------------------------------------
ATPD_STRS2       ------------------------------------------------------------
ATPD_MYCA5       ------------------------------------------------------------
ATPD_AZOPC       ------------------------------------------------------------
ATPD_THERP       ------------------------------------------------------------
ATPD_DEHM1       ------------------------------------------------------------
ATPD_RHOBA       ------------------------------------------------------------
ATPD_PROMO       ------------------------------------------------------------
ATPD_CALS4       ------------------------------------------------------------
ATPD_DICNV       ------------------------------------------------------------
ATPD_VESOH       ------------------------------------------------------------
ATPD_MYCAP       ------------------------------------------------------------
ATPD_LACLA       ------------------------------------------------------------
ATPD_WIGBR       ------------------------------------------------------------
ATPD_MAGMM       ------------------------------------------------------------
ATPD_RUBXD       ------------------------------------------------------------
ATPD_PARUW       ------------------------------------------------------------
ATPD_MYCPE       ------------------------------------------------------------
ATPD_MYCS5       ------------------------------------------------------------
ATPD_MYCPU       ------------------------------------------------------------
ATPD_RICBR       ------------------------------------------------------------
ATPD_PELUB       ------------------------------------------------------------
ATPD_THEYD       ------------------------------------------------------------
ATPD_BIFA0       ------------MQGEASRLADRESRDSFAAKLRESGNDAWEIGNELFTITYVFDHNPRI
ATPD_CALS8       ------------------------------------------------------------
ATPD_UREU1       ------------------------------------------------------------
ATPD_ORITI       ------------------------------------------------------------
ATPD_OENOB       ------------------------------------------------------------
ATPD_ELUMP       ------------------------------------------------------------
ATPD_HETA2       ------------------------------------------------------------
ATPD2_BRAHW      ------------------------------------------------------------
ATPD1_BRAHW      ------------------------------------------------------------
ATPD_CYAM1       ------------------------------------------------------------
ATPD_PETMO       ------------------------------------------------------------
ATPD_ACHLI       ------------------------------------------------------------
ATPD_TROWT       -----------------------------MPGSSSRSSLAHLRNRLSECSDLQSLYEVAV
ATPD_NEOSM       ------------------------------------------------------------
                                                                             

ATPD_AMOA5       --------------------------------------------MYTSNIQVASRYAKSL
ATPD_CYTH3       ----------------------------------------------MKETRVAYRYAKSL
ATPD_PARD8       ----------------------------------------------MDIGTISSRYAKAL
ATPD_BACV8       ----------------------------------------------MYIGVISMRYAKAL
ATPD_FLAPJ       ----------------------------------------------MSSTRAAIRYAKAI
ATPD_GRAFK       ----------------------------------------------MRGTRAAQRYAKAI
ATPD_ALKOO       -----------------------------------------------MAELVSKRYASAL
ATPD_CLOPD       -----------------------------------------------MAKLVATRYASAI
ATPD_CLOK1       -----------------------------------------------MYEYLDRRYALAL
ATPD_HUNT2       ------------------------------------------------MQLVNTRYAEAL
ATPD_RUMCH       ------------------------------------------------MPLVEKRYAQAL
ATPD_MYCGA       ------------------------------------------------MDTNIMGFARAL
ATPD_MYCPN       -------------------------------------------------MINAQAFGMAL
ATPD_MYCMS       ---------------------------------------------MILKETTINNYATAL
ATPD_MESFL       ---------------------------------------------MVLKDNVIDNWANAL
ATPD_MYCH7       ---------------------------------------------MYLYKKNYYGYAESL
ATPD_MYCMO       -----------------------------------------------MISQNNKGYALAL
ATPD_THEM4       ----------------------------------------------MRYSTISSKYVNAL
ATPD_PSELT       ----------------------------------------------MRYSQIAAKYARAL
ATPD_THENN       ----------------------------------------------MKLSAVAGRYARAF
ATPD_FERNB       ----------------------------------------------MMYSAIASKYALAL
ATPD_CAMFF       -----------------------------------------------MKEVVAKKYVKAL
ATPD_CAMHC       -----------------------------------------------MSENIAKRYVKAL
ATPD_ARCB4       -----------------------------------------------MKDLVAKRYVKAL
ATPD_CAMLR       -----------------------------------------------MEKVIAKTYAKAI
ATPD_NITSB       -----------------------------------------------MEELIAKRYAKAL
ATPD_SULDN       -----------------------------------------------MEELIAKRYLKAI
ATPD_SULNB       -----------------------------------------------MEELIAKRYATAL
ATPD_HELHP       -----------------------------------------------MFNIISKKYTQAL
ATPD_WOLSU       -----------------------------------------------MRELVAKRYAKAL
ATPD_PERMH       --------------------------------------------MKIDKKSLKRIVKVLL
ATPD_SULSY       --------------------------------------------MKIDKKYFRKVVNEII
ATPD_AQUAE       --------------------------------------------MLKRKELARKAVRLIV
ATPD_HYDS0       --------------------------------------------MKVNKELARKLSKKIV
ATPD_GALSU       ---------------------------------------------MHNNYKIAKVYAEGL
ATPD_CYACA       ------------------------------------------MILLLTNSKIIYPYSEAL
ATPD_PYRYE       ------------------------------------------MSSNNVVIKIAQPYAVAL
ATPD_GRATL       ------------------------------------------MSSQGFMSKIALPYAEAL
ATPD_CYAPA       ------------------------------------------MKQSAVVSKITQPYAEAL
ATPD_RHDSA       ------------------------------------------MSSKN--VKVAKPYADAF
ATPD_PHATC       ------------------------------------------MSVNPLTLKIASPYARAL
ATPD_VAULI       ------------------------------------------MTNKLLSIKIADPYAEAF
ATPD_SYNJA       ------------------------------------------MISSTMAARVVDPYAEAL
ATPD_TRIEI       --------------------------------------------MSVIAGEIVEPYAAAL
ATPD_GLOVI       ------------------------------------------MQQGKDSEQIAQRYAEAL
ATPD_PROMP       ---------------------------------------------MPLLNSVTTPYAEAL
ATPD_STRA1       --------------------------------------------MNKKTQALIEQYSKSL
ATPD_STRMU       --------------------------------------------MDKKTQAVTEIYAKSL
ATPD_STRU0       --------------------------------------------MTKKELALIEQYAKSL
ATPD_STRR6       --------------------------------------------MDKKTVKVIEKYSMPF
ATPD_LEPBP       ----------------------------------------------MSLNQISKVYATAL
ATPD_LEPIC       ----------------------------------------------MNDSGVSKTYASAL
ATPD_EHRRW       -------------------------------------------MTQYRGGYVTSCYAQAL
ATPD_WOLTR       -------------------------------------------MKRTQYNNLVSSYARAL
ATPD_ANAMM       --------------------------------------MFLDVVRKHGNGRVAYCYARAL
ATPD_ANAPZ       -----------------------------------------------MKGRAEYVYARVL
ATPD_ECOLI       ---------------------------------------------MSEFITVARPYAKAA
ATPD_PSYIN       ---------------------------------------------MSELTTVARPYARAA
ATPD_BLOPB       ---------------------------------------------MSSMLVVARTYAQAI
ATPD_BUCAP       ---------------------------------------------MSVLDTIARPYAKAI
ATPD_BUCBP       ---------------------------------------------MSSTKDELQLYAKAI
ATPD2_PHOPR      ---------------------------------------------MSDLKTIAQPYAKAA
ATPD2_VIBTL      ---------------------------------------------MSDYTNIAHPYAKAS
ATPD2_VIBCB      ---------------------------------------------MSELTVVAQPYAKAA
ATPD_NEIM0       ---------------------------------------------MAEFATIARPYAKAL
ATPD_PSYWF       ---------------------------------------------MAELSTLARPYAKAA
ATPD_FRAP2       ---------------------------------------------MTNLSVIAKPYAKAA
ATPD_XYLFT       ---------------------------------------------MIQALTLARPYARAA
ATPD_COXBN       ---------------------------------------------MALHLTLARPYAKAA
ATPD_THISH       ---------------------------------------------MSELTTLARPYAKAV
ATPD_LEGPH       ---------------------------------------------MSDSTTIARPYAKAI
ATPD_NITOC       ---------------------------------------------MAEKITIARPYANAV
ATPD_PSEU5       ---------------------------------------------MINTQTLARPYAKAA
ATPD_MARMS       ---------------------------------------------MAELKTVARPYAKAV
ATPD_ACIAD       ---------------------------------------------MAELLTLARPYAKAA
ATPD_HYDCU       ---------------------------------------------MAELITIARPYAEAA
ATPD_CHRSD       ---------------------------------------------MAETSTVARPYAKAA
ATPD_METCA       ---------------------------------------------MSELTTLARPYAVAV
ATPD_AROAE       ---------------------------------------------MAENVTIARPYADAA
ATPD_DECAR       ---------------------------------------------MAESVTIARPYAEAL
ATPD_LARHH       ---------------------------------------------MAELITVARPYAEAV
ATPD_METFK       ---------------------------------------------MAEAITIARPYAVAV
ATPD_THIDA       ---------------------------------------------MSELSTLARPYAEAV
ATPD_BORPD       ---------------------------------------------MAELSTVARPYAEAL
ATPD_POLAQ       ---------------------------------------------MAELATIARPYAEAL
ATPD_ACIFR       ---------------------------------------------MADLITVARPYAEAL
ATPD_LACJO       --------------------------------------------MALSREEIASRYSKAL
ATPD_LACDB       --------------------------------------------MALSREETARRYGTAI
ATPD_LACPL       --------------------------------------------MSLDNLTIASRYSKAL
ATPD_PEDPA       --------------------------------------------MSLDKTTIAKRYSKAL
ATPD_LACF3       -------------------------------------------MSRLDQKTVANRYARAI
ATPD_LACS1       --------------------------------------------MKLDNETIVHRYGKAL
ATPD_ENTHA       --------------------------------------------MKLDKYTVGRRYGKAL
ATPD_LACSS       --------------------------------------------MKLDKYAVGQRYAKAL
ATPD_LACCB       --------------------------------------------MAVTNQMVAPRYAKAL
ATPD_LEUMM       --------------------------------------------MAKNIKDIANQYAKAI
ATPD_BACP3       ----------------------------------------------MNQEVIAKRYASAL
ATPD_BACP2       ----------------------------------------------MSVTIVSKRYASAL
ATPD_LYSSC       ----------------------------------------------MSNSAVAKRYAQAL
ATPD_OCEIH       ----------------------------------------------MSNSVVAKRYADAL
ATPD_BACCN       ----------------------------------------------MSNEIVAKRYAVAL
ATPD_BACPE       ----------------------------------------------MSNQAVANRYAYAL
ATPD_BACSK       ----------------------------------------------MSNKAVANRYAVAL
