CLUSTAL format seed alignment for MF_01423

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MDTB_PHOLL      --MQAGSPIP-GGGPSRLFILRPVATTLFMAAILLAGIIGYRMLPVSALPEVDYPTIQVV
MDTB_XENBS      --MHSDSPMT-GGGPSRLFILRPVATTLFMIAILLAGIIGYRMLPVSALPQVDYPTIQVV
MDTB_PECAS      --MQDNVPAS-GGGPSRLFILRPVATTLLMIAILLAGIIGYRALPVSALPEVDYPTIQVI
MDTB_DICP7      --MQESSPIH-GGGPSRLFILRPVATTLLMVAILLAGLVGYRALPVSALPEVDYPTIQVV
MDTB_ECOSM      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOL5      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOUT      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOK1      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO45      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOL6      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO81      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOLC      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOBW      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECODH      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOLI      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOHS      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO24      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_SHIFL      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO57      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO5E      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECOSE      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_SHIBS      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_SHISS      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO7I      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO55      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO27      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYQALPVSALPEVDYPTIQVV
MDTB_ECOLU      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ECO8A      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_SHIB3      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_ESCF3      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_CITK8      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALA4      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALHS      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALSV      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALCH      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALPC      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRLLPVAALPEVDYPTIQVV
MDTB_SALNS      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALTY      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALDC      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALG2      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALEP      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALPA      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALPK      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALTI      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALPB      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAILLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_SALAR      --MQVLPPGS-TGGPSRLFILRPVATTLLMAAMLLAGIIGYRFLPVAALPEVDYPTIQVV
MDTB_ENT38      --MQVLPPSS-TGGPSRLFIMRPVATTLLMVAILIAGIIGYRFLPVSALPEVDYPTIQVI
MDTB_KLEP3      --MQVLPPGR-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRFLPVSALPEVDYPTIQVV
MDTB_KLEP7      --MQVLPPGR-TGGPSRLFIMRPVATTLLMVAILLAGIIGYRFLPVSALPEVDYPTIQVV
MDTB_CROS8      --MQVLPPSA-TGGPSRLFILRPVATTLLMVAILLAGIIGYRFLPVSALPEVDYPTIQVV
MDTB_YERPE      --MQVMPPTP-GGGPSRLFILRPVATTLFMIAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_YERP1      --MQVMPPTP-GGGPSRLFILRPVATTLFMIAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_YERPS      --MQVMPPTP-GGGPSRLFILRPVATTLFMIAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_SERP5      --MQVMPPNP-GGGPSRLFILRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVV
MDTB_EDWTE      MSQTPSSPVPRGGGPSRLFILRPVATTLLMIAILLAGLVAYRALPVSALPQVDYPTIQVV
                       *    ********:*******:* *:*:**::.*: ***:***:********:

MDTB_PHOLL      TLYPGASPDVMTSAVTAPLERQLGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_XENBS      TLYPGASPDIMTSVVTAPLERQFGKISGLKQMTSQSSGGASVITLVFQLSLPLDVAEQDV
MDTB_PECAS      TLYPGASPDVVTSAITAPLERQFGQMSGLKQMSTQSAGGASVITLQFQLELSLDVAEQDV
MDTB_DICP7      TLYPGASPDVMTSSVTAPLEHQFGSMSGLKQMSSQSSAGASVITLQFQLTLSLDVAEQDV
MDTB_ECOSM      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOL5      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOUT      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOK1      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO45      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOL6      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO81      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOLC      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOBW      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECODH      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOLI      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOHS      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO24      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_SHIFL      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLNVAEQEV
MDTB_ECO57      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO5E      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOSE      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_SHIBS      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_SHISS      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO7I      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO55      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO27      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECOLU      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ECO8A      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_SHIB3      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_ESCF3      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_CITK8      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALA4      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALHS      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALSV      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALCH      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALPC      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALNS      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALTY      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALDC      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALG2      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALEP      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALPA      TLYPGASPDVMTSSVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALPK      TLYPGASPDVMTSSVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALTI      TLYPGASPDVMTSSVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALPB      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_SALAR      TLYPGASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_ENT38      TLYPGASPDVVTSAITAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_KLEP3      TLYPGASPDVVTSAITAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_KLEP7      TLYPGASPDVVTSAITAPLERQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEV
MDTB_CROS8      TLYPGASPDVVTSAITAPLERQFGQMSGLKQMASQSAGGASVVTLQFQLTLPLDVAEQEV
MDTB_YERPE      TLYPGASPDVVTSSITAPLERQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_YERP1      TLYPGASPDVVTSSITAPLERQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_YERPS      TLYPGASPDVVTSSITAPLERQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEV
MDTB_SERP5      TLYPGASPDVVTSAITAPLERQFGQMSGLKQMASQSSGGASVVTLQFQLELPLDVAEQEV
MDTB_EDWTE      TLYPGASPDVTASAITAPLERQFGQMSGLQQMSSQSSGGASVITLQFQLSLALDVAEQEV
                *********: :* :*****:*:*.:***:**::**:.****:** *** *.*:****:*

