CLUSTAL format seed alignment for MF_01430

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q2RU01_RHORT          -------------------------------MNKIAGFMGAFALLLTALSSTQPAAAQSA
Q9A711_CAUVC          ---------------------------------------MALLLGSTALVAPQQAFAQAA
Q89KQ1_BRADU          ------------------------------------------MKFGLRLRGGLLATLIMF
Q89NX1_BRADU          MLSCGLFGRVYAGDEFKSSATIEQLSSHTTATAVSSQGDELLVRCGMKVWQNGVIAVVIC
A9CJ61_AGRFC          ------------------------------------------MKAGSRFLNAVSAVALSA
Q3J2W8_RHOS4          -----------------------------MTEGRRMARNRTGNGRTGQDRGMIRPAAVSV
Q5GTM8_WOLTR          ----------------------------------------------------MRKLSYIL
A0A0H3M0B6_EHRRW      -------------------------------------------------------MQYVI
BAMA_ECOLI            --------------------------------------------------------MAMK
BAMA_SHIDS            --------------------------------------------------------MAMK
BAMA_SALTY            --------------------------------------------------------MAMK
BAMA_YERPE            --------------------------------------------------------MAMK
Q5E3E7_ALIF1          --------------------------------------------------------MAMK
Q9KPW0_VIBCH          --------------------------------------------------------MAMK
Q8EGG7_SHEON          ---------------------------------------------------MRLNKLFAS
BAMA_HAEIN            ----------------------------------------------------------MK
BAMA_NEIMB            ---------------------------------------------------------MKL
Q5F5W8_NEIG1          ---------------------------------------------------------MKL
Q7VYC2_BORPE          ---------------------------------------------MSLRRMFHHKKGVIP
Q63T20_BURPS          -------------------------------------------------MLFKPHRFVPK
Q8PAW1_XANCP          --------------------MKLLHSFRLLSSSYAGTQQHPQSTPTGCDMTRLPTRRLLA
Q9HXY4_PSEAE          ---------------------------------------------------------MKR
Q83DT2_COXBU          -------------------------------------------------MPSIMKFRKRF
Q9ZE03_RICPR          ------------------------------------------------------MKIISI
Q5NEP7_FRATT          ----------------------------------------------------MFFLRKKF
Q8D2H0_WIGBR          -----------------------------------------------------MLIKKLF
BAMA_NEORI            ------------------------------------------------------------
Q74AT3_GEOSL          -----------------------------------------------------MRRLQAT
BAMA_DESVH            ---------------------MYGSFTQLGDSFSIDLRVVDALGVKPAKPFFIQKQGIIN
Q0PC08_CAMJE          ------------------------------------------------------------
BAMA_HELPY            ----------MKKLILSSLVFACINTSVEALENDGSKPNDLTSPKEASQESQKNEAPKNE
                                                                                  

Q2RU01_RHORT          GGQRAAAQRGGAFTAPGLGGTIDRIVIEGTQRIDPETVLTYMTVREGDVYDAGKVDRSLK
Q9A711_CAUVC          -----------------QTGVVQRILVQGNERIEQGTVLSYLPIQPGDTVDSQRLDLALK
Q89KQ1_BRADU          GAPVVAPIGAALVSSSALAQTVQSISVEGNRRVEVETIRSYFKPGPGGRLDQGAIDDGLK
Q89NX1_BRADU          GITVAASIVVVGSPTDAVAQVSQGIVVEGNRRVEAETVRSYFRSGPDGRLDQAAIDDGLK
A9CJ61_AGRFC          GVSSVAGLGVLASAGVANAAVISKIDVRGAERSGADSVRSNITIAPGKNFSNSDIDESVK
Q3J2W8_RHOS4          FLGVAGIAAGMTLPALAQNYSFSDVRIEGNDRVDATTILGFARINRGQAISAGELNEAYQ
Q5GTM8_WOLTR          IVIFISFPILLAASENNEKTQIKDIKCIGNERVGDQTIKFYIKLEPDSYVNDDDIDSIIK
A0A0H3M0B6_EHRRW      VILMLLFSSCVYAEALD--TKVKQVQINGNHRLDYKTIYFYSKVNLEDNIKESTINQIIK
BAMA_ECOLI            KLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIR
BAMA_SHIDS            KLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTINDEDISNTIR
BAMA_SALTY            KLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIR
BAMA_YERPE            KLLIASLLFGSATVYGADGFVVNDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIGKTIR
Q5E3E7_ALIF1          KLLIASLLFGSVAAHSAETFVIDDIRFEGLQRVALGAALLKTPVRVGDTMSQQDVAQVIQ