ATPD_LISMO       ---------------------------------------------MSKDLEVAGRYANAL
ATPD_EXIS2       -----------------------------------------------MRDHVAGRYAKAL
ATPD_STAEQ       ------------------------------------------------MAKVAKKYAKAL
ATPD_STACT       ------------------------------------------------MAIIAKKYAQAL
ATPD_MACCJ       ------------------------------------------------MAIVQDKYAQSL
ATPD_CARHZ       ----------------------------------------------MKSLAVAKRYASAL
ATPD_NATTJ       -------------------------------------------------MIIPKRYAEAL
ATPD_PELTS       ----------------------------------------------MLRGAVAVRYAEAL
ATPD_HELMI       ----------------------------------------------MLTGAVARRYAQAL
ATPD_DESAP       ----------------------------------------------MIKGAVAARYAQAL
ATPD_DESHY       ----------------------------------------------MLKGAIAQRYAQAL
ATPD_SYMTH       ----------------------------------------------MMNHAVARRYARAL
ATPD_SYNWW       ----------------------------------------------MLNKSVARRYAEAF
ATPD_BREBN       -----------------------------------------------MSSAVGKRYARAL
ATPD_HALOH       ----------------------------------------------MINNEVSRKYSSAL
ATPD_SALRD       ----------------------------------------------MSQRTVTRRYAAAL
ATPD_GEMAT       ------------------------------------------MAAGVQGESVARNYAEAL
ATPD_CHLT3       ---------------------------------------------MHSISIVGRRYALAL
ATPD_CHLCH       ----------------------------------------------MSVVIASRRYANAL
ATPD_MOOTA       ----------------------------------------------MSEQNVARRYARAL
ATPD_SORC5       ----------------------------------------------MSYESVARRYGRAI
ATPD_GEOSL       ----------------------------------------------MISNAIARRYAKAL
ATPD_PELPD       ----------------------------------------------MINSTIAKRYALSL
ATPD_DESDA       ----------------------------------------------MIDTVVARRYANAI
ATPD_LAWIP       ----------------------------------------------MIGDIIAQRYAQAL
ATPD_DESAL       ----------------------------------------------MKNLKVARRYAKAL
ATPD_DESPS       ----------------------------------------------MKQTILARRYAKAV
ATPD_SYNFM       ----------------------------------------------MKNLIIAKRYSKAL
ATPD_SYNAS       ----------------------------------------------MINSGIAKRYARAF
ATPD_MYXXD       ----------------------------------------------MVNVSIARRYARAL
ATPD_BDEBA       ----------------------------------------------MRVSEISKRYAKAL
ATPD1_PELCD      ----------------------------------------------MKSTAISRRYAKAL
ATPD_SOLUE       ----------------------------------------------MTLSAVATRYANAL
ATPD_ACIC5       ------------------------------------------------MAAFAARYARAF
ATPD_KORVE       ------------------------------------------------MASVTIRYANAL
ATPD_PHEZH       ------------------------------------------MADDSKSSNVGSRYAQAL
ATPD_MARMM       -----------------------------------------------MTAEAAGRYATAL
ATPD_HYPNA       ---------------------------------------------MIQTSETAQRYARAL
ATPD_GRABC       ------MGPVPEEHQRESETVASNGANESGAAVTGIPQREAKHVSGTAVSGLAKRYASAL
ATPD_GLUOX       -----MPGPDSFDARSRISRFRPHSAADLVRRNTRVTVTQVPQVGHTG--GLAQRYARAL
ATPD_RHOCS       -----------------------------------------MATEGTGVSGLAARYATAL
ATPD_METSB       -----------------------------------------MAKQETLVSGMAGRYAQAL
ATPD_PARDP       ---------------------------------------MTVANSASISADIAGRYAQAL
ATPD_ZYMMO       -----------------------------------------MEISGSIQASLGGRYALAL
ATPD_BARBK       ---------------------------------------MSDSFSLLPLPLVSQRYAHAL
ATPD_RENSM       RRALTDPSREGKDKAALLSSLVRGKVSAQAEQIVDSLAKERWASARDLGDALETVAATVA
ATPD_KOCRD       RRALTDPSRSGEDRARLVHTLLDGRANEVAVDIVAELASQRSATERQLGDGIERTAVLVA
ATPD_NOCSJ       RRAVTDVSTPAEAKSSLVHGLLDGKLGAPAVDLLAQAVGLRWVAARDLADAVEHLGVVAA
ATPD_LEIXX       RAVLSDPAADRSGKDVLVKRVF-GALSAPAVELLGVIAGERWSGQDDVLDAIEELGIRSI
ATPD_CORU7       RVAMVDAAATPEQRVELVKTLLSGKVTASTEEIVSAAVSQNWSNSQDFRTGLERLGRRAL
ATPD_NOCFA       RVALADVSVPGSARAELSERVFGGKVSVATQAVLTTAVAQNWSRTSDMVDTLVLLGQEAL
ATPD_THEFY       RRWLADPAGSPDSKSELVNSLLETKVSPATLLVVSDVVRAQWSRPRDLVDAVEQAAVLAT
ATPD_ACIC1       RRALSDPAVEPGRKVSLADRLFGERIGETARRLVATVVRARWSRVRDLSDALETLGVLAL
ATPD_FRASN       RRALTDPGAPPQSRTGLAARLLGGQISQGALAVVSAAVAGRWSRPADLRYALEELAVEAT
ATPD_SACEN       RRALADASTDPRTREDLARGLLADRLGGRALPVVVEAVRSRWSSAKDLISGLERLARTAL
ATPD_KINRD       RRALTDPSRSGAAKAEFVRRTLSGRITPAALETVVALASARWAAGRDLSDATERLAVVAV
ATPD_SALTO       RRALVDPARSGADRADLLAGILGGKVGGDALDLLTTLVSHRWSAPSELLDGAERLGVAAL
ATPD_CUTAK       RRAVSDTGSETKARQGLIDAVFTSKVSPDCKELLDATTTCKWRSPAALTRALERQGVRAV
ATPD_CHLAD       ----------------------------------MATTIDARALAAPLVEALLSTAAEQI
ATPD_ROSS1       -----------------------------------MSASEAQVIARALFDSLTGTALQAL
ATPD_LACP7       -----------------------------------------------MAKLVSKTYGEAL
ATPD_STRS2       --------------------------------------------MNARENAIVQKYALSF
ATPD_MYCA5       ---------------------------------------------MYNINDLIYNWSFAL
ATPD_AZOPC       ----------------------------------------------MEAGKISTRYARAI
ATPD_THERP       ----------------------------------------------MAVAGVAKRYAQAA
ATPD_DEHM1       --------------------------------------------MAKRVYAIAMRYAQAL
ATPD_RHOBA       ---------------MVKLPSLKFLRRSTDETPNVSETASHSTVLDVGAEKLGKTYARAL
ATPD_PROMO       ----------------------------------------------MIEAQVGRRYAEAI
ATPD_CALS4       -----------------------------------------------MEQIIAKRYASAL
ATPD_DICNV       ---------------------------------------------MSQTETIARPYAKAV
ATPD_VESOH       ----------------------------------------------MKLAVIAKPYANAI
ATPD_MYCAP       ----------------------------------------------MFIKANADGYALAL
ATPD_LACLA       -----------------------------------------------MTKVNSQKYSKAL
ATPD_WIGBR       ------------------------------------------MTIYEIKSYLSRPYAEAA
ATPD_MAGMM       -----------------------------------------MRTFAVHESTIAKRYATAL
ATPD_RUBXD       -------------------------------------------------MSAVSTYAEAL
ATPD_PARUW       ----------------------------------------------MIAKGVSLRYSKAL
ATPD_MYCPE       ----------------------------------------------MEEKNHIDHYANAL
ATPD_MYCS5       ----------------------------------------------MYVKVNPSSYSVAI
ATPD_MYCPU       ----------------------------------------------MIDNHYVQSSAKAL
ATPD_RICBR       ----------------------------------------------MNKDILTQNYAVAL
ATPD_PELUB       -----------------------------------------MSKNKGFSETSAGRYSLAL
ATPD_THEYD       --------------------------------------------MRKVRGAKAKKYAKQF
ATPD_BIFA0       PRALTDPGRPTEDKVALLNNLLGKQALPLTMEILTDLVGRSWSRAGDIDNAIEDFAVDAM
ATPD_CALS8       -------------------------------------------------MLPAKRYAEGL
ATPD_UREU1       ---------------------------------------------MKSSLKPVEKYAYSI
ATPD_ORITI       ---------------------------------------------MHKLNNVAVLYAKIL
ATPD_OENOB       --------------------------------------------MAFNENRVINNYAEAL
ATPD_ELUMP       --------------------------------------------MKSTDRILAHKYSIAL
ATPD_HETA2       ---------------------------------------------MSTNSRAGDAYAYAL
ATPD2_BRAHW      ---------------MDPIAENILSDLKKEVLREVTREKASRFSRIVKNESSAKNYAKAM
ATPD1_BRAHW      -------------------------------------------MKESDKLQILKPTASAI
ATPD_CYAM1       -----------------------------------------------MKQKIVEPYAQAL
ATPD_PETMO       ---------------------------------------------MKASYFLASKYAQAL
ATPD_ACHLI       --------------------------------------------------MTSTIYSDAL
ATPD_TROWT       LLAISRRLRSSLVSRSLSCVSKQKLIAELTGKDPDAFICMAVSLRWSEPIDLLYAFEEMF
ATPD_NEOSM       -----------------------------------------------MQQYIAGRYAQSL
                                                                             

ATPD_AMOA5       LKQAIDMG-------VLDHVYKDALFFKKVGKSHKT--LFRVLHNPIIKNETK-LAILTS
ATPD_CYTH3       IDLAAENG-------VLDRVNADMAGIESVFKQNHQ--LVAVMKNPIVQGDKK-HAILEA
ATPD_PARD8       FSLAKDKE-------QESRVYDDMKMLADSFSMEPE--LRGALSNPIVSVPEK-VKLL-T
ATPD_BACV8       LAYADEKG-------TEDTVYEEAGILADSFSRIPE--LRQALDNPVLPAETK-LKLICE
ATPD_FLAPJ       IEIATSKN-------AANEVSNDMFLIATTINSNSE--LDTFIQNPTIKVEAK-ENALLE
ATPD_GRAFK       LSLAKDKN-------SAEAVNEDMISISKTVVNSRD--LENMLTSPVIKDSTK-KSALLE
ATPD_ALKOO       FELAFEEQ-------KHHKVQEELAFIRSCIEDEPS--FFELLKSPLITADEK-KDIISN
ATPD_CLOPD       FEVGVELN-------KEEMFYEELKIISSNFEENEK--FFKMLKTPILSKQEK-KELIEN
ATPD_CLOK1       YKIAEEKG-------KVEEYLEELKDVTDIINNDTQ--FLEFIEHPEISTAEK-KKTFIN
ATPD_HUNT2       IDVTEEKN-------STDKVLNNLVQVLKLLEENRE--FYSFLLDPQIQKESR-KEAIIK
ATPD_RUMCH       LELSG--S-------DINSIKEEFGDFTNLYNSDKD--FRDFLNNPVVKTDKK-QALIRS
ATPD_MYCGA       VDLAHEED-------KVHLFYDNLKVVFDLVKENQD--LMSLMNSQVLSKNQK-HEIIDV
ATPD_MYCPN       FQLSEEEK-------KVKKVYDQSHDFLKLARNFKDGSLAALLNAYTLTKKEK-LKLIDK
ATPD_MYCMS       FNIAVKEK-------LVDDYIIQVDALIKSLADKDE--FNKLVTYSNKEQKKQAILIIEN
ATPD_MESFL       TKIAVKEN-------KVKKMLEQAHVLIEVLKNKNE--FVDILTFKSAHDEEKRIKIIDD
ATPD_MYCH7       LDISISEN-------NVEKYINDCFFILSIIQNNQV--LILLFKSHFVGKQEK-FNIIDK
ATPD_MYCMO       FEIANEEL-------KLEQYFQEVKKLNEIINENED--LVKLLSSKEIQLEKK-LKILEN
ATPD_THEM4       LMVGKKVN-------KIEDYGELLKALCDVYV-QFK----DFFDNPAVKVWKKVETIKE-
ATPD_PSELT       LNVAVELE-------KTEEYGDILAVVVQLYQ-KAK----QFFDDPTIGAAEHVDRITKF
ATPD_THENN       LNIAIENE-------KEDEYLRFLDFVCNVYE-SNK----DLFDNPVVKPEKKVTLIKSV
ATPD_FERNB       YNISKTNG-------KTETYKELLNILGDIYN-LAS----VYLNNQAIKPENRVQFVLNI
ATPD_CAMFF       ILSLSSDE-------FDKLGNELKDISNAFLLPKLK----VIIDSPDISSKQKADFLFSL
ATPD_CAMHC       IEVCKKDE-------LNDVLKGLKAIVSAFSVAKFN----DIIKSPTVSKKDKISLILSF
ATPD_ARCB4       IDGRNSES-------INTISNKLNQVASAFADERFN----SIISSPEISDKSKVDLIISF
ATPD_CAMLR       LE---RND-------FENFYSNLLELSSAFASNKFI----DILNSYEIKQDKKLELILSL
ATPD_NITSB       MESCSEKE-------LQAIEDALVAIAALFRDWKVK----EFIISPEVEKSAKEEILLAP
ATPD_SULDN       KQGSNAES-------MREIALIFSILSEAFNDKKFI----QIINNPDVSRDQKSEILLAA
ATPD_SULNB       --SSVSKD-------VKSIASVLNVLSEAISVPEVH----EALTSPIVSAEKKTDMILSA
ATPD_HELHP       VDS-GSN--------LDETLSILKGLSLALKDKRNA----DIIASPFLSKTQKEQFLLES
ATPD_WOLSU       VEALGEDR-------LASTLEWLKGSESAFGTEAFQ----EMLASPQISKTLKGQVVLDV
ATPD_PERMH       NKVPKEEA-------ALIKVSDDLTLIQEIYRKDKD--FRNFILNPSAPYEDKKKIIDSL
ATPD_SULSY       AKTDKSEE-------NLLKISSILDILNKLFKENQT--FRNIVLNPKASMEDKEKLMEKV
ATPD_AQUAE       KKVPKEKE-------SILKVDEFLGTLSTAYRKDKL--LRNFFLSPQIDRNAKVKALESL
ATPD_HYDS0       FSVPKDKE-------SLSAVSDFLGLLGVLYKKEPK--FRDFVLSPFVSNEQKKLFIKSL
ATPD_GALSU       FEIANTKNS-------LAEINEQLNSIKSVLKQMPE--FYYFLVNPLISQQIKKNTIKIV
ATPD_CYACA       FSIAKDQEK-------FEVIKNDMELFVTFTKNLNG--FKKFLETPLINKNKKIKVVKDV
ATPD_PYRYE       LDLAKTKKV-------TEKVSQDIQSIQNILAQSDK--LKIFLANPLKTVEAKKEVIIAT
ATPD_GRATL       VESASSASA-------LDQINQDLSLISEILNQSQE--LKTFFYNPLITTEIKKNVVSSL
ATPD_CYAPA       LEMAQKYDI-------VETVNNDITLILNCLQNSTK--LQQFLANPLVKKSSKKNFFEKT
ATPD_RHDSA       IEIANKGS-----------VINDLNCIATALSESKD--LQKAIANPLVSSAAKKDIIKSI
ATPD_PHATC       FDFSVEKNI-------MHQITADFQNLEIFLKENTE--LTEYLDNPVVSKNAKCEILAKT
ATPD_VAULI       FQLSLSLYIKNNDPDLFYQLIFDIQDFLKLLKETPE--LDNFLKNPLNSNILKKNILNKI
ATPD_SYNJA       VSLASAQ-------GLLDTFEADIRFIAAVVQATPE--LGQFLASPLVKAEAKKNLLQQV
