CLUSTAL format seed alignment for MF_01427

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YHAM_BACSK      MAKGIRHHRVGEAVDGYLLIKTATKQIASNSKPFLTLILGDHTGEIEAKLWGISPEDEAT
YHAM_BACHD      MSRGILYYQVGEALESYFLIKSATKAVASNGKPFLTLILSDHTGEIEAKLWGCSPEDEAT
YHAM_BACSU      MAKGIMLHEVGEQVDQYLLIKSSTKGIASNGKPFLTLMLQDQSGDIEAKLWDAKQSDEVT
YHAM_BACLD      MAKGIMLHEVGEQVDLYLLIKSSTKGIASNGKPFLTLMLQDQSGDIEAKLWDAKQQDEVT
YHAM_BACCR      MKKKIAEYEVGEQVDIFLLIKTATKGIASNGKPFLTVILQDPSGDIEAKLWDVSPEVEKQ
YHAM_BACHK      MKKKIAEYEVGEQVDIFLLIKTATKGIASNGKPFLTVILQDPSGDIEAKLWDVSPEVEKQ
YHAM_BACC1      MKKKIAEYEVGEQVDIFLLIKTATKGIASNGKPFLTVILQDPSGDIEAKLWDVSPEVEKQ
YHAM_BACCZ      MKKKIAEYEVGEQVDIFLLIKTATKGIASNGKPFLTVILQDPSGDIEAKLWDVSPEVEKQ
YHAM_BACAN      MKKKIAEYEVGEQVDVFLLIKTATKGIASNGKPFLTVILQDPSGDIEAKLWDVSPEVEKQ
YHAM_GEOKA      MAKGIIHYEVGEQVDLFLLIKSATKGIASNGKPFLTLILQDKSGDIEAKLWDVSPDDEER
YHAM_LISMO      MEKRLLDFEVGETVDLFLLIKSSVKGTASNGKPFLSLVLQDKSGELEAKLWDVKESDEAN
YHAM_LISMF      MEKRLLDFEVGETVDLFLLIKSSVKGTASNGKPFLSLVLQDKSGELEAKLWDVKESDEAN
YHAM_LISIN      MEKRLLDYEVGETVELFLLIKSSVKGTASNGKPFLSLVLQDKSGELEAKLWDVKESDEIN
YHAM_OCEIH      MKNGIAFRTIGEEFDGFLLIKESTRGTTSNGKPFLTLILRDASGEIEAKLWDATKDDEET
                * . :    :** .: ::*** :.:  :**.****:::* * :*::*****. . . *  

YHAM_BACSK      FVNKTIVHIQGDVIDYRGRLQLKIASIRPTSAMDGVHLNDFVRSAPLAPNDMLDEVNQYI
YHAM_BACHD      FVSGAIVHISGQLSEYRGRQQLKIGSIRPTTAMDQVKVSDFVRSAPLSPDDMLEQITQYI
YHAM_BACSU      YAPQTIVKVVGDVHHYRGRTQLKLRNIRPVSEQENVNIDDFLETAPIPKNEMMDTITQYI
YHAM_BACLD      YGPQTIVKVVGDIHHYRGRNQLKLRNIRPAGENENVKIDDFLETAPIPKNEMMDAVTQYI
YHAM_BACCR      YVAETIVKVAGDILNYKGRIQLRVKQIRVANENEVTDISDFVEKAPVKKEDMVEKITQYI
YHAM_BACHK      YVAETIVKVAGDILNYKGRIQLRVKQIRVANENEVTDISDFVEKAPVKKEDMVEKITQYI
YHAM_BACC1      YVAETIVKVAGDILNYKGRIQLRVKQIRVANENEVTDISDFVEKAPVKKEDMVEKITQYI
YHAM_BACCZ      YVAETIVKVAGDILNYKGRIQLRVKQIRVANENEVTDISDFVEKAPVKKEDMVEKITQYI
YHAM_BACAN      YVAETIVKVAGDILNYKGRIQLRVKQIRVANENEVTDISDFVEKAPVKKEDMVEKITQYI
YHAM_GEOKA      YVPECIVKVAGDIHNYRGKLQLRIRSIRPAHPGDAVRIDDFLEKAPLGREEMKAKVMEYI
YHAM_LISMO      YGVQQIVHLMGDIQNYRGRKQLKIRQIRQATALDGVSASEFMETAPINKEEMADEITQYI
YHAM_LISMF      YGVQQIVHLMGDIQNYRGRKQLKIRQIRQATALDGVSASEFMETAPINKEEMADEITQYI
YHAM_LISIN      YGVQQIVHLMGDIQNYRGRKQLKIRQIRQASPLDGVSASEFMETAPINKDEMADEITQYI
YHAM_OCEIH      LIPEQIIQVTGEINQFRGKHQLKILSIRLSQPMDNVQVTDFLGKAPMEKEELAEKLTEAI
                     *::: *:: .::*: **:: .**     : .   :*: .**:  :::   : : *