MDTB_PHOLL      QAAINAASNLLPNDLPYPPIYSKVNPADPPILMLAVTSDAMPMTQIQDMVETRIAQKISQ
MDTB_XENBS      QAAINAATNLLPNDLPYPPIYSKVNPADPPILTLAVTSDALPMIQVQDMVETRIAQRISQ
MDTB_PECAS      QAAINAASNLLPNDLPYPPTYSKVNPADPPIMTLAVTSSAMSMTQVQDMVDNRIAQKISQ
MDTB_DICP7      QAAINAATNLLPTDLPFPPTYNKVNPADPPIMTLAVTSTAMPMTQVQDMLETRIAQKISQ
MDTB_ECOSM      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOL5      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOUT      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOK1      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO45      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOL6      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO81      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOLC      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOBW      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECODH      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOLI      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOHS      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSIAMPMTQVEDMVETRVAQKISQ
MDTB_ECO24      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_SHIFL      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO57      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO5E      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOSE      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_SHIBS      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_SHISS      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO7I      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO55      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO27      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECOLU      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ECO8A      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_SHIB3      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_ESCF3      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_CITK8      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQ
MDTB_SALA4      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALHS      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALSV      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALCH      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALPC      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALNS      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALTY      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNSMPMTQVEDMVETRVAQKISQ
MDTB_SALDC      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALG2      QAAINADTNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALEP      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALPA      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALPK      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALTI      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALPB      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAMPMTQVEDMVETRVAQKISQ
MDTB_SALAR      QAAINAATNLLPSDLPNPPIYSKVNPADPPIMTLAVTSNAVPMTQVEGMVETRVAQKISQ
MDTB_ENT38      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSSAMPMTQVEDMVETRVAQKISQ
MDTB_KLEP3      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSSAIPMTQVEDMVETRVAQKISQ
MDTB_KLEP7      QAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTSSAIPMTQVEDMVETRVAQKISQ
MDTB_CROS8      QAAINAATNLLPDDLPNPPVYSKVNPADPPIMTLAVTSSALPMTQVEDMVETRVAQRISQ
MDTB_YERPE      QAAINAATNLLPSDLPYPPIYNKVNPADPPILTLAVTATAIPMTQVEDMVETRIAQKISQ
MDTB_YERP1      QAAINAATNLLPSDLPYPPIYNKVNPADPPILTLAVTATAIPMTQVEDMVETRIAQKISQ
MDTB_YERPS      QAAINAATNLLPSDLPYPPIYNKVNPADPPILTLAVTATAIPMTQVEDMVETRIAQKISQ
MDTB_SERP5      QAAINSATNLLPSDLPYPPIYSKVNPADPPILTLAVTSSAMPMTQVEDMVETRVAQKISQ
MDTB_EDWTE      QAAINAATNLLPNDLPYPPIYSKVNPADPPILTLAVVSDALSLPQVEDLVETRISQKIAQ
                *****: :**** *** ** *.*********: ***.: ::.: *::.:::.*::*:*:*

MDTB_PHOLL      VNGVGLVTLAGGQRPAVRVKLNAQAVAAQGLDSETIRTAINNANVNSAKGSLDGPTRSVT
MDTB_XENBS      VGGVGLVTLAGGQRPAVRVKFNAQAIAAHGLNSETIRTTIMNANVSSAKGSFDGPTRSVT
MDTB_PECAS      VAGVGLVSLAGGQRPAVRVRLNAPALAAYGLTSETIRTAITAANVNSAKGSLDGPTRSVT
MDTB_DICP7      VEGVGLVTLAGGQRPSVRVKLNAGALASFGLSSESVRTAITAANVNTPKGSFDGPTRSVT
MDTB_ECOSM      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOL5      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSESVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOUT      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOK1      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO45      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOL6      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO81      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOLC      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOBW      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECODH      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOLI      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOHS      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO24      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_SHIFL      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO57      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO5E      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOSE      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_SHIBS      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_SHISS      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO7I      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO55      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO27      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECOLU      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ECO8A      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_SHIB3      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_ESCF3      ISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVT
MDTB_CITK8      VSGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRAAITSANVNSAKGSLDGPTRAVT
MDTB_SALA4      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALHS      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALSV      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALCH      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALPC      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALNS      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETIRTAITGANVNSAKGSLDGPERAVT
MDTB_SALTY      VSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALDC      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALG2      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALEP      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALPA      VSGVGLVTLAGGQRPAIRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALPK      VSGVGLVTLAGGQRPAIRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALTI      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALPB      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPERAVT
MDTB_SALAR      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETIRTAITGANVNSAKGSLDGPERAVT
MDTB_ENT38      VSGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETIRTAIVSANVNSAKGSLDGPTRAVT
MDTB_KLEP3      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITSANVNSAKGSLDGPARAVT
MDTB_KLEP7      VSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITSANVNSAKGSLDGPARAVT
MDTB_CROS8      VTGVGLVTLSGGQRPAVRVKLNAQALASLGIDSETVRTAITSANVNSAKGSFDGPERAVT
MDTB_YERPE      VTGVGLVTLSGGQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGPTRSVT
MDTB_YERP1      VTGVGLVTLSGGQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGPTRSVT
MDTB_YERPS      VTGVGLVTLSGGQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGPTRSVT
MDTB_SERP5      VTGVGLVTISGGQRPAVRVKLNAAAVAAYGLDSETIRTAISNANVNSAKGSLDGPTRSVT
MDTB_EDWTE      VGGVGLVTLAGGQRPAVRVRLNGAAAAAYGLSSETIRSAIANANVNSPKGSLDGPTRAIT
                : *****:::*****::**::*. * *: *: **::*::*  ***.:.***:*** *::*

MDTB_PHOLL      LSANDQMKSVNDYRNLIIAYKNGSPVRLQDVATIEQGAENTKLGAWSNNTQAIVINVQRQ
MDTB_XENBS      LTTNDQMKSIDEYRNLIVAYKNGAPIRLRDVATIERGAENTKLGAWANEKPAIVINVQRQ
MDTB_PECAS      LSANDQMKSVDDYRKLIVAWKNGAPVRLQDVATIEQAAENIYLGAWANRQQAIIINVQRQ
MDTB_DICP7      LSANDQIRSVDDYRQLIITWKNNAPVRLQDVATVEQAPENTKLAAWANQNQAIILNIQRQ
MDTB_ECOSM      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOL5      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOUT      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOK1      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO45      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOL6      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO81      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOLC      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOBW      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECODH      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOLI      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOHS      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO24      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_SHIFL      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO57      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO5E      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOSE      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_SHIBS      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_SHISS      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO7I      LSANDQMQSAEEYRQLIIAYQNSAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO55      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO27      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECOLU      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ECO8A      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_SHIB3      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_ESCF3      LSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_CITK8      LSANDQMQSVDEYRQLIIAWQNGAPVRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQ
MDTB_SALA4      LSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALHS      LSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALSV      LSANDQMQSADDYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPANVMNVQRQ
MDTB_SALCH      LSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALPC      LSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALNS      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALTY      LSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALDC      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALG2      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALEP      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALPA      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALPK      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALTI      LSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALPB      LSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQ
MDTB_SALAR      LSANDQMQSADEYRRLIIAYKNGAPVRLGDVATVEQGAENSWLGAWANKAPAIVMNVQRQ
MDTB_ENT38      LSANDQMQSADEYRQLIVAYQNGAPIRLGDVATVEQGAENRWLGAWANKEQAIVMNVQRQ
MDTB_KLEP3      LSANDQMQSAEDYRRLIIAYQNGAPIRLGDVASVEQGAENSWLGAWANQQRAIVMNVQRQ
MDTB_KLEP7      LSANDQMQSAEDYRRLIIAYQNGAPIRLGDVASVEQGAENSWLGAWANQQRAIVMNVQRQ
MDTB_CROS8      LSANDQMKSADEYRNLIIAYKNGAPVRLGDVATVEQGAENAWLGAWANKQPAIVMNVQRQ
MDTB_YERPE      LSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNIQRQ
MDTB_YERP1      LSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNIQRQ
MDTB_YERPS      LSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNIQRQ
MDTB_SERP5      LSANDQMKSADDYRQLIVAYQNGAAIRLQDIATIEQGAENTRLAAWANKQPAIVLNIQRQ
MDTB_EDWTE      LNANDQLRSAQEYQNLIVAYRSGAPVYLRDIASVEQGAENTQLAAWANNHPAIVINVQRQ
                *.:***::* ::*: **::::..:.: * *:*::*:..**  *.**:*   * ::*:***