ATPD_TRIEI       MSLAQSK-------DLTDKFAEDVRSLINILDESPE--FKQFVGNPVIKQEDKKAVVKRM
ATPD_GLOVI       KELALSET------GLLEQFGNDTDGMLQVMEESPD--FERFLVVPIIAMADKKRLLVEA
ATPD_PROMP       LQVVSEN-------DQTEEMVKEVKQLLSLINDSPD--LEKTLSSPVLETDTKKKIIIEI
ATPD_STRA1       VEVAIEHKI-------VEKIQQEVAALIDIFETSE---LEGVLSSLAVSHDEKQ-HFVKT
ATPD_STRMU       VEVALERDS-------VPIIYDEVRAILSVLDDQQ---VQDFLASKAIDLSAKS-EVVRL
ATPD_STRU0       VEVAIEKDF-------LNALKEDVYAILETMKASN---LDKILSSLAYAPDDKA-NLVRL
ATPD_STRR6       VQLVLEKGE-------EDRIFSDLTQIKQVVEKTG---LPSFLKQVAVDESDKE-KTIAF
ATPD_LEPBP       LELAQEANS-------LESTEEELSSLVGVFFSDDT--IRHYFLSPLVDPSEKEQTAAKS
ATPD_LEPIC       L---GATNV-------PEEVEQELGDLAQLLFKDEK--VKNFFLSPTVSNEEKEKVLIKN
ATPD_EHRRW       FNASVSKL---------NDICKGIKFIFNLSENGNN--QFLSFLANPTANLKDKISVIEL
ATPD_WOLTR       FLVSENKL---------SVVRKEVEFLLAFFKSQHD--VFI-YLSHPMISFARKKEVIFS
ATPD_ANAMM       LDIVVDSA---------DSICEEIKLVRAALTADGE--VRA-FFANPVTPKENKIAVLQA
ATPD_ANAPZ       VDLVKDNS---------EEVSAGIRSLLCACE-DRD--VRA-FFVDPTVPFGVKVAALRD
ATPD_ECOLI       FDFAVEH-------QSVERWQDMLAFAAEVTKNEQM--AELLS-GALA-----PETLAES
ATPD_PSYIN       FEFAVDS-------NKIEAWSEMLFFTAEVVNNPTM--VKILT-SDKT-----AQELAEL
ATPD_BLOPB       FDIAVEQ-------KNINKWKSVLDLFSEISLNRLV--QSLFF-RCLE-----PKRLSDI
ATPD_BUCAP       FELAIEN-------QSIEKWKKTLIFINEIIRSKKI--EKFLS-GSLS-----PSYLSSF
ATPD_BUCBP       YNCAISNH------QSLDHWKTMLQLMANILNNEII--KNLIS-KAYF-----SQHVISL
ATPD2_PHOPR      FDFALAN-------KSLDQWAYMLMTTAEVASQPVI--LQEIK-EIDFKGAKNAEAFTQM
ATPD2_VIBTL      FDFALGE-------NKLQEWHSMLSILVTVAEEETI--AKQIS-SAEGVHTQQSEELVNL
ATPD2_VIBCB      FDYARDV-------ECLDDWQQMFAITQVVLEQPNT--LLVLN-DLDEDGSEQP--LLDL
ATPD_NEIM0       FGLAQEK-------SQIESWLGGLEKLAAVVQEGKV--ASLID-RPETNASEKADILIDL
ATPD_PSYWF       FDYAHEN-------SVIGEWEDFLFIASSVVGDSAF--VQMLE-NPAITAEQKADMLVSI
ATPD_FRAP2       FEFANEY-------NLLQEWSKQLKSFAELVQDDAI--AAIIS-SPEISQTEIINTVKDQ
ATPD_XYLFT       FAIACEK-------GKCMQWSQALTFSAQVANNPIV--ATLLS-HPQLDHEQAAALL---
ATPD_COXBN       FADGQKA-------NQLEAWLAVFTAFSKIIKNKEV--ARQII-NPKFSDKEIKTLLFDL
ATPD_THISH       FEVAQG-A------GDLARWSDQLGFMAAVVHDPTM--KAFLD-SPKLTREAAADTVIGV
ATPD_LEGPH       FEHALA-E------KKLSEWSEYLTLLAQVVLTPQA--TQFIA-NPASTDEQQIELLIEV
ATPD_NITOC       FELAQA-Q------KNYDQWSRVLNVFADLARDSEM--QILID-DPRYTSEQLIGLFVEI
ATPD_PSEU5       FEFASA-A------GQTDSWSKMLNLAAVAVEVPEV--AALLN-DPRLTSESKVQALVRV
ATPD_MARMS       FEVARE-Q------GHIVEWADMLNVLASVTVEPKL--KKALG-NPAFSAEEKANALADV
ATPD_ACIAD       FAYASE-Q------GATDNWSTALQVLSAAVQDEAF--SAYLN-RPELTPSEQVELFAKI
ATPD_HYDCU       FEVAKE-E------GKLVEWSEQLANLSAIVSDETM--TAYMV-NPSVTSEDVLKLLVDV
ATPD_CHRSD       FEYARD-H------KALEAWSGQLASAKQVAADADF--DAKVVSNPKLSHDQKTALLLEV
ATPD_METCA       FKAAKE-A------GNIQEWADMLEFLKQVMADPLM--QRAAS-DPKAGKDRFIAKFLDL
ATPD_AROAE       FELARG-A------GALGPWSEALDRLAAAAADASM--KACIS-NPKLSADQLYQLFIDV
ATPD_DECAR       FRTAKE-S------GNLAKWSEQVSLLGQVAANPDV--SSAIG-DPNVAAPQLVDLFRSA
ATPD_LARHH       FRLAKD-E------GRLAQWSEALAWLAASLAEPAV--SAAVA-NPERTEAEVVTLLGGI
ATPD_METFK       YRLAKE-K------NALADWSQMLALAAAIAADEQM--RAFID-NPKVDAADLERVFLSV
ATPD_THIDA       FRMAQD-E------NDLAGWSSRVTTLATIVSDTQV--ARLIA-DPAVPADRVAELIVSV
ATPD_BORPD       FSAARDDK------AGLPAWADLIGELAQVAGNPDV--REAMT-DPRLGDAQRIELFTGL
ATPD_POLAQ       FQSAK--P------AELAGCLEQLNELAQLAALPEV--AALSN-NPKVSADDLSKLLSGM
ATPD_ACIFR       MGWRKR-A------ARNRPGRMHCRRLPAMIADVQA--QAFLT-DPERRDAEKVSLLSAV
ATPD_LACJO       FAYAQDAN-------SLDAVHEDMNVLLQVAKEN--PDMLRLLSDPIIRKNQKEEFLSSF
ATPD_LACDB       FDFAKDSG-------KTELMYSELTELKKAVQAE--PRFVQVLSNPVLDAKQKKSLLTAV
ATPD_LACPL       FELAVEKD-------QTEAFLAELKQLRQVFVDN--PQLAEVLSGSLLPVDQKQTTLSTL
ATPD_PEDPA       FEIVSEKG-------QRDETRAELNQIQQVFNDN--EGLGKILTDKGLEQNQKLEILNIL
ATPD_LACF3       FELAQEDG-------QLDQTYQELVSVRQVFLDN--PSLAPLLAGVDLGIKEKQALVDQV
ATPD_LACS1       FELAEEMK-------IRNKFHSELQEYKKVLQNE--PQLKVFMSSNQISPEAKLKIMEIL
ATPD_ENTHA       FELAIDSN-------SAEEIYQELLSLRQIYSEI--PGLGNVLSDVRLEPHEKRIIMDKL
ATPD_LACSS       FSLAEQEQ-------QFESIHDEIQALETIFNDN--PKLGTVLTDTTLSGLKQRNLLESL
ATPD_LACCB       LEAAKDQN-------QVETVHEELQALQSVFNDN--PTILTIFDNARITAADKDALMTTL
ATPD_LEUMM       FELAGEQD-------NVDEVLTDLRTIKTVLDEN--QNFITIASSADVAIASRDDLLKTL
ATPD_BACP3       FQIALEQG-------QLDRIEEDVRAVRQALAEN--GEFLSLLSYPKLSLDQKKALIREA
ATPD_BACP2       FDIVLASS-------AVDETEKELNEIKKVLKAD--QELNDFLVHPKITADKKKHLIAEA
ATPD_LYSSC       FELAQQKN-------ILAEVGADLNELTKIVQES--PDFLTLLNAPKFSIERKKQMVAEI
ATPD_OCEIH       FQLGREKN-------SLDQLVADFLEVRQIFTND--QKLNVFLKHPKIDNEKKKQFLADV
ATPD_BACCN       FQIAKEKH-------VLEMFEEELGLVQSVFMKN--EELHSFLTKPNISKEQKKMFLSNV
ATPD_BACPE       FQLAEEKS-------ILSQVVQEMELVKEVVNTT--PEFLQLLSHPKVTTEKKRAFIENS
ATPD_BACSK       FELAEEKG-------QTDVFERELELVQEVFETT--PQLETVLAQPGLAADKKQALLRDA
ATPD_LISMO       FQVAQDKD-------LVDVFSEELTELKAALKAN--KDFVKLLENPTFTTEQKKNLASAV
ATPD_EXIS2       FDLALEHH-------VLDQAEADVRTLGEVLHAT--PELASVLENPSISAEELKQVLQTS
ATPD_STAEQ       FDVALDTN-------QLDVVYEDLETISHSSFDFI-KQLKAIDSNPSLTANQREEFVERV
ATPD_STACT       YETSLDKD-------VLDLMYDEFAAVDEAVIPNQ-DKLKAFDSDPKNIAEDRNSLVESA
ATPD_MACCJ       FEVAQAQG-------VHESVRQDLVEIKEGLAGN--KAFFAFAEDPKVSSEKRHAFVEAT
ATPD_CARHZ       FELAREKGA-------IDSISHDFEVLEKAIQETPD--VKKVLDNPVLIPAAK----KEL
ATPD_NATTJ       FQLAKEREK-------INEITQSFNQLIERLRSNEE--VFKLLSYPVVDIAEK----KQV
ATPD_PELTS       YEIASREKVLPKYKSMVDRVEEELKAVDKVIRENSD--LQKLLYHPRITAEEK----KDL
ATPD_HELMI       LEIGIQTKTL-------DALEGELGRFVEMIG-HPE--LQRFLFHPSIVVAEK----KDL
ATPD_DESAP       FDVARDNNRI-------AETENELRGFMRLLDESRD--LQQVLYNPQVPVELK----KEI
ATPD_DESHY       FELAVQENLD--------GIEAELQELVQCVEQNAE--VAHVLYHPHISLSEK----KDL
ATPD_SYMTH       FELAQEKGLL-------DQVNRELELVVSMYETDSY--LRAFMNDQRISPSQK----RKV
ATPD_SYNWW       FSIARETGKV-------DELQQELEKLVSIIETTEN--LPEYFAHLLIPAKAK----KEV
ATPD_BREBN       FEVASERSKI-------DQVEADLGAIVEAVEGNED--LKKIMLHPHIAADAK----ATL
ATPD_HALOH       LEVALESDNL-------SRFKEELEGISKALKQYDD--LKKILYHPRVLPDDK----KEV
ATPD_SALRD       YEEANANGVL-------EAVDEDVRMLLESLDSNRP--LVRVFESPVIPQDKK----DSI
ATPD_GEMAT       LVLARKADDA-------EGWGALLRQVADAINNDVN--LSRFLESPRIAAEQK----SVV
ATPD_CHLT3       MEVAVDQNIV-------GQVMADFELIEQTMVEAKQ--LRLAIQSPLIQAYKK----AAL
ATPD_CHLCH       LSVVEESNTI-------DKTLDEMNAISEVLHHSRD--LVHALKSPLISYDKK----IHI
ATPD_MOOTA       FNIAREQG-------TAGEFANGLEEVSRTLAENSD--FRRVLYHQLIPVREK----QKL
ATPD_SORC5       FEIGKETG-------TLAALAREIGDASAMYSASEE--LRLVLDNPLIPEASR----EEL
ATPD_GEOSL       VQLGAEEG-------AVDRFGVELGQFTALLDGNAD--LASVLKSPAYRIEAKREILRDV
ATPD_PELPD       VQLGAECG-------LVDRFRGELADVEDLFGTTPE--IPAAFADPALSHERKKNIMREL
ATPD_DESDA       FALGKKDGDD-----ALSSRGECLAALGEALAAAPG--LDMTLKSPVIGVEEKKAVLDKL
ATPD_LAWIP       FDLGKEQSLH-----EVELYDTALSQIEELLMTSNE--LTYFLHAPIFTIYEKQGVLLKL
ATPD_DESAL       LLIGKEDG-------QAEVYREELEAFSSLFKANPD--LEAAISNPIYEAKGRQALLRSV
ATPD_DESPS       FSIGADSG-------KYGEYNDALQAVANLYMTNPD--VVDALTNPLYPLELREKVMVGI
ATPD_SYNFM       FNLAEEGR-------MIEQYGEELDNFVRLLGKLPE--LADALRNPLFPEATRKAIFAAV
ATPD_SYNAS       FDIAGEDK-------LYEKYYEELSGFARIVQGDRN--LKEFLANPVFNQAEKKAVVEAI
ATPD_MYXXD       LDVASEAG-------RTDAVAEQLTAFADVIAKNAE--LTDVLVNPAYTREQRLRVVESV
ATPD_BDEBA       LAVAKQKG-------IHTQVHAELQALVKSFAGDVS--VKNYFENPMIGSDQKIAAVKAS
ATPD1_PELCD      VNLAAPDG-------QLESTYAQLEQLQQAFACEPR--LYKLLASPTLAADKIAGLLEGI
ATPD_SOLUE       ADVVSPGSSPIR----PEAALEELRAFEAALKSSVE--LHNALTSPSVPVGRK----RAV
ATPD_ACIC5       ADVVAEAHLPL------EQVQQQLDDFMATWNGAAD--LREVFLDPSFPAEEK----VAI
ATPD_KORVE       ADVVLSNRLDV------TTAVRDLNNIVSMTIESED--LRKVWENPSIAVAQK----RAI
ATPD_PHEZH       FDLASEQKE-------VPAVEADLKSLKAAIADSRD--LRVLLASPAFGADDKRKGLSAI
ATPD_MARMM       FELAKSEGA-------AEAVEADLAALRAMLTESPE--LADALASPLHAVEVKAGILSAL
ATPD_HYPNA       FELAQDKGD-------LATIHKDFRAFAALIKTSAD--LRKLLDSPAFSRDVKVSALAEI
ATPD_GRABC       YSYAGDSGD-------LDGVIARIEALGRLIDESAD--LRSLLGSPLVDVNRARDAVLAV
ATPD_GLUOX       YDLASEQGN-------LSDVLGEVKALRAAIAESDD--LRKFLADARMDIRQGRTVSNVL
ATPD_RHOCS       FELADENKA-------LDQTAQDLALLKQLMAESAD--LRRVVRSPLLSRSDQARAMDAV
ATPD_METSB       FALAQERGA-------TEGVATDLATFAAMLDESED--LRNFVRSPVFSAEQQTKALDAL
ATPD_PARDP       FDLVRDSGG-------IDALSSQIDDLASAYDASQD--LRDLTLSPLYDRQQQEAAVGAL
ATPD_ZYMMO       FEVAQEKGQ-------IDTVAASLGKFDEAFAQARE--LRLLANNQIFSRKHVEKAIAAL
ATPD_BARBK       FDLVQKEGY-------VGDVEKALASFQVILEQDKA--LKHLVQSPFLSVKEQVKAVCAV
ATPD_RENSM       IAVAENEAPGAE---GLEKLENDLFVFNQTVAANHQ--VQRALSEPQASAEAKQKLASAL
ATPD_KOCRD       AAAAENRG-GGH---ALEALVDDLIRFKSMLDRSAD--VQRAFSDSRASAEAKVTLARRL
ATPD_NOCSJ       VRSAGRRE--------SVRLSDELFVVAQVVEENAE--LRIALSDPVRSTDDKRELLRGL
ATPD_LEIXX       AASAPR----------TVDIPAELLAFGGAVTSDAE--LELALRSKLADPSAKAALVERL
ATPD_CORU7       LRSAEAQG-------QLERVEEELFSLARILERESE--LELLLSDRAAAVDDRRDLLAKV
ATPD_NOCFA       LESAANAG-------RLDAVEDELFRLGRIIADNAD--LEQALSDRAKPAAAKRELIARL
ATPD_THEFY       VAEHASAR-------ELEGVEDELFRFGRIVAGQPE--LRAALTTDGASIEHKRTLVENL
ATPD_ACIC1       LVAAERSR-------AVDDVEDELFRFGRIVASRPE--LRDALANRTLPVENKVRLVERL
ATPD_FRASN       LAEAEAAD-------ALDEVEDELFRFGRILGQNPQ--LSLALTDPAAPTSAKVGLVTRL
ATPD_SACEN       LVQAERAG-------RLDAVEDELFRLGRIIGGQVD--LERLLSDPTTSAEGKATVVDQL
ATPD_KINRD       VTQAERSG-------HLDALEDELFRFARTVAGSPA--LRDALADRTAPDANRASLAARL
ATPD_SALTO       LAAADKAG-------DLGEVEDELFRFGQVVAGQST--LSNVLSDPAAPAAQRATLAGEL
ATPD_CUTAK       LRGARQAD-------RFEAVADELFHVSRLVRGQAA--LQVALGDPNRSVADRQELLMKL
ATPD_CHLAD       RAAAPRIA--------------------------------------GLPASDAAAVLPAD
ATPD_ROSS1       RAAASVNG--------------------------------------ELTPERVLAALPED
ATPD_LACP7       FDLALENQ-------SLDIIEEEIKAVKMVFNENTE--LIKFLNHPKITKEEKVAFVENI
ATPD_STRS2       VEKVSDHA----------DIWDMYDQISDLISIIHDSKLNRILLSATVSREEKADFVRTV
ATPD_MYCA5       FDLANDEG-------ILKELTADVVKVIKVLKRNKR--YLEILNSYNVDLDVKFQKIDEA
ATPD_AZOPC       YEYALEQG-------NETILYKGMQSLAKHFAMYPV--LKKSINDPTLSDENKIKLLIAA
ATPD_THERP       FAVAKEHG-------QLDFWEQRLTDLEALARDSAV---EEFIQNPAIPLEAKVQVIDRL
ATPD_DEHM1       YELAKEQK-------SLDKWQEDLQDLSSLTEDASV---AEFLSNPKIASARKHKVLAKL
ATPD_RHOBA       LAATQADG-------STDAVVSDLNAICDEALLHNP-KLQLAFQSPQIDADEKCRVVDRL
ATPD_PROMO       YEIAESND-------NVKELYETLNGVMELYNTDKE--FKTLVDHPLIKREDKKEFAKKI
ATPD_CALS4       FDVAKKED-------RVKEYYEELKKAVEILQTEAV---WKIFVNKSIDKTKKMKFVEEV
ATPD_DICNV       FEQAVETE-------SVANWIDFLEIASTFVSNEAV---KEHLASASFMENFLVWFEQFL
ATPD_VESOH       FELAQQDN-------SHLQWKMVLDVGAYLLLDKKM---RRLIASPNILEQDKLSTIKAL
ATPD_MYCAP       YDLHKEEK-------HVSSTYENILSFYELLSNDKE--VFSFFNSSKIGLEEKHKIADEL
ATPD_LACLA       LEVAQEKG-------QLEAILSEVSEMIQLFKEDN---LVAFLSSEVYSFSAKSELIDTL
ATPD_WIGBR       FKFANENN-------IVDDWIYMIEEICKILKNIKI-----YSLSSFILKKNKNFLFESI
ATPD_MAGMM       AELASELN-------ILDSIRDELAHFQALLAESPE--MHEMMVSPTVSKESQHKLISTY
ATPD_RUBXD       FGAAREKD-------ELERVLDDLREFCRALRESEE--LALFFYGEQIPEREKRRAIEAL
ATPD_PARUW       VDIATNPE-------QIKSHLLALEEFVGILETIPK--LKELLFDPHLSTLTKKSILQRL
ATPD_MYCPE       YSIWLELD-------KKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKI
ATPD_MYCS5       YEIAKESN-------KIKTFHEQFSFVKKVIEKNPQ--LITFLKNDEIALEKRFELIDEI
ATPD_MYCPU       SQIAFEEK-------KEKLFLNQLFIIKNIFSYNPE--VVEYLASGSIKLENKKKFIEEI