Q9KPW0_VIBCH          QILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKMPVRVGDSVDSQDVANIIK
Q8EGG7_SHEON          MLFVGASFSGTVLADTFQPFEVTDIQVEGLQRVALGAALLSLPVKVGDTVDQLKLQQAIK
BAMA_HAEIN            KLLIASLLFGTTTTVFAAPFVAKDIRVDGVQGDLEQQIRASLPVRAGQRVTDNDVANIVR
BAMA_NEIMB            KQIASALMMLGISPLALADFTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIK
Q5F5W8_NEIG1          KQIASALMMLGISPLAFADFTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIK
Q7VYC2_BORPE          GLLAAALLAPALA-HAFEPFVVRDIRVEGIQRTDAGTVFGYLPVKVGEKFTDEEATEAVR
Q63T20_BURPS          TVAAAALAAHGLAAHATAPFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIR
Q8PAW1_XANCP          LALAAGLSLPAAAALAAEPFVASDIRVDGLQRIASGTVFTYLPVNRGDTVDDGKVADSIR
Q9HXY4_PSEAE          FLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQATR
Q83DT2_COXBU          LFAITFIIFCIPFTLTAYGFVVRSIQIQGLQGISADTVRSYLPIHEGQEYTAQRGQRILQ
Q9ZE03_RICPR          SKLTILLLTIFYYHISFADYVIRKITIEGNHRVERSTIESYLKLNVGETYNNSKEDEAIK
Q5NEP7_FRATT          VLASLLVGIAFNGWADNDSFILDNVSINGLEGLQSDVVKSRIGYKKGSYITPEDTNQIIN
Q8D2H0_WIGBR          LLILIIFSINLSIADVDEKFLVKKIIFKGFKHVNTEHILLKTPIKIGKILTKQDVSESIR
BAMA_NEORI            ------MVWLLFLSSFCFADEVVEIRISGNKRVSETTVRGLLHVEVGQDVASDELNAVFK
Q74AT3_GEOSL          SLGIIAAVVLNVQGVRAEGEKIIDVRVKGNRRVETAAITNALSLKTGDLLYAEKVDADVR
BAMA_DESVH            ILPAVDELVDRVAGEFTSGNAIADVKVRGTKVLDPDVVLMRLSTRKGDPIDPAAINKEIK
Q0PC08_CAMJE          --MKKHLISICALVAMANAATIKDIKFIGLNHLSNTSAINIAGLKIGEEINPAKINTAIL
BAMA_HELPY            VQRNEAQKETPQSNQTPKEMKVKSISYVGLSYMSDMLANEIVKIRVGDIVDSKKIDTAVL
                                              :   *                               

Q2RU01_RHORT          NLFETGLFADVSMRH----EGGRLVVSVAENPIINRIAFEGNRRIK-DPQLETEIQL--R
Q9A711_CAUVC          TLARTDLFADVKIEM----LGGDLVVKVVENPIINQVVFEGNSSLK-EDKLKDEVQI--R
Q89KQ1_BRADU          ALIETGLFQDVKINRG---AGGQIVVSVVENPVIGRIAFEGNKKIK-DEQLGTEVQS--K
Q89NX1_BRADU          ALIGTRLFQDVKIRR----AGAQVVVSVVENAVIGRVAFEGNRKIK-DEQLSAEVQS--K
A9CJ61_AGRFC          RLYATGYFSNVSMRV----SGSTLVVTVNENQLVNQVVFNGNRKIK-DDKLAGIVQT--Q
Q3J2W8_RHOS4          RLADSGLFETVEIVP----QGGTLVIRVQEFPTINIINFEGNARIK-DDKLAGLVKS--Q
Q5GTM8_WOLTR          SLYKTKLFASVHAYID---NEKKLVIKVQENPLINKVILKGNKQFKSKELLNNVIQS--K
A0A0H3M0B6_EHRRW      NLYSTQLFSEVEVYVN---KDNYLIINVKENPIVNDIIFYGNKEFNKKTLQNDILKL--K
BAMA_ECOLI            ALFATGNFEDVRVLR----DGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR
BAMA_SHIDS            ALFATGNFEDVRVLR----DGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR
BAMA_SALTY            ALFATGNFEDVRVLR----DGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR
BAMA_YERPE            ALFATGNFEDVRVLR----DGNTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR
Q5E3E7_ALIF1          ALFASGNFEDVKVFR----DGNALLIKVTERPTIANISFSGNKAIKEEQMQQNLEASSIR
Q9KPW0_VIBCH          ALYSSGNFEDVKVLR----DGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR
Q8EGG7_SHEON          SLYASTNFENISVSH----EDGVLIVKVTERPTISAVTFEGNKDIKDEQLQESLDGSGVK
BAMA_HAEIN            SLFVSGRFDDVKAHQ----EGDVLVVSVVAKSIISDVKIKGNSIIPTEALKQNLDANGFK
BAMA_NEIMB            SLYATGFFDDVRVET----ADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA
Q5F5W8_NEIG1          SLYATGFFDDVRVET----ADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA
Q7VYC2_BORPE          RLYGTGFFSDVQIQT----DNNVVVVVVQERPTIASISFNGMREFDSKAITKSLAQVGFG
Q63T20_BURPS          ALYATGFFNDVRIAT----QGGVVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLS
Q8PAW1_XANCP          ALYRTGFFEDVQLDR----QGNILVITVKERPAINKLTVTGNKDIKSEELLKGLGDIGLT
Q9HXY4_PSEAE          SLFKTGFFQDIQLGR----DGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLA
Q83DT2_COXBU          SLYRTGFFETVRLAR----RGDALIISVKERPIISLIRISGNKAISTKKLRPILNKLNIS
Q9ZE03_RICPR          RLYATSLFRNINMYIT---NDGNLIVNVTETPFISSVVFSGNSKIKTNILAKEIYTMS--
Q5NEP7_FRATT          NLYGTGFFNSVDLYR----KGSNLFINVKERPIIAGFSFSGNKKLSKDNLEKVFTDAGIY