YHAM_BACSK      FEIHNPHIQRITRFLLKKHQQAFLESPAATKNHHEFMSGLAFHVVSMLRIGKSLIELYPT
YHAM_BACHD      FEMKNPKIQRMTRHLLKKHQTAFLEYPAATTNHHEFVSGLAYHVVCMLNVAKSLAALYPT
YHAM_BACSU      FEMKNPNIQRITRFLVKKHEAEFMDYPAATKNHHEFVSGLAYHVVSMLNLAKAIADLYPS
YHAM_BACLD      FEMKNPNIQRITRHLVKKYGKEFIDYPAATKNHHEFVSGLAYHVVSMLNLAKSVADLYPS
YHAM_BACCR      FEMRNPNIQRLTRHLLNKHQNEFLDYPAATKNHHEFVSGLAYHVVSMLDLAKAISNLYPS
YHAM_BACHK      FEMRNPNIQRLTRHLLNKHQNEFLDYPAATKNHHEFVSGLAYHVVSMLDLAKAISNLYPS
YHAM_BACC1      FEMRNPNIQRLTRHLLNKHQNEFLDYPAATKNHHEFVSGLAYHVVSMLDLAKAISNLYPS
YHAM_BACCZ      FEMRNPNIQRLTRHLLNKHQNEFLDYPAATKNHHEFVSGLAYHVVSMLDLAKAISNLYPS
YHAM_BACAN      FEMRNPNIQRLTRHLLNKHQNEFLDYPAATKNHHEFVSGLAYHVVSMLDLAKAISNLYPS
YHAM_GEOKA      FAMENPNIQRITRYLLKKYEKAFFEYPAATKNHHEFISGLAYHVVSMLELAKALIHLYPS
YHAM_LISMO      FEMKNANLQRITRALLKKYQDDFYDYPAAMRHHHEFVSGLSFHVVSMLRLAKSVADLYPS
YHAM_LISMF      FEMKNANLQRITRALLKKYQDDFYDYPAAMRHHHEFVSGLSFHVVSMLRLAKSVADLYPS
YHAM_LISIN      FEMKNANLQRITRALLKKYQDDFYDYPAAMRHHHEFVSGLSFHVVSMLRLAKSVADLYPT
YHAM_OCEIH      FEMENPKIQRLVRAFIKKYQEELLTYPAATKNHHEFASGLAYHVVSMLAIGKELHKLYPE
                * :.*.::**:.* :::*:   :   ***  :**** ***::***.** :.* :  *** 

YHAM_BACSK      LDKDLLYAGIILHDLGKVRELSGAIDTTYTLEGKLLGHISIMSNEIAQAAKELEIDGEEV
YHAM_BACHD      LDTDLLYAGIILHDLGKVKELSGPIDTTYTIEGKLLGHISILVNEIGETANELGIEGEEV
YHAM_BACSU      LDRDLLYAGVILHDLGKVKELSGPVSTSYTVEGNLLGHISIMVTELSKAAEELQIDSEEV
YHAM_BACLD      LDRDLLYAGVILHDLGKVKELSGPVSTTYTVEGNLLGHISIMVTEIAKAAEELQIDSEEV
YHAM_BACCR      LDKDLLYAGVILHDLGKVIELSGPISTTYTLEGNLLGHISIMVNEIGKAADELQIDAEEV
YHAM_BACHK      LDKDLLYAGVILHDLGKVIELSGPISTTYTLEGNLLGHISIMVNEIGKAADELQIDAEEV
YHAM_BACC1      LDKDLLYAGVILHDLGKVIELSGPISTTYTLEGNLLGHISIMVNEIGKAADELQIDAEEV
YHAM_BACCZ      LDKDLLYAGVILHDLGKVIELSGPISTTYTLEGNLLGHISIMVNEIGKAADELQIDAEEV
YHAM_BACAN      LDKDLLYAGVILHDLGKVIELSGPISTTYTLEGNLLGHISIMVNEIGKAADELQIDAEEV
YHAM_GEOKA      LNKDLLYAGVILHDLGKVIELSGPVSAAYTLEGNLLGHISIMVSEISKAAEQLGIQGEEV
YHAM_LISMO      VNRDLLYAGVILHDLGKVIELSGPVSTTYTLEGNLIGHISIVVEEVSKIADELSIDGEEV
YHAM_LISMF      VNRDLLYAGVILHDLGKVIELSGPVSTTYTLEGNLIGHISIVVEEVSKIADELSIDGEEV
YHAM_LISIN      VNRDLLYAGVILHDLGKVIELSGPVSTTYTLEGNLIGHISIVVEEVSKIAEELSIDGEEV
YHAM_OCEIH      INRDLLYAGIILHDIGKIKELSGVVSTTYTLEGKMLGHIPMMVEEIGLMANELQIEGEEV
                :: ******:****:**: **** :.::**:**:::***.::  *:.  *.:* *:.***