ATPD_RICBR       FDNAKSDN-------TQDKILEEVNLVTSIIEDNIE--VKELLSSPIVNKVDKIGVINSL
ATPD_PELUB       YELAVEAN-------NLNEIEVHSASIINLITSSED--FKSLIKDPTNNKEDQLNALSKI
ATPD_THEYD       LSLVNIDQ--------VPEIVSKLETVVMLMQKEKQ--FRNMLTSPSFKDEERVGVIGYL
ATPD_BIFA0       MYQADDEK-------KTLKVSVQLAQLQSALLNLPV--VRSDLSDSQGPLNVRYELLHAL
ATPD_CALS8       LKLAQEEG-------KLEKFYEDLFKIYDLFKTNKQ--FVDVLFDLEMKVSNKKEKIKQF
ATPD_UREU1       FEIAKEEK-------KLDLYKHNLETINSIIEEVPA--FFEAVGDPARDRNERKQIVIKN
ATPD_ORITI       FKQAIKLN-------IVSKVKQDLKALKQFCKFLAK---QNMSLQFIALMKNKINLMDYL
ATPD_OENOB       MEVSGKQT---------AKVLSELQVIELVFERNKE--LAQTLDDVSVSSQQQEAFIGIL
ATPD_ELUMP       SSLADKKD--------LPSLLAELKEIHLAIGNS------SFFYSPAVPKKEKKQALSSA
ATPD_HETA2       LKVLFNETKDF---DSFSDLVGDVLDFVTIFNTCPS--IEEFFANPTYSPIQKKQFLYDF
ATPD2_BRAHW      FDIASDIG-------KIEVIKSDLNVVYSSLLVDND--IFNFFKSSFIDGHLRMRILKKI
ATPD1_BRAHW      FDIARELG-------MIKEIYNELSECSKLFQDIDI---KKYFFDKSISKKDKKELIDKR
ATPD_CYAM1       FRLKDDID---------------LTPLWEMARDSK---FMQLLMNPSIPKEKKWQLFQPF
ATPD_PETMO       LGTLEEKGE----ISRLDEYVEAFQRLKKALESSES--LRDMVYSPLIPPKHIVSRMKDV
ATPD_ACHLI       FKLALKED-------AIESIIEQFETFVSLARDYPD--WIVLLDSPMIRNRVKNKMLTEL
ATPD_TROWT       IRASCTRRFA-----DCRDFLDELFWVSSIVDSHKI--LDKTLSARFLPAYSKKQLISGV
ATPD_NEOSM       YAVCGPRL------------ESDANKFLGLLSEN------NFLSFAKVKTSTKLHVLDRL
                                                                             

ATPD_AMOA5       IFQS------------------------------RIHPLTFHLLKLLSHRKREGILPTII
ATPD_CYTH3       LFGG------------------------------KVDNFTMSLLSLLTKKHREAVVFEIS
ATPD_PARD8       AAGGI-----------------------------EVCELYSRFINLVLAHKRETLLPFIA
ATPD_BACV8       AAGGG-----------------------------KVSEELKRFVELVLEERREKFLQFMI
ATPD_FLAPJ       VFA-------------------------------NTNEVTKSLFHLLFENKRFEILGAIA
ATPD_GRAFK       IFK-------------------------------DLNTITKGAIDILLENGRIGILHLVA
ATPD_ALKOO       IFRD------------------------------RVCMEVLNFLYIIIDKGREAYIKDIV
ATPD_CLOPD       IYKD------------------------------KASLEIVNFLKVLIDKDRISIIREIV
ATPD_CLOK1       VFKG------------------------------KISEDILSFLLILIDKGRINQLYSKL
ATPD_HUNT2       VFEG------------------------------RIEQEVVNFLMLLVDKERFENIRGIV
ATPD_RUMCH       VFTD------------------------------RLSKNMLNMILLLVSKHRTAEIPGIF
ATPD_MYCGA       VFKD------------------------------HLTQTIVDFLKVVIDNREFFHIKSII
ATPD_MYCPN       LFKN------------------------------HFCDLFVDFLKTIVLKGYFNLVEQAL
ATPD_MYCMS       TFSSF-----------------------------GFDIYLINALKILVENQLFINTRMIL
ATPD_MESFL       TFSQF-----------------------------NIDEDIMNAFKILVHMQAFVNARDIL
ATPD_MYCH7       IFSA------------------------------KIEKILVNFLKVIAKNNLFLHYKQIL
ATPD_MYCMO       IFTN------------------------------HFTVNINNFLKLIITNNLFIYIKSIL
ATPD_THEM4       --SFGT----------------------------SIDKVFVNFVSLVFENKRQKFIPQIA
ATPD_PSELT       INQIGA----------------------------HFDKPFWNFLKIVFEKRRQSVLPAIL
ATPD_THENN       LEEFGE----------------------------EMDEFQERFLMLLFERKRQKLLRNIH
ATPD_FERNB       MKELKI----------------------------EYDEIFRKFINLLIVNKRLKYINQII
ATPD_CAMFF       LDNAS--------------------------------NKIHNFLLLLAERKRLGLIPEIS
ATPD_CAMHC       LKEPN--------------------------------VKIENLLKILMKNGRISLLPQIY
ATPD_ARCB4       VDGTD--------------------------------NSLNNFIKLLGEKRRLDLLPFIA
ATPD_CAMLR       LDNPS--------------------------------DAFKNFINLIVDNKREMLIPEIT
ATPD_NITSB       FKDAG--------------------------------KKFVHLIKLLAEKDRLEIIPALA
ATPD_SULDN       VKSAGY-------------------------------KEVENLIKLLAEHNRIEIIPAIA
ATPD_SULNB       IGKEAD-------------------------------ATMVNFIKILGENKRLDLIPAIA
ATPD_HELHP       VGKVD--------------------------------MKLQNFFRLLAQSDRILLIPYIS
ATPD_WOLSU       LGDGE--------------------------------AKLLNFIKVLADKNRLELIPDVC
ATPD_PERMH       SEKAG------------------------------LDPVVKEALEYIVKTNKGNLLKIIG
ATPD_SULSY       LSALG------------------------------VDAEISKLLIKIVKDKKANIFKELN
ATPD_AQUAE       AKKYD------------------------------VPKEVLEVLEYLIDINAMALIPEIK
ATPD_HYDS0       IQKGN------------------------------IPKEIEFFVDELIDLNLLRIVGEIK
ATPD_GALSU       FNN-------------------------------NLDKITLNFLLILIERRRIIYFYDIV
ATPD_CYACA       FSK-------------------------------ILNSTTLNFISILINKNRIMFVSNIS
ATPD_PYRYE       VGD-------------------------------QINENTLSFLMILVDRKRIGMLDAIA
ATPD_GRATL       FTN-------------------------------QVHSLVIRFLLVLIDRRRIALLDVII
ATPD_CYAPA       LAK-------------------------------EIHPYTFKFLLLVIDRGRISCLEIIA
ATPD_RHDSA       FAG-------------------------------NVDENTVKFMMVLCDRGRIEYLDAIA
ATPD_PHATC       LQA-------------------------------QLNDETLKFLMILVERGRISLLTSVI
ATPD_VAULI       IEN-------------------------------KFNLQTINFLNLLIDKKRIDTIQTIG
ATPD_SYNJA       FAD-------------------------------QIHPLLLNALKLLSDRRRIMFLGAVC
ATPD_TRIEI       LGE-------------------------------QVDPLMRNFLMLLIDKGRITFLEQIG
ATPD_GLOVI       FGG-------------------------------KVHPYMLNFLQLMVDRRRIALLRPVC
ATPD_PROMP       FSE-------------------------------KINSSLLNFLKLLADRQRIGIVTSIL
ATPD_STRA1       LQT-------------------------------SCSTYLVNFLEVIVQNEREALLYPIL
ATPD_STRMU       FQE-------------------------------SCSNYMKQFLEIILQNERQQLLYLIM
ATPD_STRU0       LKD-------------------------------SSSVYVNNFLDVVLQNQREYLLFDML
ATPD_STRR6       FQD-------------------------------SVSPLLQNFIQVLAYNHRANLFYDVL
ATPD_LEPBP       VQG-------------------------------KASEIVANFITLVVRKNRFLYLKDIL
ATPD_LEPIC       LRG-------------------------------KISDITLNFLGVLLNRGRIIHLPEIQ
ATPD_EHRRW       ITN-------------------------------HIDTTLSRFILVVVTNNRGNMLLQIF
ATPD_WOLTR       VNE-------------------------------HLSESLVKFIAVIFANKRSNLLISVL
ATPD_ANAMM       LGKSC-----------------------------KLSRTLVGFVCVVVKDGKFGLLSDMF
ATPD_ANAPZ       VQKAC-----------------------------ALDDTLVSFVCVVVEDGLFASLGGIF
ATPD_ECOLI       FIAVCGE---------------------------QLDENGQNLIRVMAENGRLNALPDVL
ATPD_PSYIN       FLNVCED---------------------------QLDENGQNFIKIMAENGRLRFLPRVA
ATPD_BLOPB       FIAICEDYQKK-----------------------QVDTFSKNIIYIMAENNRLLLLPIVF
ATPD_BUCAP       FIFVAGD---------------------------HIDKDARNLIKLLAENQRFKIFNNIL
ATPD_BUCBP       FIDLCCN---------------------------KVNQYGINLIKILAENKRLMLLEKLY
ATPD2_PHOPR      FLDICEG---------------------------LLDEHCQNFVRVMAENGRLIVLPDVL
ATPD2_VIBTL      IIHVCQG---------------------------LVDDHVINLIKVLAENGRLAVIRDLF
ATPD2_VIBCB      ILHAGGE---------------------------WLNKNFENFLRIMEENKRLKALSEVN
ATPD_NEIM0       VGLK--------------------------------DKELKNFVIVLAGQKRLSILPEVY
ATPD_PSYWF       YDEQVTSTEETPLKSLLLSTQSHTDEAQSNQALPAATPQIKNFVHQLAEQERLSLIPQVY
ATPD_FRAP2       LDEK-----------------------------------FFNFVALVAENKKLSILPEIS
ATPD_XYLFT       -------------------------------SPEGADPAYIRFLEVIAEAHRLDVLLQVA
ATPD_COXBN       IQTIEPE------------------------STKQLKDKIDHFLQLLIDEKRLMILPDIA
ATPD_THISH       CEGRID-------------------------------DQGKNFVRLLAENGRLTLLPEIA
ATPD_LEGPH       CGSKFKKN-----------------------------DALNNLIKLLTTNKRLMLLPEIE
ATPD_NITOC       GGDTVT-------------------------------ESAKNFIKILADNRRLSVLPEVA
ATPD_PSEU5       LGDDAD-------------------------------EAFRNYVQTLGENDRLSVLPTVW
ATPD_MARMS       CAEVTT-------------------------------EQGKAFLLALAVNKRLSLLPAIS
ATPD_ACIAD       LGEDQS-------------------------------QAVSNFLTLLADNDRLILLPEIA
ATPD_HYDCU       MDSNLN-------------------------------SEVKNLLNVMAENKRLDALSEVA
ATPD_CHRSD       CGELDE--------------------------------SLCNFIRTVGSRGRLAALPAIA
ATPD_METCA       CKGHVIP-------------------------------EGENFIRLLASNGRLGLVGTIA
ATPD_AROAE       AGQGFT-------------------------------PELQNFVRVLVDNERLQMLPEIR
ATPD_DECAR       CGTAVD-------------------------------AELSNFIQLLSNNDRLGLLPEIA
ATPD_LARHH       LGDKAG-------------------------------HEVRNLLEALAENHRLALLPAIA
ATPD_METFK       SGDRLN-------------------------------EAGTNLIKLLVEYGRLSILPEIA
ATPD_THIDA       AGDGLG-------------------------------ERGANFVKVLSANDRLTLLPEIS
ATPD_BORPD       VKTQLP-------------------------------QAVRNFIELLVANDRLLLLPVIA
ATPD_POLAQ       VKTKLD-------------------------------GKVASFLNLINQNHRLAAVPEIA
ATPD_ACIFR       PVAVDV-------------------------------KAWKAFLALLIHNDRWPATAEIG
ATPD_LACJO       SDK--------------------------------FSSETKNFLDFLLEYRRFESLTAII
ATPD_LACDB       EQG--------------------------------FSAELQEVLNFLLSYDRFDNLVDII
ATPD_LACPL       TDH--------------------------------ASEYIKNFIQMLYDYGRMSNLVGIV
ATPD_PEDPA       TKD--------------------------------ASNYVGNLIKMTFDYGRMDYLTAII
ATPD_LACF3       KEG--------------------------------ASKYVANLLQMAFDYRRMSDMVAIV
ATPD_LACS1       KKD--------------------------------SSKLMTNLLDMLYDYGRITSLEGII
ATPD_ENTHA       VSG--------------------------------FDGIVKNFLEVVYSYNRMSELSFMI
ATPD_LACSS       SND--------------------------------FSTLMQHFLSLVFDYQRMAEMPYII
ATPD_LACCB       TKD--------------------------------ASPLVANLLKLTQQYGRFGALPAII
ATPD_LEUMM       TGN--------------------------------STDSVKNLVKLLQVNNRLNILSIVV
ATPD_BACP3       FAG--------------------------------VSTPVQNTLLLLLERHRFGLVPELA
ATPD_BACP2       FKG--------------------------------VSTHVLHTMYLLIDRGRTNIFSEMT
ATPD_LYSSC       FAG--------------------------------ATPEVLHTVQLLVEKKRVNEVKLIA
ATPD_OCEIH       FKG--------------------------------ADPVVINTLKLLVDRHRTSTIPSIV
ATPD_BACCN       FSS--------------------------------VSESILNTLYILVDNKRIEILPAIA
ATPD_BACPE       FKDS-------------------------------LSETSLHTLLLLVENKRIESLVDMI
ATPD_BACSK       FQAH-------------------------------LSPAVMNTINLLMERGRYSEIVGLA
ATPD_LISMO       FEK--------------------------------INPTLRDFIYLLIDRSREDYLSVIA
ATPD_EXIS2       FTG--------------------------------FNTIVLNTILVMVENDRASEVLSLP
ATPD_STAEQ       YNE--------------------------------ANPYVVNTLKVLADNRHISIVENVF
ATPD_STACT       FKG--------------------------------INEYLKNMLFVMAENRHLSILPEVF
ATPD_MACCJ       FSG--------------------------------VDKPLRNLLSILADKKQLALLPSIA
ATPD_CARHZ       LEKLFP-------------------------DFNPITKS---FLKLLVDKRREVYLPEII
ATPD_NATTJ       ADELTA-------------------------DLEQEIRD---YLKVLIDNKRTDELAEIH
ATPD_PELTS       LQKLF--------------------------KGKISDVT-ANFLALLVDRRRETFFGEIV
ATPD_HELMI       VGRLLA-------------------------TGAFSETA-RAFILLVIDRRRESYFADIF
ATPD_DESAP       VREAF--------------------------GKELSGTT-LNFLCLVLDRRREVYLKGIA
ATPD_DESHY       MNKIF--------------------------AGELSVTV-RNFLNLLIDRRRQNYLMEIA
ATPD_SYMTH       LASVL--------------------------EGKVSPLV-LHFLYVVVQKRREPHLPSMY
ATPD_SYNWW       ANKLF--------------------------GGQVSQLT-LNFLNMIIDKRRETYIGLIS
ATPD_BREBN       ADELF--------------------------KSHVGEEA-FNFLNVLIENGREVDLVDIY
ATPD_HALOH       IHQVF--------------------------SDKVSEPV-FNFLNLIVDKRREVYLDFII
ATPD_SALRD       VRELL--------------------------GDRVEDLT-VRFLRLLIRKDRETMTEAIL
ATPD_GEMAT       LSKAL--------------------------GDKVPHLF-LRFLQQLVKNRRQMLIPAIA
ATPD_CHLT3       LKEVF--------------------------GGKVSQQV-ATFLFLLASKNRAEYLPEVI
ATPD_CHLCH       VEEVF--------------------------KGRVSETV-MFFLKLVGKKNRLGHLPHIV
ATPD_MOOTA       IDTI---------------------------FPDINPLL-KNFLHLVLAKGRERALPEMA