Q8D2H0_WIGBR          ILFDSKNFNKIKISY----EENNLIIFVEECPIINNIFFSGNISLEKNNIKNILKSKNIK
BAMA_NEORI            RLTASRLFSSVELDL----TAGILEVKLQENPILRNVVVKGNKLLSRAAIDKILVYK---
Q74AT3_GEOSL          AVYKLGQFIDVRAETEQGDGGVVLVYTVQEKPIIREVRIEGNKELSTDKVRDALGLK---
BAMA_DESVH            RIWDLGYFSDVQASVEQGGDGTVLVYTVTEKPRIDNIVIEGSDKVGHDDILAAMSSK---
Q0PC08_CAMJE          NLYKQNYFENIAVEN----NNGILEIIVTEKPTIAKVTITG---IASNDRKQVESILGIK
BAMA_HELPY            ALFNQGYFKDVYATF----EGGILEFHFDEKARIAGVEIKGYGTEKEKDGLKSQMGIK--
                       :     *  :            :   .     :  . . *                   

Q2RU01_RHORT          PRVVYTRAKVQEDVQRILELYRRSGRYAVSVEPKV-IALDQNRVDLAFEINEGPSTTVRR
Q9A711_CAUVC          PRGIFTRAKVQADVQRIIELYRRSGRISATVTPKV-VELPQKRVDLVFEINEGAKSGVLG
Q89KQ1_BRADU          ARGTFSRAMVQSDTLRIAEIYRRSGRYDVRVTPEV-IEQPNNRVDLIFTIEEGAKTGVKS
Q89NX1_BRADU          PRGAFSRAIVQSDTLRIAEIYRRSGRYDVHVTPEI-VEQPNNRVDLVFTIAEGAKTGVKS
A9CJ61_AGRFC          PMGPFNQAIVTADIARIKEAYSAIGRSDVEITTQT-VSVGQGRVNIAFVINEGERTKIGR
Q3J2W8_RHOS4          SRRAYNPAQAEADAAAITEAYRVQGRIAATVTPKI-IRRSDNRVDLVFDIAEGKVVEIER
Q5GTM8_WOLTR          PLTIFTETKLQSDLVNLVTLYRHNGKIGVKVEYEL-DKLDGNRVNLIFKVKEGKTSRVKS
A0A0H3M0B6_EHRRW      KLGVFTKSKLQRDISDLLSLYQTKGKLGVTISHEI-QELENNKVDIIIRINEGPTSRIKN
BAMA_ECOLI            VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVV-TPLPRNRVDLKLVFQEGVSAEIQQ
BAMA_SHIDS            VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVV-TPLPRNRVDLKLVFQEGVSAEIQQ
BAMA_SALTY            VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVV-TPLPRNRVDLKLVFQEGVSAKIQQ
BAMA_YERPE            VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVV-TPLPRNRVDLKLVFTEGVSAKIQQ
Q5E3E7_ALIF1          VGEALDRTTLSNIEKGLEDFYYSVGKYNATVHAVV-TPLPRNRADLKFVFTEGVSAKIQQ
Q9KPW0_VIBCH          VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVV-TPLPRNRADLKFVFTEGVSAKIQQ
Q8EGG7_SHEON          VGESLDRTMLTGIEKGLQDFYYGVGKYGAKVEAQV-INLPRNRVELKFKFTEGLAAEIRQ
BAMA_HAEIN            VGDVLIREKLNEFAKSVKEHYASVGRYNATVEPIV-NTLPNNRAEILIQINEDDKAKLAS
BAMA_NEIMB            QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKV-TKLARNRVDIDITIDEGKSAKITD
Q5F5W8_NEIG1          QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKV-TKLARNRVDIDITIDEGKSAKITD
Q7VYC2_BORPE          EGRIFDQSMLERAEYELKEQYLAKGKYGVEVTATV-TPLPRNRVGVSFDVFEGEVAKIRE
Q63T20_BURPS          QGRYYDKALVDKAEQELKRQYLTRGFYAAEVSTTV-TPVDANRVSILFAVAEGPSAKIRQ
Q8PAW1_XANCP          EGGTFDRLSLDRVTQELTRQYNNRGKYNVEITPTV-SPLDRNRVDVAIAIKEGKAAKIRH
Q9HXY4_PSEAE          EGEIFQRATLEGVRNELQRQYVAQGRYSAEINAEV-IPQPRNRVALKININEGTVAAISH
Q83DT2_COXBU          EGQPYDPTKLHEIEVGLEQQYGAMGYHAATVSTRV-VKETKNRVALYIHINEGGIAKVGS
Q9ZE03_RICPR          -GESLSQAKIELDVKKILEIYKRSGRFSTKVTPKI-KSLENNRVKVIFDIAEGPKTVIKS
Q5NEP7_FRATT          VGNVYNPNTMFLLKQSLLNQYSMMGLYGAKIEENI-RKLPNNRIDINVNFQEGKPAIIDS
Q8D2H0_WIGBR          IGNPLYPSASQEIKISLKNIYDYIGKYNSEINVNS-INLKNNKVDLNIIIKESDFVLIKE
BAMA_NEORI            KDAIFDVHEFENSITALKSYYRDSVVEKTAISYRI-VPIDENNVDVEVTVKEAKPTVIRA
Q74AT3_GEOSL          ANTIFSQKELTLAGKRVKKLYGDEGYYLAEVTTRS-EKRSDTDVRVIVSVAEGEKVLIKS
BAMA_DESVH            TGSVLNDKLLAQDLQKVTELYRKEGFYLAHVTHRVEARQGAASATLVLNVEEGNKLYIKK
Q0PC08_CAMJE          RGTLLDEGNIKEAIERIKAYYEAKSYFDTIVEYKKKTLENTDGLELEFIVNRGENIIIDN
BAMA_HELPY            KGDTFDEQKLEHAKTALKTALEGQGYYGSVVEVRT-EKVSEGALLIVFDVNRGDSIYIKQ
                                      :             :              : . . .     :  

Q2RU01_RHORT          ISFVGNKVYDDSALREVVETSEEAWYR-----FLSSTDTYDPDRLTYDRELLRRHYLKNG
Q9A711_CAUVC          INFLGNAEYSDNDLRDVIVTKESRWYK-----ILTSNDNYDPDRIEYDREQLRKHYRNRG
Q89KQ1_BRADU          IEFVGNVAFSSYRLRDVIKTRESNLLS-----FLASGDIYDPDRVEADRDLIRRFYLKNG
Q89NX1_BRADU          IDFIGNVGYSAARLRDVIKTHEGNLLS-----FLGNNDVYDPDRIEADRDLIRRFYLKNG
A9CJ61_AGRFC          IDFIGNNSYSDGRLAAVINTKKSNMLS-----FLTRKDVYNEDKLRADEEALRQFYYNRG