MDTB_PHOLL      PGANVIETTDNIRQMLPELISSLPKSVDMKILTDRTTTIRASVKDVQFELLLAIALVVMV
MDTB_XENBS      PGANVIDTTDNIRAMLPELINSLPKSVNMDILTDRTVTIRASVQDVQFELLLAIALVVMV
MDTB_PECAS      PGANVITTTDSINKMLPALKASLPNSVEVATLTDRTTSIRASVKDVQFELLLAIALVVMV
MDTB_DICP7      PGANVIATADHIRNLLPTLQASLPKSVNVTLLADRTTTIRASVDDVQFELLLAIALVVMV
MDTB_ECOSM      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOL5      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOUT      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOK1      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO45      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOL6      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO81      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOLC      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOBW      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECODH      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOLI      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOHS      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO24      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_SHIFL      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO57      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO5E      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAITLVVMI
MDTB_ECOSE      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_SHIBS      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_SHISS      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO7I      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO55      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECO27      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMI
MDTB_ECOLU      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMAIALVVMI
MDTB_ECO8A      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMAIALVVMI
MDTB_SHIB3      PGANIISTADSIRQMLPQLTESLPKSVEVTVLSDRTTNIRASVDDTQCELMMAIALVVMI
MDTB_ESCF3      PGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMAIALVVMI
MDTB_CITK8      PGANIISTADSIRQMLPQLTESLPKSVNVTVLSDRTTNIRASVTDTQFELMLAIALVVMI
MDTB_SALA4      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALHS      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALSV      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALCH      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALPC      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRTSVRDTQFELMLAIALVVMI
MDTB_SALNS      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALTY      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALDC      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALG2      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALEP      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALPA      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALPK      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALTI      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALPB      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_SALAR      PGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_ENT38      PGANIIDTADSIRAMLPQLIESLPKSVNVKVLSDRTTNIRASVSDTQFELMLAMALVVMI
MDTB_KLEP3      PGANIIDTADSIRQMLPQLTESLPKSVKVQVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_KLEP7      PGANIIDTADSIRQMLPQLTESLPKSVKVQVLSDRTTNIRASVRDTQFELMLAIALVVMI
MDTB_CROS8      PGANIITTAETIQKLLPQLTESLPKSVQVKVLTDRTTNISASVNDTQFELMLAIALVVMI
MDTB_YERPE      PGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFELLLAIALVVMV
MDTB_YERP1      PGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFELLLAIALVVMV
MDTB_YERPS      PGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFELLLAIALVVMV
MDTB_SERP5      PGVNVITTADSIREMLPQLIKSLPKSVDVKVLTDRTTTIRASVSDVQFELLLAVALVVMV
MDTB_EDWTE      PGANVIATADAVLAQLPQLRESLPASVKISVLNDRTQTIRASVSDVRHELLLAVALVVMV
                **.*:* *:: :   ** *  *** **.:  * *** .* :** *.: **::*::****:

MDTB_PHOLL      IYLFLRNGIATLIPSIAVPLSLIGTFAVMYFCGFSVNNLTLMALTIATGFVVDDAIVVIE
MDTB_XENBS      IYVFLRNATATLIPSIAVPLSLVGTFAVMYFCGFSVNNLTLMALTIAAGFVVDDAIVVIE
MDTB_PECAS      IYLFLRNAVATLIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_DICP7      IYLFLRNAVATLIPSIAVPLSLVGTFAAMYFLGFSVNNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOSM      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOL5      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOUT      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOK1      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO45      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOL6      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO81      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOLC      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOBW      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECODH      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOLI      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOHS      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO24      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SHIFL      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO57      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO5E      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOSE      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SHIBS      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SHISS      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO7I      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO55      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO27      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECOLU      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ECO8A      IYLFLRNIPATIIPGFAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SHIB3      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ESCF3      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_CITK8      IYLFLRNVPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALA4      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALHS      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALSV      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALCH      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALPC      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALNS      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALTY      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALDC      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALG2      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALEP      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALPA      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALPK      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALTI      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALPB      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SALAR      IYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_ENT38      IYVFLRNVPATIIPAVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_KLEP3      IYLFLRNVPATIIPGVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_KLEP7      IYLFLRNVPATIIPGVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_CROS8      IYLFLRNIPATIIPAVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_YERPE      IYLFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_YERP1      IYLFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_YERPS      IYLFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_SERP5      IYVFLRNVPATIIPSVAVPLSLIGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIE
MDTB_EDWTE      IYLFLRNLPATLIPGVAVPLSLIGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIE
                **:****  **:**..******:****.* * .**:***********:************

MDTB_PHOLL      NISRYIEQGEKPMTAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_XENBS      NISRYIERGEKPMAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_PECAS      NIARYIEKGEKPLNAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_DICP7      NIARYIEKGEKPLDAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIIGRLFREFAVTLA
MDTB_ECOSM      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOL5      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOUT      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOK1      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO45      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOL6      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO81      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOLC      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOBW      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECODH      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOLI      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOHS      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO24      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_SHIFL      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO57      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO5E      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOSE      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_SHIBS      NISRYIEKGEKPLAAALKGAGEIGFTIISLIFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_SHISS      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO7I      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO55      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO27      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECOLU      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ECO8A      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_SHIB3      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_ESCF3      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLA
MDTB_CITK8      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALA4      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALHS      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALSV      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALCH      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALPC      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALNS      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALTY      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALDC      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALG2      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALEP      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALPA      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALPK      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALTI      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALPB      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_SALAR      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_ENT38      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_KLEP3      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_KLEP7      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_CROS8      NISRYIEKGEKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_YERPE      NISRYIEKGEKPLDAALKGAGEIGFTIISLTFSLIAVLIPLLFMEDIVGRLFREFAVTLA
MDTB_YERP1      NISRYIEKGEKPLDAALKGAGEIGFTIISLTFSLIAVLIPLLFMEDIVGRLFREFAVTLA
MDTB_YERPS      NISRYIEKGEKPLDAALKGAGEIGFTIISLTFSLIAVLIPLLFMEDIVGRLFREFAVTLA
MDTB_SERP5      NISRYIEKGEKPLDAALKGAGEIGFTIISLTFSLVAVLIPLLFMGDIVGRLFREFAVTLA
MDTB_EDWTE      NIERHLENGDPPLRAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIIGRLFREFAVTLA
                ** *::*.*: *: **************** ***:********* **:********:***