ATPD_SORC5       LRELGG-------------------------RAAFSDVT-KNTLLLLARRRRLAALPEIA
ATPD_GEOSL       LAKL-----------------------------NLSGTV-SNFLQVLLDRGRIGFTPQIA
ATPD_PELPD       VGSC-----------------------------ACSELM-GNFLLLLVDKNRVAFFSQIV
ATPD_DESDA       LGKL-----------------------------KADQTM-RSFCFLLADKERLAFLREIS
ATPD_LAWIP       LELI-----------------------------DAAQPI-KNFCLLLAEKERLPLLTQII
ATPD_DESAL       VEKS-----------------------------GVSAVT-ASYLLLLFDKGRIGFLDVIT
ATPD_DESPS       VKSM-----------------------------DIDAVM-SNFLNLLVEKKRAEILPEIA
ATPD_SYNFM       AEQL-----------------------------ALTPIV-RSFINLLIVKKRVEHLESIA
ATPD_SYNAS       IQKI-----------------------------RMSDMT-TNFLKLLVDKKRIGMLAEIA
ATPD_MYXXD       MQAIP---------------------------GGVEATL-ANTLRLLVDRNRLGYLADIA
ATPD_BDEBA       LSGK-----------------------------GVSEEV-VNTLVLLAEKNRFGVLEQIS
ATPD1_PELCD      SNYL-----------------------------QLSTTL-RNLLGLLQQRQRLEYFDALV
ATPD_SOLUE       VGRISD-------------------------TLKISPIV-RNFLFVLVDHRRIASLTEIL
ATPD_ACIC5       LDRMNQ-------------------------KLGLAPVV-RNFLAVVLQHERMHAMEEIL
ATPD_KORVE       LDGLVG-------------------------MVGTPRII-RNFVAVLIDHQRVPLLPRIA
ATPD_PHEZH       ADKAKF-------------------------KPTTK-----KFLGLLAANGRAAALPEVI
ATPD_MARMM       AKKAKF-------------------------NVLTA-----NAFGVAARNGRAGDLGDLA
ATPD_HYPNA       AKKAGY-------------------------SPLFG-----KFLGTMATNGRANDILGAE
ATPD_GRABC       LDRQGF-------------------------TRIER-----NFVGTVANNRRLGSLRSII
ATPD_GLUOX       MSKLGF-------------------------GDVLR-----RFVGVIADNRRLPDLASIL
ATPD_RHOCS       LAQVDV-------------------------SGLVR-----QFVGLVARNRRLFALSGMI
ATPD_METSB       LDRAGL-------------------------SGTTTS----QFLNLVASKRRLFAVADMI
ATPD_PARDP       SERMGL-------------------------SAELA-----NTLRLLARNRRLFTLPQFV
ATPD_ZYMMO       VPVLAI-------------------------DDLTA-----KFLNLLAAKGRLGAFPEIA
ATPD_BARBK       CENLGL-------------------------AHKKAGQILRNFLCVVAANRRLSALSGIL
ATPD_RENSM       VPGAS--------------------------------QVAELLIGQAVAAPRGARPAKLV
ATPD_KOCRD       AHTES--------------------------------DEAALLIERAVSAPRGSLPGRLL
ATPD_NOCSJ       LAQRAL-------------------------------PATVALVEQALAGSF-RSFHAAV
ATPD_LEIXX       LVGKAA-------------------------------GQTVAITRQLVLQPRGRSVRQAL
ATPD_CORU7       LYGKVS-------------------------------SVTEALALQAVGRARKA-PVDLL
ATPD_NOCFA       LAGKAE-------------------------------PVTISLAEQVVGRNTTR-IGAAF
ATPD_THEFY       LSGKVS-------------------------------TATLTLVTEAVTRPRGRTLEQGL
ATPD_ACIC1       LADRAH-------------------------------PVTVALVTQLVRHPRGRTPEEGF
ATPD_FRASN       LSGRAH-------------------------------PVTLRLAEQAVADREQGDIERRL
ATPD_SACEN       ISGKVE-------------------------------EVTQSLVRQLVTHPQGR-VSDGL
ATPD_KINRD       LLGKAS-------------------------------PETVQLARRAASSSRGMRAERLL
ATPD_SALTO       LAGKAR-------------------------------PVTVRLVEVALGGFGGRSFVGAL
ATPD_CUTAK       VGGQVS-------------------------------EETLVLARRAVVASDST-FEQVI
ATPD_CHLAD       LLPQVR-------------------------------NFLLTMVKEGL-SGELNAVAEAL
ATPD_ROSS1       APREIR-------------------------------NLVMALGREGN-LDRLPAVVTAF
ATPD_LACP7       FKGRVS-------------------------------DDVTGFLVIIIKKGRYDEISGIF
ATPD_STRS2       RQSS--------------------------------FWQINDLIEDVIRDGHADLLLETL
ATPD_MYCA5       FSGN--------------------------------NIHLINFIKLAAKAAVAKFLIQIL
ATPD_AZOPC       CRIDSN-------------------------------KTLKQAIKVIVKNGRAYYIERIA
ATPD_THERP       FPGDEN-------------------------------RYVRNLLVLLLERGRWHQLRDVV
ATPD_DEHM1       SNID---------------------------------PLMLNLVDMLVATRRLGIMRAVS
ATPD_RHOBA       FGGNS-------------------------------HPTLIKLMKVMAKRGRLGYLVAVR
ATPD_PROMO       FGELE--------------------------------ESSLNIIFYLIEKDRLSSIRGIV
ATPD_CALS4       LEGFS--------------------------------KEIVNFVKVAISKHRENLIKEIL
ATPD_DICNV       VESRGE----------------------------ALSEQERNFLNVLNQQGRMAIVPEIA
ATPD_VESOH       LMSILNR---------------------------ELDAHEAMFISVLLDNNRIGILPSIA
ATPD_MYCAP       VQENKN------------------------------LKTFANFLKLLISKNNSPLLLQAL
ATPD_LACLA       LQTSS--------------------------------EVMSNFLNTVRSNGRLGDLGEIL
ATPD_WIGBR       KNNFDV--------------------------------YFNNFVKIIIENNRLIIFPEIL
ATPD_MAGMM       LEYAKP------------------------------NDLTANFLRLLIDKHRMALLNDVA
ATPD_RUBXD       TEGMS--------------------------------PLTTNFLKVLCDNRREEILEDVL
ATPD_PARUW       FKDRLD-------------------------------ETILNFLFVLIEKNRFKYIVDIR
ATPD_MYCPE       FFDLSKS---------------------------ISNIYLKNFLFVLNDNNFFKRILEIF
ATPD_MYCS5       FGSLEV--------------------------------DVKNSIKVALVRNMIFVLRKII
ATPD_MYCPU       FDLIE--------------------------------PLILNFLLMAVEDNKIKYLDNIF
ATPD_RICBR       VKNIKI------------------------------SKIMQNFLLLLIKNSRTSILADIA
ATPD_PELUB       SEQYKL------------------------------NELLTKFLSFLISKRRFFYVDKIL
ATPD_THEYD       CEKLGL------------------------------PEETKKFLNFLSIEGVLIGLGEIV
ATPD_BIFA0       IDGADF------------------------------DRITVRLAEHCTRNPRNRRYLESV
ATPD_CALS8       LDESID-------------------------------RYIVNLICLLIDKRRETLLPYIP
ATPD_UREU1       LEGEID-------------------------------IYLISLIDLLIDVKSIKLLKKIV
ATPD_ORITI       SSAYEL------------------------------DHLTYNFLKLLQKNNRLTYLSHII
ATPD_OENOB       GKGCS--------------------------------TTTKNFLETLADNRHFSLLEEIV
ATPD_ELUMP       LKTDNF--------------------------------LIKNTLFLLIDNKKLNLLGQII
ATPD_HETA2       FGRSLN-------------------------------PILMSFLYLLCDTKRIIYISSII
ATPD2_BRAHW      YADKIL-------------------------------EETFNLIAILVERDMINILFAII
ATPD1_BRAHW      LKPILS-------------------------------KETYAFVSILTEHDSIDVLPDIV
ATPD_CYAM1       DKLV------------------------------------QSWLEVIWKKKRMNLLAEIC
ATPD_PETMO       SEFDD--------------------------------TIFVQFLEVLADKRRQNLIPFMS
ATPD_ACHLI       GIFD---------------------------------ALFMNFLMLLVRHHQVRLYEDIY
ATPD_TROWT       FAGAH--------------------------------EGTLAVLEYFACYMQKKRAFREC
ATPD_NEOSM       HLPC----------------------------------ELKNLCKLLLANHRGFLCTTVL
                                                                             

ATPD_AMOA5       DTFLEQ-YYIYRGIKAASVTTTFRLSDDLIRYFKNLAKSLVPCK----------------
ATPD_CYTH3       SEFQRQ-YREKMGIKIVEVTTTQPITEDQRANFKAIMAS--KAS----------------
ATPD_PARD8       YIYIHL-YRKEKKITRVRFDTAVAVDDAVKSHLQDKLRKE-TGC----------------
ATPD_BACV8       MSYIDL-YRKQKNISVGKITTVCPVAEEVVNRIRALVVEK-THG----------------
ATPD_FLAPJ       SEYNKL-FDEINGIQVAKVTTAIAMDANLEAKVKAKIATF-SDK----------------
ATPD_GRAFK       RQYIIK-FNELNNVRQAVVTTAVPLDKELEAVILSKVKEL-TGS----------------
ATPD_ALKOO       NEYILL-VDSVQNKVDAVAITAVPMEKQDLLMLQANLSKSSGK-----------------
ATPD_CLOPD       DIYKQL-LNENKNEIQAIAITAVPMSEESLKELTYKLCEKTKK-----------------
ATPD_CLOK1       KEMGKI-YLENHNTVIATVKTVIPLEDDERETLTEKLRRKFNK-----------------
ATPD_HUNT2       EEYFRL-ADERKNILNMTIISAFPLEDVQINRIKEKYKKLYNKT----------------
ATPD_RUMCH       NQFIQM-ANETANVLDMKIIMAAPMDEVQLETLREKFKKKYNAV----------------
ATPD_MYCGA       KKFFRM-IEEEEHTIFINVVSAHELNDDQKAQLVEKLHKKFAS-----------------
ATPD_MYCPN       KYFFDC-VENEKHVQFIRIITAFELSAPQLKRIVAAMEKKLNS-----------------
ATPD_MYCMS       KVLYKK-LLAYKNIVLGEVYSTEKLTKTQLNAIKKKISNKVNK-----------------
ATPD_MESFL       KKLRGK-LVELDNMTYGVVWSTEEISAAQIKEIEEKMSKKINK-----------------
ATPD_MYCH7       LKYIKL-ANSHLSQTWGEIETAFPISSVMTSSFESILSKKLGK-----------------
ATPD_MYCMO       KIFLDI-ASKKLNISYGKIYSSKKLDEKIISNLEKFYSDKLSK-----------------
ATPD_THEM4       AYYRYA-SIDVENKILVNVTTAEKLSSEELRAISEFVKKCVNR-----------------
ATPD_PSELT       QYYKNM-KIESEMKVPVFLTTAYELSEEELKVITDFVRKYTKR-----------------
ATPD_THENN       ELFEYE-KILSEQKVPADLRIAHVPKEEELTLLRKFIRKYALK-----------------
ATPD_FERNB       SFFDYT-ILEDKGLIPVNVTSAMELSKEEEEILSKFVEKYTNR-----------------
ATPD_CAMFF       KEFEYQ-QAVRDCKFSGLISGNFELSAAQKTELEERFSKKFGA-----------------
ATPD_CAMHC       DGIKES-IALSNNEYQGKIYTKENLDEPTIKLLETNFSKKLNA-----------------
ATPD_ARCB4       KDLNIQ-LAKMNNNYIGVVYTNQELSSDYISSIEKQFSKKFDV-----------------
ATPD_CAMLR       KELSEQ-KASKENTFLGQVYSKEKLSEEEIKNLEEKLSLKFNA-----------------
ATPD_NITSB       NELKIQ-RALKERKFDGVVYSEFKLSDNELKKIAEALSKKVNG-----------------
ATPD_SULDN       EVMRKD-IAKTNRVYSGVVYSDSVVDSKVMEDLGNGLGSRFNS-----------------
ATPD_SULNB       KVLNAD-LQKESNQYEGVLKSSSELGKEELAKLEKTLETYTGS-----------------
ATPD_HELHP       DELERR-LLARKKEYAATLTAKESLDTKTLEKIQDSLAKKLGV-----------------
ATPD_WOLSU       KELEKS-IAATRNEYVAVLTTQEAFDDKTLKAIEETLAKKLQA-----------------
ATPD_PERMH       DEFRFE-VEKFFATVKGEIITAYPIDEETINSVKEVVEKKLGK-----------------
ATPD_SULSY       KVFKFE-VEKFFGTVQGEIISAYKIDEALLNEIKSVIESKIGK-----------------
ATPD_AQUAE       RLYELE-LEKLMGMLKGELILAKKPSKKLLEKITKTINDILNR-----------------
ATPD_HYDS0       RLFDYE-SEKILSIYKGKLIFAKEPVKELVDEIIQRVEKVLNR-----------------
ATPD_GALSU       DQFILI-WNKATNTSVVEIASVISLTEKQQQYLINKLKEITKA----------------N
ATPD_CYACA       EKYNQL-VLKDKSVKLVKIACARQLSEKQAQALSEVLKHKFKC----------------L
ATPD_PYRYE       SKYLEL-AYQMESLTIANINTSIALSPDQETLLTEKIKVMTKA----------------K
ATPD_GRATL       SKYLEL-VYQLQSTVIAEVLTPVLLTDVQQSALINKIKDMTNS----------------K
ATPD_CYAPA       QKYQSL-ILKLTKTELAEVVTAVPLSSEQEAALNNIIKELTNA----------------N
ATPD_RHDSA       ETALIL-AYKQASIEMAYVASSVKLSSAQTEALVDKLKAMTKA----------------D
ATPD_PHATC       TIYLEL-VYETASIKTIEVSTAFEFTTSQKTILVQKLKELMNA----------------R
ATPD_VAULI       KIFLEK-AYEFVCIKFVEVWSTIELSQKQQENLIQKINILLGPIFSEPS-------VQFY
ATPD_SYNJA       QRFLEL-QRKLKNIVLAEVTTAVPLTEAQQQSIRERVRDFTQA----------------S
ATPD_TRIEI       KQYLAL-LRELNQTVLAEVTSTVELNENQKNTIRERVKSMTSA----------------R
ATPD_GLOVI       TSYQRI-LRELQQTTLAEVISAVPLSEEQASALIERIRRRTAA----------------V
ATPD_PROMP       DRFLEI-YRENSNIALATVTSAVELTDDQKGLITKKIINIAGT----------------E
ATPD_STRA1       KSIDQE-LIKVNGQYPIQITTAVALSPEQKERLFDIAKTKLALPNG--------------
ATPD_STRMU       KEVLKE-LSLKTHIFDIEVTTAVALSDDQKERLTALVEKKFALTKR--------------
ATPD_STRU0       KTVLKE-IAQETNTYDVTVTSAIPLTEEQKNRVISVVMSKFGIQTG--------------
ATPD_STRR6       VDCLNR-LEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVR--------------
ATPD_LEPBP       EDYRSG-VDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREV---------------
ATPD_LEPIC       KQFTVE-LDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEF---------------
ATPD_EHRRW       NTFLEY-VRKHNKEVSISVTSCSKLTTQEKQGICNALLEKYGKVV---------------
ATPD_WOLTR       EKFLTL-VRESENELEITIKSAETLSES-NIKIITESLSFLGKIV---------------
ATPD_ANAMM       EEFFVL-LMHARGQFALEITTASPVSAAEEKRILSIVKSEYGEPA---------------
ATPD_ANAPZ       EKFFAL-LRRKLGKFNLEIISAAPLTEKEESKILRMLRAQYGDPE---------------
ATPD_ECOLI       EQFIHL-RAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRK----------------
ATPD_PSYIN       QLFAAL-EDEHKKQVDVNVVSAYGLSKKQLDELSKSLEKRLARK----------------
ATPD_BLOPB       KEFTYL-CSIYVHTVEIEIISAWPLKYNQLKKITDIMAKRLSKT----------------
ATPD_BUCAP       RQFLKL-ETSYQGNTIIELISAYSLQEHEIIDIRCILQKIFLSK----------------
ATPD_BUCBP       KEFINL-CELYQGVVNITVISAHKLNEEYISKINIMLKKRFFKK----------------