Q3J2W8_RHOS4          LSFVGNRAYSDRRLRQVLETKQAGLLR-----SIIASDTFIAERVELDKQLLRDFYLSRG
Q5GTM8_WOLTR          VRFIGNKNFSENELERAIKVQSNDIFNKLFRAIFKGGNHYSPQYLLTNEELLDRFYSSKG
A0A0H3M0B6_EHRRW      IKFVGNKFFSSMVLKKAILSTEYYPYK-----IFNSSTKFAPERLMLDQAALYNFYTSKG
BAMA_ECOLI            INIVGNHAFTTDELISHFQLRDEVPWWNV-----VGDRKYQKQKLAGDLETLRSYYLDRG
BAMA_SHIDS            INIVGNHAFTTDELISHFQLRDEVPWWNV-----VGDRKYQKQKLAGDLETLRSYYLDRG
BAMA_SALTY            INIVGNHAFSTEELISHFQLRDEVPWWNV-----VGDRKYQKQKLAGDLETLRSYYLDRG
BAMA_YERPE            INIVGNHSFTTDELISRFQLRDEVPWWNV-----VGDRKYQKQKLAGDLETLRSFYLDRG
Q5E3E7_ALIF1          INFIGNEVFTDEQLLSRFNLNVDVAWWNF-----LADEKYQKQVLAGDIEALRSYYLDRG
Q9KPW0_VIBCH          INFIGNQVFSDEELLSRFNLNVDVAWWNF-----LADDKYKKQVLAGDIEALRTYYLDRG
Q8EGG7_SHEON          INVVGNHEFTDAELIGMLELKDYVAWWDL-----FGERRYQKQKLQADLETIKTYYHNKG
BAMA_HAEIN            LTFKGNESVSSSTLQEQMELQPD-SWWKL-----WGN-KFEGAQFEKDLQSIRDYYLNNG
BAMA_NEIMB            IEFEGNQVYSDRKLMRQMSLTEGGIWTWL-----TRSNQFNEQKFAQDMEKVTDFYQNNG
Q5F5W8_NEIG1          IEFEGNQVYSDRKLMRQMSLTEGGIWTWL-----TRSDRFDRQKFAQDMEKVTDFYQNNG
Q7VYC2_BORPE          IRVVGSKAFSEGELLDQFDLTTPGWLTWY-----TNTDKYSREKLEGDIERLRSFYLDQG
Q63T20_BURPS          INFIGNKAFKTSTLRDEMQLSTPNWFSWY-----TKNDLYSKEKLTGDLENVRSYYLNRG
Q8PAW1_XANCP          VNLIGTEKFANEDILENWESKEHNWASWY-----RRDDQYSKEKMSGDLEKLNSWYLDRG
Q9HXY4_PSEAE          INVVGNTVFSEEDLTDLFELKTTNWLSFF-----KNDDKYAREKLSGDLERLRSYYLDRG
Q83DT2_COXBU          IQFVGNRAFSARTLRNQFKLTTPGLFTWI-----SHRDRYSQVKLEEDLQQLSEFYLNHG
Q9ZE03_RICPR          IYFSGNEHYSDSELKSIVLTKESRWFRFLE-----SNDTYDPDRVEYDKELLREFYQSVG
Q5NEP7_FRATT          INFVGNKSFADSDLDSSVAFEVPSIWNLWG--FLAPFDSYSPDGMNQSVQGLTNYYLDRG
Q8D2H0_WIGBR          INFIGNNKFSKKNLINKIELCEYNSSLSF-----FQKCIYQKHKLIKTKNILKNFYFNQG
BAMA_NEORI            IEFEGNTTYSDRVLKHVIRSREKSILRLF-----GTAHYYSREKLEFDKDLLADFYQGKG
Q74AT3_GEOSL          IRFEGNKAFNASKLRGVMETKEKWFLSWL-----TGAGTYKDEVVKNDANLIADLYFNNG
BAMA_DESVH            VKIEGLKELSESEVKDILALSERGMFSWF-----TGTGVLKDELLERDSAAITAYCLNHG
Q0PC08_CAMJE          VHLSGAKKFSYSDIEPAVVNKEKEFMGWMWG---RNDGKLKVFELSNDSSRIADEYMKKG
BAMA_HELPY            SIYEGSAKLKRRMIESLSANKQRDFMGWMWG---LNDGKLRLDQLEYDSMRIQDVYMRRG
                          *        :                              .      :       *

Q2RU01_RHORT          YADFQVKSAIAELSTDRQAFFMTFTVSEGERYRFGPVGLETTLAELDP---EALRGVITF
Q9A711_CAUVC          YFDFRVISSVAELAPDKNGFAVTYTLEEGPKYKFGKITVETELKKLDG---NLLAQILPV
Q89KQ1_BRADU          FADVQVVAALTEYDPEKKGFNVTFKIEEGAQYRVGALDFRSSIPNFDP---NSMRAYSRV
Q89NX1_BRADU          FADAQVVAALTEYDPGRKGFLVTFKIEEGQQYRVGSVDFRSTVPGFDP---AALRSYSRV
A9CJ61_AGRFC          YADFRVVSSDAVLDESKNEYTISITVDEGKKYDFGNVAVESTVPGVDG---SELQGLVET
Q3J2W8_RHOS4          FIDFEVLDATAEVTRERDAFFMTFTVQEGQSYSFGQITASSEVEGIDA---ADFQQALRI
Q5GTM8_WOLTR          YINNSIQP-IAEIDNNNQ-IELTFLIDEGQQYLFGSNKVNVEAEIQDPDLKEKVLELITK
A0A0H3M0B6_EHRRW      FIDFKVKSAVPEITNDKS-VNLVFSVEEGIQYKFGNSNIIIDKQTNNTQLKEELEKLILS
BAMA_ECOLI            YARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSA---EIEQLTK-I
BAMA_SHIDS            YARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSA---EIEQLTK-I
BAMA_SALTY            YARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSA---EIENLTK-I
BAMA_YERPE            YARFNIDSTQVSLTPDKKGIYVTINITEGPQFKLNSVIVSGNLAGHQS---EAEKLTK-I
Q5E3E7_ALIF1          YLKFQVDSTQVSISPDKKGVYIALTIDEGEPYTVSGVKFQGELIGKEE---EFKKLIP-F
Q9KPW0_VIBCH          YLKFQVDSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMGKEA---EFTSLIP-F
Q8EGG7_SHEON          YIRFEVTSTQVAMTPDRKGLYITINVNEGEKYKVKDVNLTGDLMGREE---LMKSILP-I
BAMA_HAEIN            YAKAQITKTDVQLNDEKTKVNVTIDVNEGLQYDLRSARIIGNLGGMSA---ELEPLLSAL
BAMA_NEIMB            YFDFRILDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPK---AELEKLLTM
Q5F5W8_NEIG1          YFDFRILDTDIQTNEDKTRQTIKITVHEGGRFRWGKVSIEGDTNEVPK---AELEKLLTM