MDTB_PHOLL      VAILISAVVSLTLTPMMCARILKPESQIKHNRFEQASGRFFEQMIAGYAVWLKRALNHPW
MDTB_XENBS      VAILISAVVSLTLTPMMCARMLKAEAEIKHNRFEQASEHFFERIIAIYGGWLKRVLNHPW
MDTB_PECAS      VSILISAVVSLTLTPMMCARMLSHQSLRKQNRFTRASERFFTRLIDTYGTWLRKVLNHPW
MDTB_DICP7      VSILISAIVSLTLTPMMCARLLNHEALAHQNRFTRASERFFDWVIAAYGRGLTRVLSHPW
MDTB_ECOSM      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOL5      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOUT      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOK1      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO45      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOL6      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO81      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOLC      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOBW      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECODH      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOLI      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOHS      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO24      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_SHIFL      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO57      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO5E      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECOSE      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_SHIBS      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_SHISS      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO7I      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ECO55      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGQGLAKVLNHPW
MDTB_ECO27      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFERIIAAYGQGLAKVLNHPW
MDTB_ECOLU      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFERIIAAYGRGLAKVLNHPW
MDTB_ECO8A      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_SHIB3      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_ESCF3      VAILISAVVSLTLTPMMCARMLSQESLRKQNRFSRASEKMFDRIIAAYGRGLAKVLNHPW
MDTB_CITK8      VAILISAVVSLTLTPMMCARMLSQASLRKQNRFSRAAEKMFDRVIEKYGQWLAKVLNHPW
MDTB_SALA4      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALHS      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALSV      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALCH      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALPC      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALNS      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALTY      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALDC      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALG2      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALEP      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALPA      VAILISAVVSLTLTPMMCACMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALPK      VAILISAVVSLTLTPMMCACMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALTI      VAILISAVVSLTLTPMMCARMLSRQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALPB      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERMFDRVIASYGRGLAKVLNHPW
MDTB_SALAR      VAILISAVVSLTLTPMMCARMLSQQSLRKQNRFSRACERLFDRVIASYGRGLAKVLNHPW
MDTB_ENT38      VAILISAVVSLTLTPMMCARMLSAESLRKQNRFSRASERMFERIIAAYGRMLEKVLNHPW
MDTB_KLEP3      VAILISAVVSLTLTPMMCARMLSHESLRKQNRFSRASERFFERVIAVYGRWLSRVLNHPW
MDTB_KLEP7      VAILISAVVSLTLTPMMCARMLSHESLRKQNRFSRASERFFERVIAVYGRWLSRVLNHPW
MDTB_CROS8      VAILISAVVSLTLTPMMCARMLSHESLRKQNRFSRASERVINRVIARYGQLLKRVLNHPW
MDTB_YERPE      VAILISAVVSLTLTPMMCARMLSYESLRKQNRLSRASEKFFDWVIAHYAVALKKVLNHPW
MDTB_YERP1      VAILISAVVSLTLTPMMCARMLSYESLRKQNRLSRASEKFFDWVIAHYAVALKKVLNHPW
MDTB_YERPS      VAILISAVVSLTLTPMMCARMLSYESLRKQNRLSRASEKFFDWVIAHYAVALKKVLNHPW
MDTB_SERP5      VAILISAVVSLTLTPMMCARMLSHESLRKQNRFSAASERFFDRVIARYGKWLKTVLNHPW
MDTB_EDWTE      VAILISAVVSLTLTPMMCARLLSQESLRRQNRFSLACERQFQRLIAGYGRALRLALRHPR
                *:*****:*********** :*.  :  ::**:  *. : :  :*  *.  *  .* ** 

MDTB_PHOLL      ITFGIALSTLALTALLYLMIPKGFFPSQDNGLIQGTLEAPQSISFTAMVNKQQQVSSLLL
MDTB_XENBS      ITLGVAFSTLAFTALLYLTIPKGFFPLQDNGLIQGTLEAPQSISFNAMSDKQREVTALLL
MDTB_PECAS      LTLSVALGTLLLTILLYIWIPKGFFPIQDNGIIQGTVQAPQTVSFSNMADRQQRVASIIM
MDTB_DICP7      ITLSVAIGTLVLTVLLYIVIPKGFFPIQDNGIIQGTVQAAQTISFNSMVDKQHQVTDAIL
MDTB_ECOSM      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOL5      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOUT      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOK1      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECO45      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOL6      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECO81      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOLC      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOBW      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECODH      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOLI      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOHS      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECO24      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_SHIFL      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECO57      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECO5E      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOSE      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_SHIBS      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_SHISS      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFTNMAQRQRQVADVIL
MDTB_ECO7I      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFTNMAQRQRQVADVIL
MDTB_ECO55      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECO27      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ECOLU      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFTNMAQRQRQVADVIL
MDTB_ECO8A      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_SHIB3      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_ESCF3      LTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVADVIL
MDTB_CITK8      LTLSVALGTLLLSIMLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFASMAQRQRQVSDVIL
MDTB_SALA4      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALHS      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALSV      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALCH      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALPC      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALNS      LTLSVAFATLLLSIMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALTY      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALDC      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALG2      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALEP      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALPA      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALPK      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALTI      LTLSVAFATLLLSVMLWITIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALPB      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQRQVAERIL
MDTB_SALAR      LTLSVAFATLLLSVMLWIVIPKGFFPVQDNGIIQGTLQAPQSSSYASMAQRQHQVAERIL
MDTB_ENT38      ATLSVALGTLALSVMLWIVIPKGFFPIQDNGIIQGTLQAPQSVSFASMAQRQQAVSDVIM
MDTB_KLEP3      LTLGVALSTLALSIILWVFIPKGFFPIQDNGIIQGTLQAPQSVSFASMAERQRQVASIIL
MDTB_KLEP7      LTLGVALSTLALSIILWVFIPKGFFPIQDNGIIQGTLQAPQSVSFASMAERQRQVASIIL
MDTB_CROS8      LTLGVALGTLALTVLLWIFIPKGFFPVQDNGIIQGTLQAPQSVSFASMAERQRAVADVIL
MDTB_YERPE      LTLSVAFSTLVLTVILYLLIPKGFFPLQDNGLIQGTLEAPQSVSFSNMAERQQQVAAIIL
MDTB_YERP1      LTLSVAFSTLVLTVILYLLIPKGFFPLQDNGLIQGTLEAPQSVSFSNMAERQQQVAAIIL
MDTB_YERPS      LTLSVAFSTLVLTVILYLLIPKGFFPLQDNGLIQGTLEAPQSVSFSNMAERQQQVAAIIL
MDTB_SERP5      LTLGVAFSTLLLTVLLYLLIPKGFFPVQDNGIIQGTLEAPQSVSFSNMAERQQQVAAEIL
MDTB_EDWTE      ITLGVAVATLMLTVLLYLIIPKGFFPQQDNSLIQGTVYAPQSISFSAMAERQRQLSEALL
                 *:.:*..** :: :*:: ******* ***.:****: *.*: *:  * ::*: ::  ::