YHAM_BACSK      LILQHLILSHHGKGEWGSPKTPVVREAEVLHLIDNIDAKINMMDRALERVQPGEFSERVM
YHAM_BACHD      IILQHLVLAHHSKGEWGSPKPPLIREAEILHMIDNIDAKMNMMDRALERVQPGEFSERIK
YHAM_BACSU      LILQHLILSHHGKAEWGSPKPPMVKEAEILHYIDNLDAKMNMMDRALERVKPGEYTERVF
YHAM_BACLD      LILQHLILSHHGKPEWGSPKPPMVKEAEILHYIDNLDAKINMMDRALERVKPGEYTERVF
YHAM_BACCR      LILQHIVLSHHGKAEWGSPKPPLVKEAEILHYIDNLDAKMNMMDRALGRTKPGEYTERVF
YHAM_BACHK      LILQHIVLSHHGKAEWGSPKPPLVKEAEILHYIDNLDAKMNMMDRALGRTKPGEYTERVF
YHAM_BACC1      LILQHIVLSHHGKAEWGSPKPPLVKEAEILHYIDNLDAKMNMMDRALGRTKPGEYTERVF
YHAM_BACCZ      LILQHIVLSHHGKAEWGSPKPPLVKEAEILHYIDNLDAKMNMMDRALGRTKPGEYTERVF
YHAM_BACAN      LILQHIVLSHHGKAEWGSPKPPLVKEAEILHYIDNLDAKMNMMDRALGRTKPGEYTERVF
YHAM_GEOKA      VILQHLVLAHHGKAEWGSPKPPLVKEAEVLHYIDNLDAKITMIDRALEKVKPGEFTERVF
YHAM_LISMO      VVLKHVLLSHHGKGEWGSPKPPLVREAEILHQIDLMDASLNMMDKVLKHTKPGEFSERVF
YHAM_LISMF      VVLKHVLLSHHGKGEWGSPKPPLVREAEILHQIDLMDASLNMMDKVLKHTKPGEFSERVF
YHAM_LISIN      VVLKHVLLSHHGKGEWGSPKPPLVREAEILHQIDLMDASLNMMDKVLKHTKPGEFSERVF
YHAM_OCEIH      LILKHLVLSHHGKAEWGSPTPPLVREAELLHLIDLIDAKMNMLGRALEKIQPGEFTERLF
                ::*:*::*:**.* *****..*:::***:** ** :**.:.*:.:.* : :***::**: 

YHAM_BACSK      ALDNRSFYKPSFHKKPIEL------
YHAM_BACHD      AMDNRSFYKPNFHEPPLDLS-----
YHAM_BACSU      ALENRSFYKPTFHK-----------
YHAM_BACLD      ALDNRSFYKPVFHK-----------
YHAM_BACCR      ALDNRSFYKPSFHN-----------
YHAM_BACHK      ALDNRSFYKPSFHN-----------
YHAM_BACC1      ALDNRSFYKPSFHN-----------
YHAM_BACCZ      ALDNRSFYKPSFHN-----------
YHAM_BACAN      ALDNRSFYKPSFHN-----------
YHAM_GEOKA      ALDNRSFYKPAFLSVSKPKNPGSKE
YHAM_LISMO      GLDNRSFYNPTFE------------
YHAM_LISMF      GLDNRSFYNPIFE------------
YHAM_LISIN      GLDNRSFYNPTFE------------
YHAM_OCEIH      AMDNRAFYKPNFEENEG--------
                .::**:**:* *