Q7VYC2_BORPE          YLEFTVEPPQVTISPDRKDIYITITVHEGEPYKVREVKLAGNLMGL-D---SEINNLVEI
Q63T20_BURPS          YLEFNIESTQVSISPDKKDMYLTVALHEGEPYTVSSVKLAGNLLDR-Q---AELEKLVKI
Q8PAW1_XANCP          YVDFSVDSTQVSISPDKRDMFVSAGVTEGEQYKISEIKVTGDTVLP-Q---ADIERLVIP
Q9HXY4_PSEAE          YINMDIASTQVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVP-E---EEVKRLLLV
Q83DT2_COXBU          YLRFRVVSHDVQWSPDKKHVYITIHLVEGPIYHLSGYTITGETYGFKD----QLYRLVKL
Q9ZE03_RICPR          FADFRVISASVALNDTKEYFTITYSIEEGEKYRFGNVTIDNKLTNINI---KQLNKIVNI
Q5NEP7_FRATT          YLDFKVTSKQASMSKDREHSYITFDVAEGQIYKVGSVSLTGKFILPKS----ELESLVKI
Q8D2H0_WIGBR          YVDFKINFTKVNIIKEKKFVYIDFYLYEGVRYKISEIIFNGYEVTQDL------EDLKKN
BAMA_NEORI            YFDYALEGLEERE--NEDGVVLVFKLKEGARYSFGRVSVVSEKGEIEI---SDLKEKVRI
Q74AT3_GEOSL          YVNVKVGEPQVALNEDKSGLIVTIGITEGDQFRTGAIGYKGDLLEKEE----DLTKVLRL
BAMA_DESVH            YVDALVSAPKVDYE--EDGIIVSFAVKEGPRYKLGKIGFDGELIDTDERLLKVVKLDDHK
Q0PC08_CAMJE          YLDVQVSSPYLKTYTDTYQANLTYFIKEGKPYKIKSISIENPLFDDKQN--AQTVKDLRS
BAMA_HELPY            YLDAHISSPFLKTDFSTHDAKLHYKVKEGIQYRISDILIEIDNPVVPL---KTLEKALKV
                      :    :               :   : **  :                            

Q2RU01_RHORT          KDGDWYSADKVEAAVQKLTDEVGNRGFAFVDVKPRVTRDADKRTIAITFQIDEGPRAFVE
Q9A711_CAUVC          RTGQLYEDERIEQATDALTFAAGAAGFAFVDVRPRYVPNRETKTVDVVFQVREGPRVYVD
Q89KQ1_BRADU          NVGSLYNVESVEKSVEEMQIEASRRGYAFAVVRPGGDRNFEAHTVSVVFNIDEGPRTYIE
Q89NX1_BRADU          NAGSLYNVELVEKSVEDMQIEASRRGFAFAVVRPTGDRNFEAQTVSVVFSIDEGPRTYIE
A9CJ61_AGRFC          RQGASYSAKEVQQSMEAISKRVAGEGYPFARVTPRGDRDMSGNTIGVTYIVDQGERAYVE
Q3J2W8_RHOS4          RRGVTYSPSVVENNIARLESLALQKGLNFVRIEPRITRNERNQTLDVNFALVRGERIFVE
Q5GTM8_WOLTR          EDNKVFDRVKVSNAVEKINKYLNEIGYIFAKVNPEYTQH--GNVVDVTYRVLPGKKIYIN
A0A0H3M0B6_EHRRW      KNKDTFSPETVNNSVERITWHLSNNGNFFSDVKHEYQIK--DGVVDVDYIIYTGNKVYIN
BAMA_ECOLI            EPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVR
BAMA_SHIDS            EPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDVGNRFYVR
BAMA_SALTY            EPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVR
BAMA_YERPE            EPGELFNGSKVTRMEDDIKKMLGRYGYAYPRVVTQPEINDDDKTVKLHINVDAGNRFYVR
Q5E3E7_ALIF1          ENGEVYNGSAVTSLEENIKRILGEAGYAYPQVRTMPEFDDENQTVSLIINVEAGNRMYVR
Q9KPW0_VIBCH          EIGETYNGSAVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVR
Q8EGG7_SHEON          KAGDMYNGGDVTFAEEMYSKYLGRFGYAYPEVKTYPEIDDKTKEVTLNINIKPGKRVYVR
BAMA_HAEIN            HLNDTFRRSDIADVENAIKAKLGERGYGSATVNSVPDFDDANKTLAITLVVDAGRRLTVR
BAMA_NEIMB            KPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVN
Q5F5W8_NEIG1          KPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISVQPLPNAGTKTVDFVLHIEPGRKIYVN
Q7VYC2_BORPE          KPGEVFSAAKANNSAKAITNYLGDLGYAFANVNPNPQLDRAKHEADVTFYVDPSRRVYVR
Q63T20_BURPS          KPGDRFSAEKLQQTTKAIVDKLGQYGYAFATVNAQPEIDQATHKVGLTLVVDPSRRVYVR
Q8PAW1_XANCP          KAGDIFSRALLEYTSDAITNTLSNVGYAFAKVNPIPTPNREDRTVAVNLQVVPGPRVSVR
Q9HXY4_PSEAE          QKGQVFSRKVMTTTSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVN
Q83DT2_COXBU          KRGDIFSRQVIINTNKAIGDFLGDRGYAFARVNVIPTIDDQQHLVHLTFNVAPGERVYVR
Q9ZE03_RICPR          KQGKIFNMKTVDDIAEKIGEYFTANGYPAVNVYPDIKKN-DNHTADIKFIIEKADKVYIN
Q5NEP7_FRATT          KQGEVFSKSKLVQTVEGIKTLLGSKGYAFATVNPIPTVDKDNHIVSFKIVVDAGKKVYVN
Q8D2H0_WIGBR          IINKFYKENDILKIKNLIKKNISKHGYNEPKIFLKIKKSNSNNKIQLLFNVHKGQKLYVN
BAMA_NEORI            REGAVFNIGAVRENALTLLSVLNERGHMFVNVVPEYHPD-ANGRVDLTYHVVSTKKYRIR
Q74AT3_GEOSL          KSGDVFSRANLRTDVMTLTDLYADKGFAFVNVTPLTKVNPETKTVDLTFEFEKGEKVFFD
BAMA_DESVH            KDNQYFALDVMQTDDKLLSDYYADYGYAFAEINSRTQKSAEEHVIDVTYVIRKRQKVYIN
Q0PC08_CAMJE          SAGKTINIEDIRKDVKTIETQSADLGYAFVEVYPDIQKNDQTQEATVVFKVIPHDKVYIR
BAMA_HELPY            KRKDVFNIEHLRADAQILKTEIADKGYAFAVVKPDLDKDEKNGLVKVIYRIEVGDMVYIN
                                               *     :              .   .       . 