MDTB_PHOLL      QDPAVENITTFVGVDGSNPTLNNGRLQITLKPLNQRDDRIVDIIPRLQEKVAAIPGIKLY
MDTB_XENBS      QDPDVENVTTFIGVDGSNSTLNSGRLQITLKPLNQRDIRVDEIIPRLQARVANVPDVKLY
MDTB_PECAS      KDPTVESVSSFIGVDGTNAALNSGRLQINLKPLSERSERIPEIISRLQQQTAQIPGIQLY
MDTB_DICP7      KDPTVESVSSFIGVDGTNPSLNSGRLQINLKPFSERSERVQTIIDRLQQQAAAIPGVQLY
MDTB_ECOSM      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOL5      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOUT      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOK1      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO45      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOL6      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO81      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOLC      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOBW      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECODH      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOLI      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOHS      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO24      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_SHIFL      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO57      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO5E      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOSE      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_SHIBS      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_SHISS      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO7I      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO55      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLEERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO27      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECOLU      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ECO8A      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_SHIB3      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_ESCF3      QDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDKVPGVDLF
MDTB_CITK8      KDPAVESLTAFVGVDGTNPALNSARLQINLKPLNERDDRVQKVIARLQHAVAKVPGVDLY
MDTB_SALA4      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALHS      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALSV      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALCH      QDPAVQSLTTFVGVDGANSTLNSTRLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALPC      QDPAVQSLTTFVGVDGANSTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALNS      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALTY      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVELY
MDTB_SALDC      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALG2      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALEP      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALPA      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPVVALY
MDTB_SALPK      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPVVALY
MDTB_SALTI      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALPB      QDPAVQSLTTFVGVDGANPTLNSARLQINLKPLDARDDRVQQVISRLQTAVATIPGVALY
MDTB_SALAR      QDPAVQSLTTFVGVDGANPTLNSARLQINLKSLDERDDRVQQVISRLQTAVATIPGVALY
MDTB_ENT38      KDPAVESLTSFVGVDGTNPSLNSARLQINLKPLDDRDDRVNTVIERLQSAVAKVPGVELY
MDTB_KLEP3      KDPAVESLTSFVGVDGTNPALNSARLQINLKPLDERDDRVQTVISRLQQAVDGVPGVALY
MDTB_KLEP7      KDPAVESLTSFVGVDGTNPALNSARLQINLKPLDERDDRVQTVISRLQQAVDGVPGVALY
MDTB_CROS8      KDPAVESLTSFVGVDGTNPSLNSARLQINLKPLDDRDDRVQTVIARLQEAASRVPGATLY
MDTB_YERPE      KDPAVESLTSFVGVDGTNATLNNGRLQINLKPLSERDDRIPQIITRLQESVSGVPGIKLY
MDTB_YERP1      KDPAVESLTSFVGVDGTNATLNNGRLQINLKPLSERDDRIPQIITRLQESVSGVPGIKLY
MDTB_YERPS      KDPAVESLTSFVGVDGTNATLNNGRLQINLKPLSERDDRIPQIITRLQESVSGVPGIKLY
MDTB_SERP5      KDPAVESLTSFVGVDGTNATLNSGRLQINLKPLSERSERIPAIITRLQQMSTQFPGVKLY
MDTB_EDWTE      RDPDVASVSAFVGVDGVNPALNSGRLQIVLKPLADRRDRIDRIIPRLQALAARVGGISLY
                :** * .:::*:**** *.:**. **** **.:  *  *:  :* ***     .    *:

MDTB_PHOLL      LQPMQDLTIDTQVTRTQYQFTLQATSLDELSIWVPKLLAELKQRAELVDISSDWQDQGLI
MDTB_XENBS      LQPTQDLTIDTQVARTQYQFTLQGTVSNDLNIWVPKLQEALKQRPELVDVGTDWQNRGLV
MDTB_PECAS      LQPVQDLTIDTQISRTQYQFTLQAMSLDELSVWVPKLMTELKKLPQLEDVSSDWQDGAAV
MDTB_DICP7      LQPVQDLTIDTQVSRTQYQFTLQTMSLDELGVWVPKLTAELQKLPQLQDVSSDWQDGAAV
MDTB_ECOSM      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOL5      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOUT      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOK1      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO45      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOL6      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO81      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOLC      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOBW      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECODH      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOLI      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOHS      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO24      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_SHIFL      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO57      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQISDVSSDWQDKGLV
MDTB_ECO5E      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQISDVSSDWQDKGLV
MDTB_ECOSE      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_SHIBS      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_SHISS      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDQGLV
MDTB_ECO7I      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLVEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO55      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO27      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECOLU      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ECO8A      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPELMEKLQQLPQLSDVSSDWQDKGLV
MDTB_SHIB3      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_ESCF3      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLVEKLQQLPQLSDVSSDWQDQGLV
MDTB_CITK8      LQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSDWQDKGLV
MDTB_SALA4      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALHS      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALSV      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALCH      LQPTQDLTIDTQVSRTQYQFSLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALPC      LQPTQDLTIDTQVSRTQYQFSLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALNS      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALTY      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALDC      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALG2      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALEP      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALPA      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALPK      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALTI      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALPB      LQPTQDLTIDTQVSRTQYQFTLQATTLDALSHWVPKLQNALQSLPQLSEVSSDWQDRGLA
MDTB_SALAR      LQPTQDLTIDTQVSRTQYQFTLRATTLDALSHWAPKLLNALQSLPQLSEVSSDWQDRGLA
MDTB_ENT38      LQPTQDLTIDTTVSRTQYQFTLQATSLEALSTWVPQLVTKLQELPQLSDVSSDWQDKGLA
MDTB_KLEP3      LQPTQDLTIDTTVSRTQYQFTLQANSLEALSTWVPPLLSRLQAQPQLADVSSDWQDKGLA
MDTB_KLEP7      LQPTQDLTIDTTVSRTQYQFTLQANSLEALSTWVPPLLSRLQAQPQLADVSSDWQDKGLA
MDTB_CROS8      LQPIQDLTIDTQVSRTQYQFTLQANSLEALSTWVPKLIARLQTLPQLADVSSDWQDNGLV
MDTB_YERPE      LQPVQDLTIDTQLSRTQYQFTLQATSLEELSTWVPKLVNELQQKAPFQDVTSDWQDQGLV
MDTB_YERP1      LQPVQDLTIDTQLSRTQYQFTLQATSLEELSTWVPKLVNELQQKAPFQDVTSDWQDQGLV
MDTB_YERPS      LQPVQDLTIDTQLSRTQYQFTLQATSLEELSTWVPKLVNELQQKAPFQDVTSDWQDQGLV
MDTB_SERP5      LQPVQDLTIDTQVSRTQYQFTLQAMSLDDLSLWVPKLMAELQQTPQLADVTSNWQDQGLV
MDTB_EDWTE      LQPVQDMTIDTLPGRARYPFTLQAMSLDELQTWVPRLQARLAQSPMLKDVNSDWQDQGLV
                *** **:****   *::* *:*:    : *  *.* *   *   . : :: ::**: .  

MDTB_PHOLL      AYVKVDRDIASRLGISMAAIDNALYNAFGQRLISTIYTQANQYRIILEHDVTSTPGLAAF
MDTB_XENBS      AYINVNRDMASRLGISMTAIDNALYNAFGQRLISTIYTQANQYRVILEQDTQNEAGMNAF
MDTB_PECAS      AYVNVDRDSASRLGITMSQVDSALYNAFGQRLVSTIYTQASQYRVVLEHDTTNNTGLDAL
MDTB_DICP7      AYVKVDRDNASRLGITMSQIDSALYNAFGQRLISTIYTQSNQYRVVLEQHSPNKTGLDPL
MDTB_ECOSM      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOL5      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOUT      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOK1      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO45      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOL6      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO81      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOLC      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOBW      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECODH      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOLI      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOHS      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO24      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_SHIFL      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO57      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO5E      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOSE      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTEITPGLAAL
MDTB_SHIBS      AYVNVDRDSASRLGISMADVDNALYSAFGQRLISTIYTQANQYRVVLEHNTEITPGLAAL
MDTB_SHISS      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTEITPGLAAL
MDTB_ECO7I      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO55      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO27      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECOLU      AYVNVDRDSASRLGINMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ECO8A      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_SHIB3      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_ESCF3      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTENTPGLAAL
MDTB_CITK8      AYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTDTTPGLAAM
MDTB_SALA4      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALHS      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALSV      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALCH      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALPC      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALNS      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALTY      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASMPGLAAL
MDTB_SALDC      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALG2      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALEP      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALPA      AWVNVDRDSASRLGISIADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALPK      AWVNVDRDSASRLGISIADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALTI      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALPB      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTASTPGLAAL
MDTB_SALAR      AWVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTANKPGLAAL
MDTB_ENT38      AYVNVNRDTASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTEQTPGLTAL
MDTB_KLEP3      AYIKVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEQDTEATPGLAAL
MDTB_KLEP7      AYIKVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEQDTEATPGLAAL
MDTB_CROS8      AYVNVDRASASRLGISMSDVDNALYNAFGQRLISTIYTQANQYRVVLEHNTTATPGLAAL
MDTB_YERPE      AFVNVDRDSASRLGITMAAIDNALYNAFGQRLISTIYTQSNQYRVVLEHDVQATPGLAAF
MDTB_YERP1      AFVNVDRDSASRLGITMAAIDNALYNAFGQRLISTIYTQSNQYRVVLEHDVQATPGLAAF
MDTB_YERPS      AFVNVDRDSASRLGITMAAIDNALYNAFGQRLISTIYTQSNQYRVVLEHDVQATPGLAAF
MDTB_SERP5      AYVNVDRDSASRLGISMSDVDNALYNAFGQRLISTIYTQANQYRVVLEHDVSTTPGLAAL
MDTB_EDWTE      AYVNVNRDSASRLGIAMQDVDNALYNAFGQRLISTIYTQSNQYRVVLEQERAHQDGLTAL
                *:::*:*  ****** :  :*.***.******:******:.***::**:.     *: .:

MDTB_PHOLL      DNIRLNGTDGHVVPLRTIATIEQKFGPLAINHLAQFPSATFSFNVAEDASLEQAVNAVRD
MDTB_XENBS      NNVHLIGTDNKVVPLSTIATVEQQLGYLSINHLQQFPAVTFSFNVAQEASLEAAVNAVKE
MDTB_PECAS      NDVRLISSDGGTIPLSSIATIEERQGPLAINHIDQFPSTTISFNVASGYALGEAVDAITQ
MDTB_DICP7      HDIRLVNSTGGVVPLDSIATIEERNGTLAVNHIDQFPSSTISFNVAPGYALGDAVKAIET
MDTB_ECOSM      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOL5      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOUT      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOK1      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO45      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOL6      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO81      DTIRLTSSDGGVVPLSSIAKIEPRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOLC      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOBW      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECODH      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOLI      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOHS      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO24      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_SHIFL      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGHAVQAIMD
MDTB_ECO57      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO5E      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOSE      DTIRLTSSDGGVVPLSSIAKVEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_SHIBS      DTIRLTSSDGGVVPLSSIAKVEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_SHISS      DTIRLTSSDGGVVPLSSIAKVEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQEIMD
MDTB_ECO7I      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO55      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO27      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECOLU      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ECO8A      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_SHIB3      GTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGDAVQAIMD
MDTB_ESCF3      DTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNMPDNYSLGDAVQAIMD
MDTB_CITK8      DTIRLTSSDGGIVPLSAIAKIEQRFAPLSINHLDQFPVTTFSFNVPDNYSLGDAVQAILD
MDTB_SALA4      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALHS      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALSV      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALCH      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPITTFSFNVPEGYSLDDAVQAILD
MDTB_SALPC      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALNS      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALTY      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPESYSLGDAVQAILD
MDTB_SALDC      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALG2      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALEP      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALPA      ETIRLTSRDGGTVSLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALPK      ETIRLTSRDGGTVSLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALTI      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALPB      ETIRLTSRDGGTVPLSAIARIEQRFAPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILD
MDTB_SALAR      ETIRLTGNDGGTIPLSAIASIKQRFTPLSINHLDQFPVTTFSFNVPEGYSLGDAVQAILN
MDTB_ENT38      DTVRLTSKNGGIVPLSAIATVEQRFAPLSINHLDQFPSTTISFNVPDNYSLGEAVESILN
MDTB_KLEP3      DNIRLTSSDGGIVPLTAIATVEQRFTPLSVNHLDQFPVTTISFNVPDNYSLGEAVDAILA
MDTB_KLEP7      ENIRLTSSDGGIVPLTAIATVEQRFTPLSVNHLDQFPVTTISFNVPDNYSLGEAVEAILA
MDTB_CROS8      DGIRLASSDGGMVPLSAIAKVEQRFGPLTINHLDQFPSTTISFNVPDGYSLGDAVDAITQ
MDTB_YERPE      NDIRLTGIDGKGVPLSSIATIEERFGPLSINHLNQFPSATVSFNLAQGYSLGEAVAAVTL
MDTB_YERP1      NDIRLTGIDGKGVPLSSIATIEERFGPLSINHLNQFPSATVSFNLAQGYSLGEAVAAVTL
MDTB_YERPS      NDIRLTGSDGKGVPLNSIATIEERFGPLSINHLNQFPSATVSFNLAQGYSLGEAVAAVTL
MDTB_SERP5      NDIRLTSSNGTIVPLSTIAKIEQRFGPLSVNHLDQFPAATISFNVAGNYSLGEAVDAITL
MDTB_EDWTE      QRIYLTAADGSAIPLASIATVEQRHGVLAINHLDQFPSATLSFNVPDGYTLEQAIAEIDA
                  : *    .  :.* :** :: :   *::**: ***  *.***:.   :*  *:  :  

MDTB_PHOLL      AAQLINMPKDISTQFQGTTLAFESALGNTLWLIAAAIIAMYIVLGILYESFIHPVTILST
MDTB_XENBS      TERSIGMPKNINTQFQGATLAFQDALGNTLWLILAAVISMYIVLGILYESFIHPVTILST
MDTB_PECAS      AEQQMNLPADITTRFQGSTLAFQSALSSTVWLIVAAIVAMYIVLGVLYESFIHPITILST
MDTB_DICP7      TQQQMQLPSDIITRFQGSTLAFQAALTSTIWLVVAAIVAMYIVLGVLYESFIHPVTILST
MDTB_ECOSM      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOL5      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOUT      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOK1      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO45      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOL6      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO81      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOLC      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOBW      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECODH      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOLI      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOHS      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO24      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_SHIFL      TEKTLNLPVDITTQF-GSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO57      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO5E      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOSE      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_SHIBS      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_SHISS      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO7I      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO55      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO27      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECOLU      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ECO8A      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_SHIB3      TEKTLNLPVDITTQFQGCTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_ESCF3      TEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILST
MDTB_CITK8      TEKTVNLPVDITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALA4      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALHS      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALSV      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALCH      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALPC      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALNS      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALTY      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALDC      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALG2      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALEP      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALPA      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALPK      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALTI      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALPB      TEKTLALPADITTQFQGSTLAFQAALGSTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_SALAR      TERTLALPADITTQFQGSTLAFQAALGNTVWLIVAAVVAMYIVLGVLYESFIHPITILST
MDTB_ENT38      AEKTLNFPTDIQTQFQGSTLAFQAALGNTIWLIVAAVVAMYIVLGVLYESFIHPVTILST
MDTB_KLEP3      AEQSLDFPTDIRTQFQGSSLAFQSALGSTVWLVVAAVVAMYIVLGVLYESFIHPITILST
MDTB_KLEP7      AEQSLDFPTDIRTQFQGSSLAFQSALGSTVWLVVAAVVAMYIVLGVLYESFIHPITILST
MDTB_CROS8      AEADLAFPAEITTQFQGSTLAFQAALGSTLWLILASVVAMYIVLGVLYESFIHPITILST
MDTB_YERPE      AEKEIQLPADITTRFQGSTLAFQAALGSTLWLIIAAIVAMYIVLGVLYESFIHPITILST
MDTB_YERP1      AEKEIQLPADITTRFQGSTLAFQAALGSTLWLIIAAIVAMYIVLGVLYESFIHPITILST
MDTB_YERPS      AEKEIQLPADITTRFQGSTLAFQAALGSTLWLIIAAIVAMYIVLGVLYESFIHPITILST
MDTB_SERP5      AEKNLNLPKDITTQFQGATLAFQAALGGTLWLILAAVVAMYIVLGVLYESFIHPVTILST
MDTB_EDWTE      ARRAIGMPADMTLHFQGAALAFQSALDSTLWLILAAIVAMYIVLGILYESFIHPITILST
                :   : :* ::  :* * :***: ** .*:**: *::::******:********:*****