ATPD2_PHOPR      NLFMEM-KADFERTIEATVLSVEPLTEEQKVNLVKALEKRLSRT----------------
ATPD2_VIBTL      NLFSDL-KDEHERVIPVTVTSSELLTQDQVTSLTAALEKKLERQ----------------
ATPD2_VIBCB      VQFQEM-KADYERTMTVTVRVSEPLDEEQMARLKQALTEKYGKA----------------
ATPD_NEIM0       AQYQDL-TLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSE----------------
ATPD_PSYWF       EQFRLH-RAQALKQVNAYVTSAYPLSETQRVMIQKRLEESLKAS----------------
ATPD_FRAP2       FQFENI-RNVHNNIKVADVTLAYAIDKNTLANLKTKLEEKFSCS----------------
ATPD_XYLFT       GLYEKL-RAEAQHVIKAKITSAIELAPNELNNIVTALKKRFDCE----------------
ATPD_COXBN       LVYQQL-LNKYQDIIEASVTYVFPLNDEHRQQIQKQLEKRFNAE----------------
ATPD_THISH       AIYEVM-RAEAEGKVEALVVSAQPVSDAQKSAIAQSLAKRLGRE----------------
ATPD_LEGPH       ALYEVY-RAEQEKILEVDVVSYSELTPAQQQRLSESLSQRLSRK----------------
ATPD_NITOC       ALFEQL-RAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGRE----------------
ATPD_PSEU5       ELYEDI-KAQAEKTLEAEVETAFELSNAQLQTLAAALSKRLDRT----------------
ATPD_MARMS       ELFLQF-KLNFEKAVNVQFTSAFELTAEQTQALAASLAKKLDRT----------------
ATPD_ACIAD       EEYEEL-KSQNNNVVDVVIESAFPLSAEQEQLLKTALEKRYNSS----------------
ATPD_HYDCU       EVFEEL-KATEDKRVRATVISARKATVEQKKKLSAALNAKFDAE----------------
ATPD_CHRSD       EQFEVL-RAEEEKRVDVTIVSAFDLDAAQQDKLATALKKRLNRE----------------
ATPD_METCA       DMFAEF-RAEEEGYVDVDVITAYPLEESETTNLNALVEKWMSRK----------------
ATPD_AROAE       DLFVEL-KNEHEGVQEAEIASAFPLDDATLANLKADLETRFKTR----------------
ATPD_DECAR       GLYETY-KRAEEGTKQADIVSAFPIDDNQVKALIPQLEAVFKTK----------------
ATPD_LARHH       EQFEQL-KQVEEGVLTADIASAYPLTEAQSAELAATLKAKYGKE----------------
ATPD_METFK       AAFEAL-KAQDEGVLEAEITAAVQPSDAEFSAIVKRLEAKFGKK----------------
ATPD_THIDA       TQFETL-KAGAEGTLEATITSAQELSQAQVDDLVAGLKAKFQRA----------------
ATPD_BORPD       KQFVAL-KNRHEGTAQAEITSAFELSDAQVKELIEALETKFGLK----------------
ATPD_POLAQ       HQFEAM-KNKSEGAAEVSITSAFPLEGSALNDLLSSLKKRFGGKE---------------
ATPD_ACIFR       TLFADA-MRRAEGVVDVLVTSAIALDAGQKTAVQSALERRFAGHK---------------
ATPD_LACJO       EAFNTL-YDEYKNIASGTAVSAIKLNEDELSRISQAYAKKYGFK----------------
ATPD_LACDB       DYYIHL-YNAANHIGTGVAKTALKPDEDQLQRLADSYAKKYGLQ----------------
ATPD_LACPL       DAFEAR-FDESRKIVHAEVTSAVKLSDEQADAIAKAFAKRVGAN----------------
ATPD_PEDPA       DEFNNL-CDADEKIVRAKVVSAIPLSDQQLDKMAEQFAKRLKVS----------------
ATPD_LACF3       DEFERR-YDEKHKRVHAEVVTAVQLDETRRNQLRDNLAARLGAQ----------------
ATPD_LACS1       DEFDRL-NDEFEKTVRASVITAIELDEERKQKLASSFANVVGAK----------------
ATPD_ENTHA       DEYEHR-YNDYKGLLLGSVKTAVPLSDEQLQKLEMNVAKTMDYQ----------------
ATPD_LACSS       AAYEDL-YDQHKGIAHAKVTSAVALDDDQLAKISQSFAKREGLN----------------
ATPD_LACCB       SAFNQA-YDEEAGIIAATVTTAVALSADQADALRSTIAARFGMK----------------
ATPD_LEUMM       DEFVSQ-YNEVNGIVDVQATTAVALDDGRLDKLASVFASKTGAQ----------------
ATPD_BACP3       GTVSRPRSTTARGIAKAVAYSGAASTDEELRALSDVFAQKVGKQ----------------
ATPD_BACP2       SEFVKL-ANRTKQIDDAIVYSVKPLSGAEIQSLSEVFAKKAGVT----------------
ATPD_LYSSC       NAYAEL-AAKAQGTADATVFSTRALSAEESANISTTFAKLVGKQ----------------
ATPD_OCEIH       DHLVAL-VNDTKGIADATVYSIRELNTDEKEQLQTSFAKRLGKR----------------
ATPD_BACCN       NEYVTL-ANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKD----------------
ATPD_BACPE       DSFKEM-SYEAQDMAEAVVYSAKPLTSEEQAQIAVIFAKKVNKA----------------
ATPD_BACSK       GEYKQL-NDDKKGIAEATVFSVKALSDSEKNQIAAVFAPKAGKR----------------
ATPD_LISMO       DVYQKR-VNDLRGVADADVYSVVPLSEQELTALSRVFATKMNKT----------------
ATPD_EXIS2       EHFIAL-LNEHRNVATAIVTSAYKLSDEELTNVKETFGQKSGK-----------------
ATPD_STAEQ       KSFQNL-YNKYYKQDFAIIESTYELSEDEISRIVELIKKQTELS----------------
ATPD_STACT       KAFEGL-YNQYYNQDFATVESVHELSQDELDKVGEALIQRTGLS----------------
ATPD_MACCJ       DYYTEH-YNKFNNQQYMKVESVYALSSEELDEIGKAFIKRTGYK----------------
ATPD_CARHZ       ALFAEK-LREERGEMLVEVESARELKGDLSDLIKEKLSRLTGK-----------------
ATPD_NATTJ       DTFLDL-VRTEENRTLCEVKTPIPLDEDELKKIQDLLAQMSEG-----------------
ATPD_PELTS       AEFVKL-ANAGRNIITAQVTSAVELNDQEKGDLNRILVRLTGK-----------------
ATPD_HELMI       REFVRL-ANKVRNIEEARVTSAVELAPEQVERLRSQLAAATGK-----------------
ATPD_DESAP       DHFIAL-ANETRNIIEAEVTSALELSVVHKVNLMQVLSRMTGK-----------------
ATPD_DESHY       RVFAHL-ADEARNIVEAKVASAIPLSETQEQRLHQELARMTGK-----------------
ATPD_SYMTH       RAFQDL-ANEAMGVVEVEVRSAVPLAEETARNLEAKLTTKLGK-----------------
ATPD_SYNWW       EEYRDM-ADELRNITKAELTAAAPVSEADMKNLEQNLSAKTGK-----------------
ATPD_BREBN       RSFVQL-ANEARGFADAIVTSAKPLSTEEQNELAEKFGQTLNK-----------------
ATPD_HALOH       RDFIKQ-ANRKEGLVKIEVVSAIELSEKQREQLKNKLKKALNK-----------------
ATPD_SALRD       DQYQTL-RDEQRGIVDAEVTVARPLADETRTTLVGVLEEKTGK-----------------
ATPD_GEMAT       TEYETL-RDAASGIVHARVTVARETGDEEAKMIAERLSKATGK-----------------
ATPD_CHLT3       QEYRAL-LDEQNGVISVDIKTAVDLDDKQTKQLKDKLEAYTSK-----------------
ATPD_CHLCH       DEFKNL-LDEDRGIINVDITSAVELSDEQANELVATIANMSGK-----------------
ATPD_MOOTA       AQFRRL-VDQAENILPVEVTSAITLREDILAGLKERLAGITRR-----------------
ATPD_SORC5       RQLALL-VDQDQNVARAVVTSAGPLSDGYLDRLRAELEKATGR-----------------
ATPD_GEOSL       HSYAVF-ADELSGIVRPVLTSAFPLDDAQVEGMKSALAKATGK-----------------
ATPD_PELPD       KAYGQL-ADEHVGILRPVITTAFELDAVQLAAIREALEKKSAK-----------------
ATPD_DESDA       AWYGKL-LDEAKGIVRGELVTAVKLSADKKAKLKESLEKKTGT-----------------
ATPD_LAWIP       NSFKVL-LDNAKNIVHGQLITAITLDEKKQSELLISLEKQTNR-----------------
ATPD_DESAL       SEYKEM-ADELKGIARASVSAATELSNETIEKIRSGLGRLTGK-----------------
ATPD_DESPS       EEFQAM-VDDAQNLSHGSVISAVELSEELQGKIQQTLEKLTGK-----------------
ATPD_SYNFM       QYYHRL-IDEYSNVARAQVKAAIDLDEKVIQEIAKTLEKMTGK-----------------
ATPD_SYNAS       DYYRVL-MDEVLKRVRVSVKTAFPLPADVTSDIKQGLEQMTGK-----------------
ATPD_MYXXD       RLFRDM-ADARAGRVRGHVTSAAPLPADALAQLQQTLQQLTQR-----------------
ATPD_BDEBA       FAYRDL-LDLEEGVTRGVVRSAQPLAADAQKDIEQKITKVLNK-----------------
ATPD1_PELCD      ADYREL-ADVQLGLVRARVCSAAPLDAAVQQAISAQLQKRYGK-----------------
ATPD_SOLUE       HSFELI-MDERLGFARAEISSARELTEPQRTALSAQLAQLTGK-----------------
ATPD_ACIC5       KEFREE-MNRRLGITAVSITSARALNEAERKSLLEQVGTLAEG-----------------
ATPD_KORVE       RQFELE-LNHRMGFADAEVTSVHELSAQDRQMIEQQIAKVVGK-----------------
ATPD_PHEZH       SAFERL-AAEARGAVSAEVTTALPLSSAQAKGLAQALRQALGK-----------------
ATPD_MARMM       RVYAAL-AAADRGVVTADVQTAAALTKKQTEALAASLKSAFGR-----------------
ATPD_HYPNA       FAFDQF-YAKQRGVQRAIVRTAKEMTGAEKSRIESLLARVVGG-----------------
ATPD_GRABC       SAFAVL-VAEKRGEAVAVVESAHELTEVQEHQLRASLIEAGYG-----------------
ATPD_GLUOX       DGVLAL-DSALRGEVVAEVRSAQPLTDTQRSQLQARLAEAGYS-----------------
ATPD_RHOCS       DGFLAE-LARRRGEQTARVVAARPLSQEQLDALTDALRRALGS-----------------
ATPD_METSB       RDFNIL-HDHAVGLSRAAVTVAEPLKDEHVAALKDALAAVAGSQ----------------
ATPD_PARDP       AKLRNL-IADAKGEVTADVVSAQALTDEQKARLADTLAAKSGK-----------------
ATPD_ZYMMO       SAYRQY-VADLRSEKVADVITAHPLSDEQKSTLTARLKEQLKA-----------------
ATPD_BARBK       QAFQRR-VALSRGEVSAQVISAHPLDADQKKELCVALESVVGG-----------------
ATPD_RENSM       EQFATL-AAARQQRWIATVTVGQALNKNQEARLSAGLNNLYGRD----------------
ATPD_KOCRD       EQFAQW-VADRQQRWIARVETARPLGEEQLARLQDGLNRLYGRD----------------
ATPD_NOCSJ       SEYQKV-AAATQGEGVALVRVARELTEAERTRLEQALSTQYGRP----------------
ATPD_LEIXX       REAARI-VAAQDGQTIATVVTATPLPAAQAERLRASLAAKYGD-----------------
ATPD_CORU7       DDLCQE-AASLNGYEVARVTSAGPLSEEQKASLSEKLHKIYGRK----------------
ATPD_NOCFA       DELSDL-AAARRDQIVAHVRAAIALTSQQRERLAASLQRIYGKP----------------
ATPD_THEFY       EHFSQL-VAERAKHYIAVVRAAVPLSEAQQSRLQAALTRIYGRD----------------
ATPD_ACIC1       ADFSGI-AARFRQRLVARVTTAVALTDDERSRLRRALSELYGRD----------------
ATPD_FRASN       EQLSRI-AAARRGRVVAVVRTATVLDADQIARLKAAISRFFGRQ----------------
ATPD_SACEN       EELAEL-SAKRRERSVAHVRSATPLSEEQQQRLASTLQRIYSRP----------------
ATPD_KINRD       EEWVEV-VAKRREQLVAHVVSATPLTDAQRERLAATLSRQYGRA----------------
ATPD_SALTO       TRLVEL-AADQRDRQVAYVTVAAPLGAEEERRLVASLSAIYGRE----------------
ATPD_CUTAK       DGYLHV-AAEMADRRRAIVTTAKALTDAQRAEMVKQLERITGSP----------------
ATPD_CHLAD       QTYLET-G---RRVIDASVTSAIELSSEQQERITSELRRRYG-D----------------
ATPD_ROSS1       EQMTRR-GG--ARPLTGEVISAVELNPQQRERITAQLTARYGPD----------------
ATPD_LACP7       DYFLAK-VREHKNIGVAYVTSAVEISEQEKEQIKDKLLATTKYV----------------
ATPD_STRS2       ERVQLQ-ISKFKNEFEARVVSVYPLTEAQKERLRHLVEQRFSLR----------------
ATPD_MYCA5       VRFVEI-SNQKLNVKYGTIFTTIALDEVKVKEFESKISKKLNAK----------------
ATPD_AZOPC       RMYEKE-YRQSKGLVLAQLTTVGLTTNNEAKKLLIKFLSNKTNG----------------
ATPD_THERP       VAFREL-LREHRGVIDVELVTAVPLEPSEVERLRRELAQRLSRP----------------
ATPD_DEHM1       GEYNRL-LNEARGVEDAIVTTAKPSSEADIEIIRQQLSKITGKK----------------
ATPD_RHOBA       DAAVDL-FDEAAGRVVAEVRTAVPMTEQLRGEVTQQLSSRFGKT----------------
ATPD_PROMO       AEYLKI-YYAKNQILDVEAIFAIEPTKDQKAKLIEQLEKKTGKK----------------
ATPD_CALS4       NEFEAL-YKAYFNMIDVKVISAYPLKEEVLNLVREKLEKKYNKK----------------
ATPD_DICNV       TQFKQL-YYSAQNVCKATVYTALALDEKQKKELQATIERNVHRE----------------
ATPD_VESOH       TLFESL-INITNNIKIFTIISSYQLSKSEKEQIVSDLMNQYNKT----------------
ATPD_MYCAP       SIYIRL-VESELNILRAKLISAFEIDNQTKIKIIEKLENKYNKK----------------
ATPD_LACLA       DETKNA-ADDMFKIADVGVVSSIALTNAQIEKFTAMAKAKFDLN----------------
ATPD_WIGBR       NQFINL-KNDQNNIENITIISKYKLDKKILNKIEKKIKSLIFKE----------------
ATPD_MAGMM       TAIVRV-VDERAGRIQVKVETPKALTPSLVAKLEKSLADVTGKE----------------
ATPD_RUBXD       RRYEEM-VEDHLGRIEVEVVTATELSGEMQERIRERIARVLGGR----------------
ATPD_PARUW       KEYHRL-AKKRLGILEVRLLTAVSVSDIPQEKVRIKLQKTYQKE----------------
ATPD_MYCPE       ISFFQK-LDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR----------------
ATPD_MYCS5       VDFLKI-TNYELGIKFAKVITAYPLSDSELEKIQKKLNEKTKKI----------------
ATPD_MYCPU       LKAILT-INKKLNIENGIIYTTLKLSDKKLLEIEKKLSVFLKKE----------------
ATPD_RICBR       NTYSKL-LYESKNIKIVQVISANKLKPTEQEWVKTNIEKELKQE----------------
ATPD_PELUB       KSFVET-CSVKRGELKAELTSAKDLTENEINNIKEELTKNFSSK----------------
ATPD_THEYD       RYINAL-YLEAKKKVKGIVTSAVELPENIKQKIVESLKAITGRD----------------
ATPD_BIFA0       QWLINK-FSRHMGESMVTVTTATPLSDEQSDKLARIYTKKTGRP----------------
ATPD_CALS8       FYYKEM-YDKIIGNVEVEVIVSEEVDEGVLRKISNWLLKRYDVK----------------
ATPD_UREU1       LKALDF-VNEALSVKKVLITTAYELTKNQIDRLVQSLKKKYACE----------------
ATPD_ORITI       IAFDAQ-VRNYQGVTLGYLITTIKWSKAAIKDIKAIFERKLNRK----------------
ATPD_OENOB       ENLDQR-VSASNNHSLVIAKTAIPITAEQSKRLSKIAQKKFGYQ----------------
ATPD_ELUMP       IDLNKT-IESFTNTVSAEVYCAREMDDKQQNAVIESLKKYFKAN----------------
ATPD_HETA2       SIFLETLLKNTNSHIVEVQTPTGKDYKLDISKLETTLSGWFNKIQKNNDEAVNFLNFDES
ATPD2_BRAHW      VEYENLCNEYYNIIVVKITTASNMTDTEDMNKLKDHITNMISDK----------------
ATPD1_BRAHW      ALYKEI-ADDYSNIVRVRIITASTIDDKTVEDIIQTVKCFSSNE----------------
ATPD_CYAM1       ASYLEL-RKKKEGIVTVFVTSATPLTDTQTQQLEVQLTRMCQAK----------------
ATPD_PETMO       HILYQE-SLEREKVVEVRLVLPNEVSNTIINQVKQAIQNKTGRK----------------
ATPD_ACHLI       EQWIAK-SRLNQKIAYVQLYSAKPLSKKRLNQLKEEIQDYLPGL----------------
ATPD_TROWT       VFFAEKIVADELGAQIADVTTERPLSREQRDELVDVLSRRFKRR----------------
ATPD_NEOSM       LGYIEI-VKKNRKEADARVESYSRLSATAKKEVADALLIKFPYLK---------------
                                                 .                           