Q2RU01_RHORT          RIDINGNVRTLDEVVRREMMLSEGDAFNSAKLRRSRQRIQDLGFFEKVEVNNEPSPTAPD
Q9A711_CAUVC          RIDIVGNTRTLDYVLRRELEVAEGDAYNRVLVDRSKNNMRRLGFFKEVEIEDAPG-SAPD
Q89KQ1_BRADU          RINLRGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLKNLDYFKSVKITTEPG-SSSD
Q89NX1_BRADU          RINVRGNTRTRDYVIRREFDLSEGDAYNRALVDRAERRLKNLDFFKSVKITTEPG-SSSD
A9CJ61_AGRFC          RIEIRGNTRTRDYVIRREFDISEGDAFNQTIITAAKRRLEALGYFSKVNISTAGG-SAPD
Q3J2W8_RHOS4          RIDIEGNTTTLDQVVRRQFRTVEGDPFNPREVRQSAERIRALGYFANADVNTRPG-SSPD
Q5GTM8_WOLTR          QITIDGNDRTLDKVIRSKLSVAEGDAYNTSEVQKSRRRLIGSDFFETVKINSYAI--NDN
A0A0H3M0B6_EHRRW      NINITNNQNTIDRVIRQKLNISEGDIYNASIINRSYKNILGLGFFDSVNVQNHKV--SDS
BAMA_ECOLI            KIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPD
BAMA_SHIDS            KIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPD
BAMA_SALTY            KIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPD
BAMA_YERPE            HIRFEGNDTSKDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGAAD
Q5E3E7_ALIF1          DIRFVGNTSTKDEVLRREMRQMEGAWLNSKSIETGKNRLNRLGFFETVDVQTVRVPGSDD
Q9KPW0_VIBCH          DIRFVGNNSTRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSED
Q8EGG7_SHEON          SINFTGNTVTEDEVMRRELRQMEGAWLNSAQVEQSKARLNRLGFFETVDTETIQVPGTDD
BAMA_HAEIN            QLRFEGNTVSADSTLRQEMRQQEGTWYNSQLVELGKIRLDRTGFFETVENRIDPINGSND
BAMA_NEIMB            EIHITGNNKTRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPD
Q5F5W8_NEIG1          EIHITGNNKTRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPD
Q7VYC2_BORPE          RIQIGGNTRTRDEVVRREMRQQEAAWYDAGDIKVSRDRVDRLGYFNEVNVKTDPVPGSPD
Q63T20_BURPS          RINIVGNTRTRDEVVRREMRQLESSWFDSSRLALSKDRVNRLGYFTDVDVTTVPVEGTND
Q8PAW1_XANCP          RILYKGNSRTSDEVLRREMRQFENTWYSQAAIDRSKIRLQRLGYFESVDVETPAVPGSND
Q9HXY4_PSEAE          RINFRGNTKTEDEVLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDD
Q83DT2_COXBU          RISFFGNQRTDQEVLRREMRQYEGSLYSLSKIEESKRRLELLGYLSDVKYTPQIVPNSPD
Q9ZE03_RICPR          KINIINNLKTEDHVIRRAFKIEEGDVMNRSYIEKGERNLRNLDYFEKVSISLAQT-KAKD
Q5NEP7_FRATT          RINFFGNNVTNDYVFRRQLQYYEQSQYNKEAIDKSQRRLEQLPYVGAADMELVPVAGSDD
Q8D2H0_WIGBR          HINFSGNEYTKEHVIRRNLKQLERSTLEISNIYKDISNLNKLNYIEVIDINIKNAPNMEN
BAMA_NEORI            KINISGNTRTKDTVIRREMLLSENDLYQPSKVADSRRRILNLGFFDEVYIEEHKID--GQ
Q74AT3_GEOSL          RINVSGNTKTRDKVIRRELKVAEGETYSSTGLKQSKQRLMNLGFFEEAAISTVKG-SAEN
BAMA_DESVH            RVLVEGNQKTRDNVVLREMRIADGDMFEGAKLRRSNERLNRTRYFSQVDTELVPTQ-KED
Q0PC08_CAMJE          NVIISGNSRTVDRVIRRELYITEGNLYNRTDLSESKNALKRTSYFDDVNIKEEKV--DDT
BAMA_HELPY            DVIISGNQRTSDRIIRRELLLGPKDKYNLTKLRNSENSLRRLGFFSKVKIEEKRV--NSS
                       :   .*  : :  .   :            :      :    :.               