MDTB_PHOLL      LPTAGVGALLALMMAGHELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGLSPYEAI
MDTB_XENBS      LPTAGVGALLALMVGGYELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREKGMSPYDAI
MDTB_PECAS      LPTAGVGALLALMMAGKDLDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMKPYDAI
MDTB_DICP7      LPTAGVGALLALMISGSDLNIIAIIGIILLIGIVKKNAIMMIDFALAAEREHGMSPYQAI
MDTB_ECOSM      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOL5      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOUT      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOK1      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECO45      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOL6      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECO81      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOLC      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOBW      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECODH      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOLI      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECOHS      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAI
MDTB_ECO24      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SHIFL      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECO57      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECO5E      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECOSE      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SHIBS      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SHISS      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECO7I      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECO55      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECO27      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECOLU      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ECO8A      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SHIB3      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_ESCF3      LPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_CITK8      LPTAGVGALLALMIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMAPRDAI
MDTB_SALA4      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALHS      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALSV      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALCH      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALPC      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALNS      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALTY      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALDC      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALG2      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMINFALAAEREQGMSPRDAI
MDTB_SALEP      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALPA      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALPK      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALTI      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALPB      LPTAGVGALLALIIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPRDAI
MDTB_SALAR      LPTAGVGALLALMIAGSELDIIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMYPRDAI
MDTB_ENT38      LPTAGVGALLALMLSGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMAPRDAI
MDTB_KLEP3      LPTAGVGALLALWLAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMPPREAI
MDTB_KLEP7      LPTAGVGALLALWLAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMPPREAI
MDTB_CROS8      LPTAGVGALLALLIAGAELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMTPREAI
MDTB_YERPE      LPTAGVGALLALMLTGNELDVIAIIGIILLIGIVKKNAIMMIDFALAAERDQGMTPYDAI
MDTB_YERP1      LPTAGVGALLALMLTGNELDVIAIIGIILLIGIVKKNAIMMIDFALAAERDQGMTPYDAI
MDTB_YERPS      LPTAGVGALLALMLTGNELDVIAIIGIILLIGIVKKNAIMMIDFALAAERDQGMTPYDAI
MDTB_SERP5      LPTAGVGALLALMMAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMTPYDAI
MDTB_EDWTE      LPSAGVGALLALMISGQALDVIAIIGIILLIGIVKKNAIMMIDFALAAERTQGMAPHDAI
                **:********* : *  *::*********************:******* :*: * :**

MDTB_PHOLL      YQACLLRFRPILMTTMAALLGALPLMLSTGVGAELRRPLGICMVGGLIMSQILTLFTTPV
MDTB_XENBS      FQACLLRFRPILMTTMAALLGALPLMLSTGIGAELRRPLGICMVGGLIMSQILTLFTTPV
MDTB_PECAS      YQACLLRFRPILMTTMAALLSALPLMLSTGVGAELRQPLGVCMVGGLIMSQILTLFTTPV
MDTB_DICP7      YQACLLRFRPILMTTMAALLSAVPLMFSTGVGAELRRPLGICMVGGLVMSQVLTLFTTPV
MDTB_ECOSM      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOL5      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOUT      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOK1      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO45      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOL6      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO81      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOLC      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOBW      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECODH      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOLI      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOHS      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO24      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_SHIFL      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO57      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO5E      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOSE      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_SHIBS      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_SHISS      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO7I      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO55      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO27      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECOLU      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_ECO8A      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPV
MDTB_SHIB3      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLVVSQVLTLFTTPV
MDTB_ESCF3      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLVVSQVLTLFTTPV
MDTB_CITK8      FQACLLRFRPILMTTLAALLGALPLMLSTGTGAELRRPLGIGMVGGLLVSQVLTLFTTPV
MDTB_SALA4      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALHS      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALSV      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALCH      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALPC      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALNS      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALTY      FQACLLRFRPILMTTLAALLGALPLMLSTGVGTELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALDC      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALG2      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALEP      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALPA      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALPK      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALTI      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALPB      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQVLTLFTTPV
MDTB_SALAR      FQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIAMVGGLLVSQILTLFTTPV
MDTB_ENT38      FQACLLRFRPILMTTMAALLGALPLMLSTGVGAELRRPLGIGMVGGLLVSQVLTLFTTPV
MDTB_KLEP3      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLMLSQVLTLFTTPV
MDTB_KLEP7      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLMLSQVLTLFTTPV
MDTB_CROS8      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLLVSQVLTLFTTPV
MDTB_YERPE      YQACLLRFRPILMTTLAALFGALPLMLSTGVGAELRQPLGVCMVGGLIVSQVLTLFTTPV
MDTB_YERP1      YQACLLRFRPILMTTLAALFGALPLMLSTGVGAELRQPLGVCMVGGLIVSQVLTLFTTPV
MDTB_YERPS      YQACLLRFRPILMTTLAALFGALPLMLSTGVGAELRQPLGVCMVGGLIVSQVLTLFTTPV
MDTB_SERP5      YQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRHPLGVCMVGGLVMSQILTLFTTPV
MDTB_EDWTE      YQACLLRFRPILMTTMAALLGALPLMFSQGVGAELRQPLGICMVGGLIVSQILTLFTTPV
                :**************:***:.*:***:* * *:***:***: *****::**:********

MDTB_PHOLL      IYLLFDRLAHYRRNRQ--------LSVSNTPSIDHQEPR
MDTB_XENBS      IYLLFDRLANYFKNKRQNRLQSQNQRELDHSPVNHQEPL
MDTB_PECAS      IYLLFDRLATRFRRVPRQ------EEETE----------
MDTB_DICP7      IYLLFDRLAHRLRRPRPQ------EGEAQ----------
MDTB_ECOSM      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOL5      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOUT      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOK1      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO45      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOL6      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO81      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOLC      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOBW      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECODH      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOLI      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOHS      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO24      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_SHIFL      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO57      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO5E      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOSE      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_SHIBS      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_SHISS      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO7I      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO55      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO27      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECOLU      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_ECO8A      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_SHIB3      IYLLFDRLALWTKSRFAC-----HEEEA-----------
MDTB_ESCF3      IYLLFDRLALWTKSRFAR-----HEEEA-----------
MDTB_CITK8      IYLLFDRLSLYVKSRFPR-----QEEEA-----------
MDTB_SALA4      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALHS      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALSV      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALCH      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALPC      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALNS      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALTY      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALDC      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALG2      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALEP      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALPA      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALPK      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALTI      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALPB      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_SALAR      IYLLFDRLSLYVKSRFPR-----HKEEA-----------
MDTB_ENT38      IYLLFDTLALKMKARFPK-----REEEA-----------
MDTB_KLEP3      IYLLFDRLSLHLKRRFPR-----QEEEA-----------
MDTB_KLEP7      IYLLFDRLSLHLKRRFPR-----QEEEA-----------
MDTB_CROS8      IYLLFDRLGHAVRRRLPA-----REEEA-----------
MDTB_YERPE      IYLLFDKLARNTRGKNRHRDEDIDSSELLNGQEPQ----
MDTB_YERP1      IYLLFDKLARNTRGKNRHRDEDIDSSELLNGQEPQ----
MDTB_YERPS      IYLLFDKLARNTRGKNRHRDEDIDSSELLNGQEPQ----
MDTB_SERP5      IYLLFDKLARNTRRQP-------DAQELP----------
MDTB_EDWTE      IYLAFDRLARNTHRPTRG-------VPAR----------
                *** ** *.   :