ATPD_AMOA5       EVILKEYVNPSIQGGFVLRI--EDQQLDNSLATRLHKLKKQYSIAEY-------------
ATPD_CYTH3       KVELIEKIDEKILGGFVLKM--DDQQIDESVIAKLNKIKNKFTEQVINY-----------
ATPD_PARD8       TIEFSGHVEPELIGGFRLRI--GNYRIDASYATQLRDIRTGLLENR--------------
ATPD_BACV8       TVEFKTKIDPKLEGGFIFEI--GTYRLDASVANQIKRVKQQFIAKNRRIV----------
ATPD_FLAPJ       KVTIENTVDASIIGGFILRI--GDKQYNASVANRLQVLKRELSN----------------
ATPD_GRAFK       EASLKSVIDEDIIGGFVLRV--GDLQYDASVSRNLRRLERELKDNTYVSKI---------
ATPD_ALKOO       NIQLQNQVDPTIIGGVLVKI--GDKVIDGTIKNRLATMQEQLSKILV-------------
ATPD_CLOPD       NVKVKNQVDPTVLGGVLVKM--GNEEIDGTVKTKLEKLKKQLHQIIA-------------
ATPD_CLOK1       EVLIKEELDPEIIGGVYVEV--NNMVIDGTVKSKLSEMKKIMLKGEQR------------
ATPD_HUNT2       DVKAKLIIDKSLIGGVKIQI--GDKVIDDSIKGRLLCLKEALLQR---------------
ATPD_RUMCH       AVNSTEIVDESLIGGLKVII--GDKVYDGSVKGRIESLTEIVSV----------------
ATPD_MYCGA       QVKILYQTDPSLIAGIRIQS--NDLLIDNSIDGKLKLLKHQLRTFSKEN-----------
ATPD_MYCPN       KIVYKTEIDKSLISGIRIES--SAQLFEKNIRDQLSRLMEQFKGN---------------
ATPD_MYCMS       KVELVNKIDPTLIGGIKVSV--EDKVFDGSIKAKLEALKKQMNT----------------
ATPD_MESFL       EVKLVNKIDTKLIAGIQVVV--HNKVYDGSLRSKLDEMKYQVLKEK--------------
ATPD_MYCH7       KVHLRHKINSKLISGIRIIV--DNQIFENSLFSELKLLKQNLKKHLITKNDL--------
ATPD_MYCMO       KVEMLNLIDTTLIKGIRIEI--ENTIHENSIKNNIKELQKSILEKEQ-------------
ATPD_THEM4       VPVIEEKIDESLIAGAVIEF--SGKMIDVSVSGRLNKIAREVFSLRKG------------
ATPD_PSELT       NPVFETRIDESLIAGVVIEC--EGKTFDASVAGRIRNVTRHVLQREVM------------
ATPD_THENN       DPVFKTTVDESLIAGAVVEF--EGFRLDTTVQGRLKRLSQETLKRGEMS-----------
ATPD_FERNB       KPVFNVTVDDSLIAGVVVEF--AGKTLDVTVKGRLQNIARNILNREG-------------
ATPD_CAMFF       KIEFENIKNNYNGIKIELDD--LGVEVSFSIDRLKAQMSEYILKAI--------------
ATPD_CAMHC       NIKFVCIAGNYTGVKIDISD--LGYEISFSIDRLKSAMSEYILKAI--------------
ATPD_ARCB4       KLSLSQNVCDYDGIKVDIDG--LGVEISFSKDRLKSQLIDHILKAV--------------
ATPD_CAMLR       KIRLDSKISDNDSVKISLDG--LGYEISFSMQSLKAKMNEYILKAI--------------
ATPD_NITSB       EVVLHQGKEPYDGIKVEVNT--VGIEIEFSKSKIKKQLIENILKAI--------------
ATPD_SULDN       KISLKFVKDNFNGIKVDVED--LGVEISFSKARINTQMIEHIIKAI--------------
ATPD_SULNB       KIELKQEKTDLEGLRVSVDD--LGIEVNFSKQRVKEQLIDFIKKSL--------------
ATPD_HELHP       KLSIKQRLSEVDGIKLSVED--LGIEVSFSKERFSNDLKHHILKAL--------------
ATPD_WOLSU       KLVLSQKREEFEGVKLVVED--LGVEVSFSRERFINDLKNHILKAF--------------
ATPD_PERMH       KVEFDIKQDPSIIGGIIVKA--GSYILDSSLKTYLQKLEQQLTAF---------------
ATPD_SULSY       KVEFTVKEDNSLIGGAVIKA--GTYIIDTSVKSYLKRLESTLSRF---------------
ATPD_AQUAE       QIEIEVKEDPSLIGGFVFKT--QAFVLDTSVKTQLEKLA-RVGGV---------------
ATPD_HYDS0       KIEPEISVNEALIGGFELRL--SGLVLDTSVRSVLQNLSNKVKSL---------------
ATPD_GALSU       YIKLKLKIDPSLIGGLIIKF--GSNLIDLSLKGKLKNSPYI-------------------
ATPD_CYACA       SVKLIFNIEPELIAGFKIFI--ESQVIDVSLQGELKEFEWYLTK----------------
ATPD_PYRYE       EVKLIISVEPELIGGFTIQI--GSKVIDTSIRGQLRQMASHLDVVVT-------------
ATPD_GRATL       TVKLVITIKPMLIAGFIIKI--GSKTIDTSLYGRLKHISAYLNAVS--------------
ATPD_CYAPA       EVKLVFKIDQNLIGGFIINI--GSKVVDASLLGQLLRIGNYLGLETV-------------
ATPD_RHDSA       QIKLELKVDESLIGGFKVQI--GSRIIDTSVQNQLKQLSSYLGASVA-------------
ATPD_PHATC       EIRLMITVDPNLIGGFLIKT--QSKVIDFTIKNQLQKLAKHLDTVLEI------------
ATPD_VAULI       KIQLTLMLDTNLLGGLIIKM--GSKIIDLSLRNELQQLGKKLDITI--------------
ATPD_SYNJA       GVELQTSQDPTLLGGVIIKI--GSQVIDLSLRGQLRRLALQLA-----------------
ATPD_TRIEI       EVEIETKVDPSILGGVIIKI--GSQIIDSSLQGQLRRIGISLKTL---------------
ATPD_GLOVI       RVELRRRVDPELLGGMIIKI--GDEVIDASLRGQLRKLTLQLTLS---------------
ATPD_PROMP       KLELVTKIDPSLIGGFVASV--GSKVIDASLASQIRKLGLSLSK----------------
ATPD_STRA1       --QLVEHIDPSIVGGFVVNA--NNKVIDASVRNQLHQFKMKLK-----------------
ATPD_STRMU       --NLIEKIDDEIIGGFIIKA--NNKVIDTSIRSQLQELKMNLK-----------------
ATPD_STRU0       --RLIETIDASIIGGFIISV--NNQVIDTSIKRQLHDFKMKLI-----------------
ATPD_STRR6       --SVKEQIDESLIGGFVIFA--NHKTIDVSIKQQLKVVKENLK-----------------
ATPD_LEPBP       --RVTEHTDLNLIGGFKIYI--DDFLIDASIRAKLAGTREALLQKKIPVGAFE-------
ATPD_LEPIC       --ILEVSEDKSLLGGFVVQF--NDLKIEKSIASQLGEIKKSMLEKKLPVGAIYEN-----
ATPD_EHRRW       --SITNTVDPSILGGFIIRV--GFDIIDVSLNSYLQSLQELSKIAVRSMVNSKV------
ATPD_WOLTR       --RVDNAVDPSILGGFIVKY--GFNLIDASLKSYLDRLVDLSKVEILKTRNFI-------
ATPD_ANAMM       --TVTKRVDPAILGGFIAKA--DSLVIDASFAGHLRELERVSRSVVCGV-----------
ATPD_ANAPZ       --AIIRRTDPGILGGFVAKG--DTFTVDASYVGQLRELTRISKEAVFSI-----------
ATPD_ECOLI       -VKLNCKIDKSVMAGVIIRA--GDMVIDGSVRGRLERLADVLQS----------------
ATPD_PSYIN       -VNLHCSIDKTLIAGMVVTV--GDLVIDSSAKGQLGRLSNTLQS----------------
ATPD_BLOPB       -VNPVHKVDKDILAGVIIRI--GDTVIDGSIRGRIFRLNHVLQS----------------
ATPD_BUCAP       -IKFIYKIDHQILDGIIIKK--ADTVFDFSVRSYLKQLSDVLNF----------------
ATPD_BUCBP       -INVTYVIDESIIGGLIIKF--CDTVINASIHSRLEKLLNILQY----------------
ATPD2_PHOPR      -VELDCQIDESLVGGMLIKA--GELVIDGTLKSSINRLASSLQA----------------
ATPD2_VIBTL      -VEMEQVIDDSLVGGIVIKA--GETVIDGSLNTSINRLAHQLHAR---------------
ATPD2_VIBCB      -ITLETQLDPSLVGGVVITA--GQTVYDGSVLTNLSRLATNLHV----------------
ATPD_NEIM0       -LKISVEIEPELIGGIKVEV--GDQVLDLSVRGKLSALYTTMTN----------------
ATPD_PSYWF       -VIIHEDVDPSLLAGATVKI--GDKLVDDSVRGKLKQLKTQLTA----------------
ATPD_FRAP2       -IDMNVIIDPVILGGAVIKV--GDTVIDDSVSGRIETLKSILLS----------------
ATPD_XYLFT       -IEVTTGVDHSLIGGAVIDT--GNVVIDGSIKSKLTRLQASLTH----------------
ATPD_COXBN       -VKLKMIKDESLLGGVIIRA--GNWVMDGSIKGKLTRLAENLKG----------------
ATPD_THISH       -VELVCEVDESLIGGAVIRA--GDLVIDGSVRGRLERMAANLSR----------------
ATPD_LEGPH       -VSLKISIDPSLLGGALIRA--GDLVIDGSVRGKLNMLGTSLAA----------------
ATPD_NITOC       -VTFSRKTDESLLGGVIIRA--GDLVIDGSAIGKLNQLAASLLH----------------
ATPD_PSEU5       -VNLQQVVNPALIGGVLIRA--GDVVVDGSVRGKLSQLAESLKS----------------
ATPD_MARMS       -VNLTSETDASLIGGVVIRT--GDLIIDGSVRGKLAKLAEAINS----------------
ATPD_ACIAD       -VTISVEVKPALIAGVVIRA--GDQVIDDSALNKLEKMRTRLLA----------------
ATPD_HYDCU       -VEITYEEDPSLISGIKIKV--GDWAIDGSALSQLNKLGAAIAQ----------------
ATPD_CHRSD       -ISITTRVDRALMGGVILRA--GDTVIDGSVRGRLTRLRDALSA----------------
ATPD_METCA       -GRLHVTVDESLIAGVVLRA--GGRVVDASVHGQLQRLAKRLSN----------------
ATPD_AROAE       -LNTKVSLDPELIGGVRIAI--GDEVIDASVRGKLANMAAALKN----------------
ATPD_DECAR       -LEAAVSVDPTLIGGIKVIV--GDQMLDASVRGKLDAMATALNN----------------
ATPD_LARHH       -IVLKASVDPSLIGGVRILV--GDEVIDASVRGKLHTMAISLKS----------------
ATPD_METFK       -VEASVKVDPEIIGGIKIVV--GDTVIDASVRGQLQELAYTLKG----------------
ATPD_THIDA       -VNVQVAVDPELIGGAVIMI--GDQVIDGSVKGRLQRMAFALQG----------------
ATPD_BORPD       -LKPSVTVDKSLIGGVRVAV--GDQVLDTSVQAQLARLRDTLAA----------------
ATPD_POLAQ       -LRPTIQVDPTLIGGVRIQV--GDEVMDSSVKAQLAQMQASLGA----------------
ATPD_ACIFR       -VRFREAVDAALIGGLVIHT--GDLTIDASVRGQVQQLARTLRS----------------
ATPD_LACJO       ELILTNKVDPSILGGIILKV--GDRIIDGSIRTRLQQIREQLIENR--------------
ATPD_LACDB       ALHLENEVDPEIIGGVVLEV--EGRVIDGSVKHRLEKIRAMLTK----------------
ATPD_LACPL       QVVLSRKVDEAIIGGVIVKS--NNQTFDGSVALQLTNLRRALINN---------------
ATPD_PEDPA       EVVLDSEVDDSIIGGAIIKT--DSLIYDGSIQTQINQIRQRLIG----------------
ATPD_LACF3       EIVLNEKVDPTILGGVVVKT--ANQTLDGSIKTKIEQIRRLIVK----------------
ATPD_LACS1       KVIIDPIVDPGIIGGVILKS--ESYIYDGSIKTKIARIKRLLLK----------------
ATPD_ENTHA       TVELKQIVDSSIIGGAIVEA--NHRVIDGSIRTQLEKMRNQLNR----------------
ATPD_LACSS       EVLIESVVDPDIIGGIVLES--NHKVIDGSVKHGLDQIKSLLLK----------------
ATPD_LACCB       STQLDQVVDPSVIGGVRIQA--RGSVIDGTVKHRFDKMKAALLAD---------------
ATPD_LEUMM       QVNIENVVDESILGGVILQS--QSTLIDGSLQTKIAKMKAQLLG----------------
ATPD_BACP3       TLEIENIIDPELIGGVNVRI--GNRIYDGSVSGQLERIRRQLIG----------------
ATPD_BACP2       SLRVENVIDKDLIGGVKIRI--GNRIYDGSVSGKLSRIERQLAGENR-------------
ATPD_LYSSC       SLNITNEIDPSLLGGIRVQI--GNHIYDSSVANKLERLKRELIG----------------
ATPD_OCEIH       SVQITNVVDPKILGGMKIRV--GNTIYDGTVSNKLNRISRSIVSANK-------------
ATPD_BACCN       AIRVKNIVDEDLLGGIKVRI--GNRIYDGSLQGKLARIQRELMKNR--------------
ATPD_BACPE       KLLVTNVVNKDLLGGLKIRI--GDRIYDGSVKSQLDRLERQLIAGTR-------------
ATPD_BACSK       ELRVVNVVDSALIGGLKVRV--GDRVFDGSIQGQLKRLEKQLVAGQ--------------
ATPD_LISMO       KLNIQNHIDKSLLGGVKVVI--GTRIYDDSLKTKLKDMERQIKA----------------
ATPD_EXIS2       TLEVENVVDTNVIGGLRVQI--GYTTYDGTIETKLTRLERELLKA---------------
ATPD_STAEQ       NVIVNTKINQDLIGGFRVKV--GTTVMDGSVRNDLVQLQRKFERAN--------------
ATPD_STACT       KLIITNVINKSLIGGIRAKV--GTKVFDGSIQNDLAQIERKFIRTK--------------
ATPD_MACCJ       KLLIENVVNSTLIGGIRATI--GTTVYDGSVANELTQLEKSFHKQ---------------
ATPD_CARHZ       KVTMKVRTNPDLIGGIVVRV--GNKVYDGSIKNQLYRLKRSIYG----------------
ATPD_NATTJ       EVEIETTTDESIIGGIVVRI--GDRVFDYSLKGQLNSLREQLKKTTITS-----------
ATPD_PELTS       KVKTSYAVDPSLIGGVVVRM--GDKIIDGSLKTRLASLKERLLAIS--------------
ATPD_HELMI       AIVLRMAVDPDLIGGLVVAF--GDRIIDGSVAGKIRDLRESLLRSPLPSLS---------
ATPD_DESAP       ELRIRYQVDPDIIGGLVVRL--GDRIIDGSIKRQLERLKDSIRETKVG------------
ATPD_DESHY       NVRMVKEVRPELIGGVMIQI--GDRVMDGTVAFKLQRIRQSLSHA---------------
ATPD_SYMTH       RVKLRTQVAPELIGGLAVRV--GDTLMDGSVRTRLRRMHERLISAQSNVIEG--------
ATPD_SYNWW       TVQLSLKVDPGLIGGLKIRI--GDQIVDATVAKKLEMLKEQLKQAKIS------------
ATPD_BREBN       KLRMTAVVDPAILGGVIIKI--GDRLYDGSLKTKLETFAQKA------------------
ATPD_HALOH       KIELKTKIDPGIIGGIIIKI--GDRLIDGSIKHQLDSIKESIEKIPVTELGVIQNES---
ATPD_SALRD       EIRLHLHEDADLIGGLVVRI--GDRVFDASVRSQLGALHDRLREATLSENALDDGA----
ATPD_GEMAT       TVVPHFAVDPSILGGVVVRV--GDTVMDGSLRRKLGMLRRRMGGTRA-------------
ATPD_CHLT3       KVRVHLATDKQLIGGLTIQI--GDTVLDGSIRHQLAMLKNNLAAGALN------------
ATPD_CHLCH       QVRATLTVNEELIAGAAVKI--ADTIIDGTVRHQLSKLRSSLVAA---------------
ATPD_MOOTA       NIRLSSRVNPELIGGVVIRL--GDRVLDASVKKKLELLGEHLKRA---------------
ATPD_SORC5       KISVTHRQDPSLIAGVVTQI--DDQVIDGSLRTRLSSFRDNLLRT---------------
ATPD_GEOSL       RVELSAQVDSALIGGVVTKI--GDKVFDGSVRTQLNRIQDILQKG---------------