Q2RU01_RHORT          RTVVKVDVTEKSTGEVSFGVGWSSSVGAIIEVGLRERNLLGRGQDLKASVSWAQR-----
Q9A711_CAUVC          RTSLRVKVEEQPTGELSFSAGYSSIDKLVLDVGITERNFRGRGQNLRARASVGSL-----
Q89KQ1_BRADU          RVILIVDMEEKSTGDFSISGGYSTTDGALAEVSVSERNLLGRGLFAKASVTYGQY-----
Q89NX1_BRADU          RVILIVDLEEKSTGDFSISGGYSTSDGALAEVSISERNLFGRGLYGKASVTYGQY-----
A9CJ61_AGRFC          RVVIVVDVEDQSTGSFGIGAGYSQNDGVLLEASVEEKNFLGRGQYIRVAAGAGEDD----
Q3J2W8_RHOS4          QVVVDVNVEEQPTGSLSFGVSYGVSSGVGFSIGFSEQNFLGRGQILGVDVSTGTD-----
Q5GTM8_WOLTR          AVNLDLNVKEKNTTSLYLGGGVSFPGGAFIKTDFKDRNLFGTGKELSFALEKSQY-----
A0A0H3M0B6_EHRRW      LVDLNFQVKEKGTGSFDIAAGFSSITGLVGKINIQERNLFGTGKILSLHLEKSSS-----
BAMA_ECOLI            QVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDY-----
BAMA_SHIDS            QVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDY-----
BAMA_SALTY            QVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDY-----
BAMA_YERPE            LVDVTYKVKERNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDY-----
Q5E3E7_ALIF1          EVDLVYSVKEANSGSVNFGVGYGTESGISFQVGLQQDNFIGSGNRVGINAMMNDY-----
Q9KPW0_VIBCH          QVDLVYSVKEANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMINDY-----
Q8EGG7_SHEON          LVDVAVKVKEQPSGSFNAGVGYGTESGLSLQFGVQQNNFLGTGNQAGVSLSTNKY-----
BAMA_HAEIN            EVDVVYKVKERNTGSINFGIGYGTESGISYQASVKQDNFLGTGAAVSIAGTKNDY-----
BAMA_NEIMB            KVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKT-----
Q5F5W8_NEIG1          KVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKT-----
Q7VYC2_BORPE          QVDVNVDVKEKPTGIINLGVGYGSSEKAILSAGISEDNVFGSGTNLTLQLNTSKT-----
Q63T20_BURPS          QVDVNVKVAEKPTGAITLGAGFSSTDKVVLSAGISQDNVFGSGTSLAVNVNTAKS-----
Q8PAW1_XANCP          QVDVVYNVKETTSGSFVFGLGFSQAFGVTTSVQLSQNNFLGGGNRVAVEASRSTF-----
Q9HXY4_PSEAE          QVDVNYSVEEQPSGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGLTRSEY-----
Q83DT2_COXBU          QVDLNYHVKEIAAGRASIQGGYSDVYGFLYGASISEPNFMGTGKYVSIGFQNSQY-----
Q9ZE03_RICPR          KYDVNVEVDEKSTSSIGFDLGYNTAGGLFGRFSFLERNLVGTGKLLNAGVQVSKN-----
Q5NEP7_FRATT          LVDVNYNIKERNANSISGSLGFSDLYGFMIGGRLNMPNVFGTGNTFNLNAQLSIP-----
Q8D2H0_WIGBR          YLDIFYKIKENNIGKINFGIGFGEQNKINFNFKISKKNIFGSGNFIEINGEKNYH-----
BAMA_NEORI            NLILEVRVKERPTGTLNLSGGYGSDVGFFGNFSFVENNLFGTSDRLVVELQKASL-----
Q74AT3_GEOSL          KLDVNIEVKEKPTGTFSIGAGYSSLDGLIGQGSVSQGNFLGLGLRANLAASIGGK-----
BAMA_DESVH            EVDLKVKVKEQNTGALIGGVGYSTFYQFGVSGTIMERNLFGKGYYASLQAFFSGK-----
Q0PC08_CAMJE          HIDLIVDVKEASTGAISGGIGYGSSDGILLNASLSDTNIFGSGIKSSVSVDKSDD-----
BAMA_HELPY            LMDLLVSVEEGRTGQLQFGLGYGSYGGLMLNGSVSERNLFGTGQSMSLYANIATGGGRSY
                         :   : :          .            .   *  * .                 

Q2RU01_RHORT          ---------RSQVDISFTEPYFLDRRLRAGVDLYAIERDLKKESS---------------
Q9A711_CAUVC          ---------RQQIDFGFSEPRFLGRNLVAGVNLYTFRYDLSEFAA---------------
Q89KQ1_BRADU          ---------ARGYSLSFVEPYLLDYRVALGLDLYQREQKSNSYIS---------------
Q89NX1_BRADU          ---------SRGVTLSFVEPYLLEQRIALGLDLSYRQQKANSYTS---------------
A9CJ61_AGRFC          ---------ARTYSLSFTEPYFLGYRLAAGFDLFKNQSKSEDYYN---------------
Q3J2W8_RHOS4          ---------NVNTQLNFVEPSFLGRDLRFRFNAYYRETD-NQYSR---------------
Q5GTM8_WOLTR          ---------VFSTNVEVVENNFNDSDTSLGVDVFYERQDKP-----------------NT
A0A0H3M0B6_EHRRW      ---------SLSSSIDFAVPNFLETDSAVGFGLFYSQQNKPSMEKINSSFIEIMKDNSDA
BAMA_ECOLI            ---------QTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDA--------------DLS
BAMA_SHIDS            ---------QTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDA--------------DLS
BAMA_SALTY            ---------QTYSELSVTNPYFTVDGVSLGGRIFYNDFQADDA--------------DLS
BAMA_YERPE            ---------QTYAEFTLMDPYFTVDGVSLGGRIFYNDFKADNA--------------DLS
Q5E3E7_ALIF1          ---------QKNISLDYRDPYWNLDGVSLGGKIFYNEFEASDA--------------GIV
Q9KPW0_VIBCH          ---------QKNLTLEYRDPYWNLDGVSLGGKVFYNQFEASEA--------------GIV
Q8EGG7_SHEON          ---------SKNVNLSYTDPYWTKDGVSLGGSVYWNEFDANEA--------------NLE