ATPD_PELPD       TIIPQLTVDKAFLGGVVVQI--GDTVYDSSVKTQLKRIQDQLQKG---------------
ATPD_DESDA       ALELTFAVDKDILGGMVLKM--GDRVLDASLRAQLGILRETFKRGE--------------
ATPD_LAWIP       KLELLFQVNPDILGGIVLHI--GDKVFDASLRTQLECIRNTIKKGETNHAY---------
ATPD_DESAL       EVVLTVSQDPALIGGIVTKI--GDLVLDGSIRTQLLNLKETLKRSEAV------------
ATPD_DESPS       KVELTTSVDPSIIGGIVAKV--GDLVLDGSIKTQLAGLKESIKGRE--------------
ATPD_SYNFM       KIVVEFQKDPSLIGGVLAQI--GDFVLDGSVKRQLLNFKETLKRGALG------------
ATPD_SYNAS       QTEIVVEEDRSLLGGIVIRV--GDTLYDGSIKTQLSNIRNLLGEAV--------------
ATPD_MYXXD       NVLLETRVDPSLLGGVSAQV--GSILYDGSIRTQLEEMRRELKQR---------------
ATPD_BDEBA       KIVLTYEQDPKLLGGIVATV--GGWTFDDSIDTHLKKLNEELNRRAN-------------
ATPD1_PELCD      QAVLELAVEPELLGGVRIEV--AGQVLDGTIRSGLRRMAGYLNS----------------
ATPD_SOLUE       QIRMRFAVDEALIGGAVARI--GSTVYDGSVRGQLQTLERRLSTER--------------
ATPD_ACIC5       RVDASFHEDASLLGGVVVQI--GSKVYDGSVRGRFARLEEQLAVR---------------
ATPD_KORVE       SVRARYKTNATLLGGAIIRV--GSTVYDGSIKGQLAKIKEQLSAS---------------
ATPD_PHEZH       DPEITTRVDPALLGGIKVKV--GSRLFDASLRSKLDSLKFALKRA---------------
ATPD_MARMM       EIEVRTEVRPELMGGLIVKV--GSRMFDSSLRSKLDGMKTAMKEA---------------
ATPD_HYPNA       DVELTSEVDPSLIGGIQLRL--GSKLVDASVAKKLERMNTVMKGA---------------
ATPD_GRABC       NVRIEKHVDPSLLGGLVVRI--GTRLYDTSLKSRLQRLQYAMKGAA--------------
ATPD_GLUOX       RVSMTERTDAALLGGMTVRI--GSTLFDTSIAGRLTRLQNAMKGAA--------------
ATPD_RHOCS       KVSVDLRVDPSLIGGMVVKV--GSRMIDSSVRTKLTKLKLAMKGVG--------------
ATPD_METSB       RVEMSVKVDPSIIGGIIVQL--GSRMVDNSLKTKLNSIRARMKEVG--------------
ATPD_PARDP       TVKLNARVDESLIGGMIVKL--GSQMIDSSIRSKLASLQNAMKEVG--------------
ATPD_ZYMMO       DVQINATVDPSILGGMIVRL--GSRQIDGSIRSKLHMLAQAMKG----------------
ATPD_BARBK       KVTLRLSVDPAILGGLIVRL--GLYQIDTSLATQLSSLKLALKKEVS-------------
ATPD_RENSM       -LKVNISVDPTLIGGVRVRV--GDEVVDASVVNRLGELRRQLAG----------------
ATPD_KOCRD       -LKLTTETNPSLVGGLRVQV--GEEIIDGSLTHRLGQLQQRIGA----------------
ATPD_NOCSJ       -VHLNIEVDPSLLGGMRVEI--GDDVIDGTVVSRLDDARRRLAG----------------
ATPD_LEIXX       -LKLNQVVDPSILGGMRVQI--GGDVIDGSVSSRLSKLRLQLAG----------------
ATPD_CORU7       -IAVHTEVDSSLLGGAVVRV--GDEVIDGSTAGKLERMRRSLA-----------------
ATPD_NOCFA       -VTVHVQVDPSLLSGLVVRI--GDDVIDGSAVGRLERLRRELA-----------------
ATPD_THEFY       -IHLNIEITPEIVGGLSIRV--GDEVIDGTIAGRIAEVRRRLAG----------------
ATPD_ACIC1       -VHLHVEVDPRIGGGVVVQL--GDEVIDGSIASILAETRQRLAS----------------
ATPD_FRASN       -IQLQIDLDPAVLGGVAVRV--GDEVVDGTVLRRLAAARRGLTR----------------
ATPD_SACEN       -IALHLEVDPDLGGGLLVRV--GDEIIDGSVAGRLQSLRRDLAD----------------
ATPD_KINRD       -IRVNLDVDPHLVGGLRVSV--GDDVIDGSISTRLDEARRRLAG----------------
ATPD_SALTO       -VTVKQSVNPEVLGGVSVQV--GSDLYDGTVLRRLNESRNALAKR---------------
ATPD_CUTAK       -IELSEVVDPTVLGGALINL--GDEVIDSTVAHRLDQARRELG-----------------
ATPD_CHLAD       -VHVTYHVDPTLIGGLIIRV--GDQVLDNSLRARLSAVQRALQAS---------------
ATPD_ROSS1       -LELRFSVDESLIGGLIIRI--GDQVLDTSLRTRMAAIQRNMMTS---------------
ATPD_LACP7       QFEMNYKVDASILGGLIIRI--GDRVVDSSLKSKLNTLSKNLFKIQLG------------
ATPD_STRS2       VRNITEELDQSLLGGFIVTV--NHKVIDASVRTQLKDIRKKL------------------
ATPD_MYCA5       -VILKNEIDPSLIAGIKIKI--DDYVVENSISGYLNELKKSVIKK---------------
ATPD_AZOPC       QIEFKTILNLDIIGGFILEI--EDLLLDASVKRQLNQIKCQI------------------
ATPD_THERP       -VELRTTVDPELLGGVVLKI--GDEVFDASVRTQLTNLRRQLVGAAA-------------
ATPD_DEHM1       -INVVTATDPGLIAGLKARI--GDKLIDGSVSRRLVLLQNEISQGRI-------------
ATPD_RHOBA       -VRLRESVDTELIGGMVIRV--GDTVFDSSVASRLDKLGKSAAAGFARQLIEQSDRFSSS
ATPD_PROMO       -VNLEVSIDKSIIAGGIIKI--GDEIIDGSVRRQLDTIARS-------------------
ATPD_CALS4       -VNLIPVVDKEILGGLKLVI--GNTVIDGSIKARLEALLKNMRQAV--------------
ATPD_DICNV       -VVLDVREEPALIAGVRIEY--DGMVIDQSARGRLERFARMLDESRN-------------
ATPD_VESOH       -VSIDIVVDKDLVGGVIIKD--GDKVIDISIKARVDELGLRLSKTH--------------
ATPD_MYCAP       -IKLTTFIDKSLIFGFKIVI--GNDIIEQNAKADLEKISSLINNKNGDLNG---------
ATPD_LACLA       EVTVINTVNEKILGGFIVNS--RGKIIDASLKTQLAKIAAEIL-----------------
ATPD_WIGBR       -IKINIKIDKSIIGGYIIKS--KNFLIDNSIKNKLYRFSEYL------------------
ATPD_MAGMM       -VSLEISEKPELLGGLVIRM--GSVMLDDSLRTQLHRLKEIMKG----------------
ATPD_RUBXD       EVILRTSVDPEILGGAVFRF--KDRLVDSSIRGRLEGLREAMLERGVV------------
ATPD_PARUW       -VEIQNVVNPDIVGGMILIM--DHQIFDNSVKKRLAKLKVSLLTAKV-------------
ATPD_MYCPE       -VRYENIIDKSLIGGMKIMF--GNDVYDYSIKGKIDQIKWNIENNKEV------------
ATPD_MYCS5       -VEISTEVDEKLLSGYKIIF--SNQLYERNYNNDLQKIKKTIIKGKEDEK----------
ATPD_MYCPU       -VKLLNLIDKELISGYEIQV--GDFKQRNNVASWIDQMALSIKKGD--------------
ATPD_RICBR       -TKINFEIDPTIMGGIVIKY--DSILQDYSIKGSLDKIAKALQSVNVFDCHPVA------
ATPD_PELUB       -IKLNYKHDASLIGGLIVQV--GSTMVDTSIKNKLQQIENRMIEA---------------
ATPD_THEYD       -VELQYEIDPSLIGGVRVKV--GSTMYDLSIKGQLGLLRDKLIKG---------------
ATPD_BIFA0       -VHIHSVVDPTVMGGMRIQV--GDEVTDNTVVAQLENLKRKVKAGVSE------------
ATPD_CALS8       NPRFKVKVDRSIIGGIKLLF--NNIEVDATIKGALDSIKKELIQNAI-------------
ATPD_UREU1       KIEPIVVVDKSIIGGLSINF--ESQVLDNSLKTKLFNVVKKTN-----------------
ATPD_ORITI       -LIISNIVDKSIVGGIILRY--DDYEYDLSMLGAINRFKSRIKLNY--------------
ATPD_OENOB       HVEVKNVVDPNVIAGVILTA--GSKTIDGSIKNKLVQLNNHIKQAVGKE-----------
ATPD_ELUMP       FINADFKQDKTLISGLKIKT--ADYVIDGSTKNNLQKLKQVLQD----------------
ATPD_HETA2       LVIFTVKEVPGLLGGFRLNFVTDSKVIDFSIAGKIKRLAAVLNY----------------
ATPD2_BRAHW      DIHFTFNIDENIIGGVVIEV--EDVVYDYSVRRLLTELKSSISENN--------------
ATPD1_BRAHW      -ISYETIVDENIIGGIIVYI--GSVVYDYSIKKQIDLLQSKFTYGN--------------
ATPD_CYAM1       HLQCEYQVDAQLLAGLKIQM--NGQLIDTSWQTQLKQLMKSLW-----------------
ATPD_PETMO       -IKLRTQFNEDLIGGLQLYI--GDKFFDYSVKGFLQDIQSAYAPIGGGEIFES-------
ATPD_ACHLI       EIEFNQHIDPTLIEGVKMTYQ--GRSIERSLKKALDDMRTNI------------------
ATPD_TROWT       -IILREVINEKVFGGVRVQV--NHSVIDDTVAVHLNNLALSFGALETFS-----------
ATPD_NEOSM       KINIAQKVNRSILGGLTIKI--NSIMIDLSIAGRLAKCKSIGQSTILEIFQ---------
                                              .                              

ATPD_AMOA5       -
ATPD_CYTH3       -
ATPD_PARD8       -
ATPD_BACV8       -
ATPD_FLAPJ       -
ATPD_GRAFK       -
ATPD_ALKOO       -
ATPD_CLOPD       -
ATPD_CLOK1       -
ATPD_HUNT2       -
ATPD_RUMCH       -
ATPD_MYCGA       -
ATPD_MYCPN       -
ATPD_MYCMS       -
ATPD_MESFL       -
ATPD_MYCH7       -
ATPD_MYCMO       -
ATPD_THEM4       -
ATPD_PSELT       -
ATPD_THENN       -
ATPD_FERNB       -
ATPD_CAMFF       -
ATPD_CAMHC       -
ATPD_ARCB4       -
ATPD_CAMLR       -
ATPD_NITSB       -
ATPD_SULDN       -
ATPD_SULNB       -
ATPD_HELHP       -
ATPD_WOLSU       -
ATPD_PERMH       -
ATPD_SULSY       -
ATPD_AQUAE       -
ATPD_HYDS0       -
ATPD_GALSU       -
ATPD_CYACA       -
ATPD_PYRYE       -
ATPD_GRATL       -
ATPD_CYAPA       -
ATPD_RHDSA       -
ATPD_PHATC       -
ATPD_VAULI       -
ATPD_SYNJA       -
ATPD_TRIEI       -
ATPD_GLOVI       -
ATPD_PROMP       -
ATPD_STRA1       -
ATPD_STRMU       -
ATPD_STRU0       -
ATPD_STRR6       -
ATPD_LEPBP       -
ATPD_LEPIC       -
ATPD_EHRRW       -
ATPD_WOLTR       -
ATPD_ANAMM       -
ATPD_ANAPZ       -
ATPD_ECOLI       -
ATPD_PSYIN       -
ATPD_BLOPB       -
ATPD_BUCAP       -
ATPD_BUCBP       -
ATPD2_PHOPR      -
ATPD2_VIBTL      -
ATPD2_VIBCB      -
ATPD_NEIM0       -
ATPD_PSYWF       -
ATPD_FRAP2       -
ATPD_XYLFT       -
ATPD_COXBN       -
ATPD_THISH       -
ATPD_LEGPH       -
ATPD_NITOC       -
ATPD_PSEU5       -
ATPD_MARMS       -
ATPD_ACIAD       -
ATPD_HYDCU       -
ATPD_CHRSD       -
ATPD_METCA       -
ATPD_AROAE       -
ATPD_DECAR       -
ATPD_LARHH       -
ATPD_METFK       -
ATPD_THIDA       -
ATPD_BORPD       -
ATPD_POLAQ       -
ATPD_ACIFR       -
ATPD_LACJO       -
ATPD_LACDB       -
ATPD_LACPL       -
ATPD_PEDPA       -
ATPD_LACF3       -
ATPD_LACS1       -
ATPD_ENTHA       -
ATPD_LACSS       -
ATPD_LACCB       -
ATPD_LEUMM       -
ATPD_BACP3       -
ATPD_BACP2       -
ATPD_LYSSC       -
ATPD_OCEIH       -
ATPD_BACCN       -
ATPD_BACPE       -
ATPD_BACSK       -
ATPD_LISMO       -
ATPD_EXIS2       -
ATPD_STAEQ       -
ATPD_STACT       -
ATPD_MACCJ       -
ATPD_CARHZ       -
ATPD_NATTJ       -
ATPD_PELTS       -
ATPD_HELMI       -
ATPD_DESAP       -
ATPD_DESHY       -
ATPD_SYMTH       -
ATPD_SYNWW       -
ATPD_BREBN       -
ATPD_HALOH       -
ATPD_SALRD       -
ATPD_GEMAT       -
ATPD_CHLT3       -
ATPD_CHLCH       -
ATPD_MOOTA       -
ATPD_SORC5       -
ATPD_GEOSL       -
ATPD_PELPD       -
ATPD_DESDA       -
ATPD_LAWIP       -
ATPD_DESAL       -
ATPD_DESPS       -
ATPD_SYNFM       -
ATPD_SYNAS       -
ATPD_MYXXD       -
ATPD_BDEBA       -
ATPD1_PELCD      -
ATPD_SOLUE       -
ATPD_ACIC5       -
ATPD_KORVE       -
ATPD_PHEZH       -
ATPD_MARMM       -
ATPD_HYPNA       -
ATPD_GRABC       -
ATPD_GLUOX       -
ATPD_RHOCS       -
ATPD_METSB       -
ATPD_PARDP       -
ATPD_ZYMMO       -
ATPD_BARBK       -
ATPD_RENSM       -
ATPD_KOCRD       -
ATPD_NOCSJ       -
ATPD_LEIXX       -
ATPD_CORU7       -
ATPD_NOCFA       -
ATPD_THEFY       -
ATPD_ACIC1       -
ATPD_FRASN       -
ATPD_SACEN       -
ATPD_KINRD       -
ATPD_SALTO       -
ATPD_CUTAK       -
ATPD_CHLAD       -
ATPD_ROSS1       -
ATPD_LACP7       -
ATPD_STRS2       -
ATPD_MYCA5       -
ATPD_AZOPC       -
ATPD_THERP       -
ATPD_DEHM1       -
ATPD_RHOBA       S
ATPD_PROMO       -
ATPD_CALS4       -
ATPD_DICNV       -
ATPD_VESOH       -
ATPD_MYCAP       -
ATPD_LACLA       -
ATPD_WIGBR       -
ATPD_MAGMM       -
ATPD_RUBXD       -
ATPD_PARUW       -
ATPD_MYCPE       -
ATPD_MYCS5       -
ATPD_MYCPU       -
ATPD_RICBR       -
ATPD_PELUB       -
ATPD_THEYD       -
ATPD_BIFA0       -
ATPD_CALS8       -
ATPD_UREU1       -
ATPD_ORITI       -
ATPD_OENOB       -
ATPD_ELUMP       -
ATPD_HETA2       -
ATPD2_BRAHW      -
ATPD1_BRAHW      -
ATPD_CYAM1       -
ATPD_PETMO       -
ATPD_ACHLI       -
ATPD_TROWT       -
ATPD_NEOSM       -