BAMA_HAEIN            ---------GTSVNLGYTEPYFTKDGVSLGGNVFFENYDNSKSD-------------TSS
BAMA_NEIMB            ---------TLNGSLSFTDPYFTADGVSLGYDVYGKAFDPRKAST------------SIK
Q5F5W8_NEIG1          ---------TLNGSLSFTDPYFTADGVSLGYDIYGKAFDPRKAST------------SVK
Q7VYC2_BORPE          ---------NRAVVLSHTDPYFTKDGISRTTSAYYRVTEPWD-NN------------DGD
Q63T20_BURPS          ---------YRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYST------------NSS
Q8PAW1_XANCP          ---------QQRYAFSYTNPFFTDDGVSLGYNLSWRELDYS--DF------------NTA
Q9HXY4_PSEAE          ---------QTRYNFGFVDPYWTVDGVSLGYNAFYRKTDYDELDV------------DVA
Q83DT2_COXBU          ---------QQNYSFVYNNPYYTTWGLQRGFSIYYSRVKPNTKFN-------------LS
Q9ZE03_RICPR          ---------STSYYGCITDPHFLDRDLSLSVNAFRNYTGRGASVL----------NTTDQ
Q5NEP7_FRATT          ---------FQQLDISYIDQFFTTSGVSQSISAYINRSNFAKTNA-------------VA
Q8D2H0_WIGBR          ---------HTHAEMFFFNPYIKLNGTHANGKIFFNNFNLNNSYK--------------N
BAMA_NEORI            ---------GSNYSMEFQRKRIFDTFITAGASVFYKNRNEKANGL---------------
Q74AT3_GEOSL          ---------SSTFNLGLTDPYFLDTRWTLGGDLYRTERDYLD------------------
BAMA_DESVH            ---------RNSFIASFTNPRVNDGDLSFGNDAYISREYFDD------------------
Q0PC08_CAMJE          ---------TLSGRISLVNPRVLDSQYSLGGTLYSNDYEWDNYSE---------------
BAMA_HELPY            PGMPKGAGRMFAGNLSLTNPRIFDSWYSSTINLYADYRISYQYIQ---------------
                                                                                  

Q2RU01_RHORT          -YDYRTYGTALRLGYNYNENLGHTFKYTAEFNEITDVKS-----DASRFIK---------
Q9A711_CAUVC          -YDTKSVGGDVRFGFPLTNDSSMSLRYTVRQDEVSVADSLCASGSVSQILC---------
Q89KQ1_BRADU          -YGTKTLGFSPRLGFSLREDLALQLRYSIYRQEITLPFYLANCNNIAGPA---FNPSPAF
Q89NX1_BRADU          -YGVTTLGLSPRVGLALREDTSLQLRYSLYQQRIELSSAYNNCNNNASNASLAYNPTPAY
A9CJ61_AGRFC          -YDEQ--GFALRVTAPITENLSTTFKYTYKQINYEGKGDWQNNANLAEPY----------
Q3J2W8_RHOS4          -YDTRKIGISPSIEFPVSDSGRLELRYTLSEDKISNVDGGPNDTDDDDDVS---------
Q5GTM8_WOLTR          TFDSCDWGGIAQLLHKIIENLTNSIRYSYKYNHIHMDNKGGKDEDISEIIR---------
A0A0H3M0B6_EHRRW      AFSSSSAGLILHTSHNITDDLGLSLNYSYKHVNIFN-----VKDTASEIIK---------
BAMA_ECOLI            DYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQD
BAMA_SHIDS            DYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQD
BAMA_SALTY            DYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGQSADTS---
BAMA_YERPE            GYTNSSYGADGTLGFPINENNSLRVGVGYVHNDLSDMLPQVAMWRYLESVGERPGYDGRE
Q5E3E7_ALIF1          DYTNQSYGGSLTWGFPFDELNYFEIGVGYTHNKISNLEGYVQIEQYLQSVGDAYDSGDQ-
Q9KPW0_VIBCH          DYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNLTPYLQVENFLAAQASNIDSGG--
Q8EGG7_SHEON          RYKNSSYGVALNSGFPINEYNRINGGIGYRHNTISEISAYEQALRFYNIYRDDDPNAD--
BAMA_HAEIN            NYKRTTYGSNVTLGFPVNENNSYYVGLGHTYNKISNFALEYNRNLYIQSMKFK-GNG---
BAMA_NEIMB            QYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVNT-YNKAPKHYADFIKKYGKTDGTDG
Q5F5W8_NEIG1          QYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHLTVNT-YNKAPKRYADFIRKYGKTDGADG
Q7VYC2_BORPE          -YRVKAMGLGMNFGVPISEYDRIFLGGTFERNQIDL-YNNSPQAYRDFVDQYG-------
Q63T20_BURPS          -FRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDV-DSNTPQSYQDYVNEFG-------
Q8PAW1_XANCP          QFNSTNGSAQVVFGVPITENDTVSAMIGVDSNQITTFPGTTPQAIVDYIQAIGT------
Q9HXY4_PSEAE          SYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDT-GRYTVDEIYDFLDKEG-------
Q83DT2_COXBU          SYVEDGYGADVTYAYPISERNSIGFGYGFEHIKISQLDPAIAAPSVLAFLGTTNGVQNT-
Q9ZE03_RICPR          SYKLHSIGVKISLGYDMKEDLSHEIDYLIKRDILSAPSPSNSIFLNEQMGK---------
Q5NEP7_FRATT          AYQLDTIGARLMYGVPISTFSNVSGGITFANNTVKQSDGYQSSIVQWFIQQQGG------
Q8D2H0_WIGBR          NYNLYNYGLSSNIIMPEYKNNIIDFGLEYTHNKAIQMNSHSDIWNYFNDIKKYNSLLSKE
BAMA_NEORI            -YKFSSVGGDGSVSYSLRDDLRLHLGYSLSFDKIFDVEGDAPESVKSSAGT---------
Q74AT3_GEOSL          -FTRRATGGDIKAGYPLSDTLRTLWVYKYEQKEIFDISPALRVVPETNSTT---------
BAMA_DESVH            -FSKNTIGDTIRFALPVGEYSTVGWGYRLDRYELYDIDDDAAKIIKEREGE---------
Q0PC08_CAMJE          ----KNYGFDITIGRQFARYYNVSLTYNLEQSDIYHLSPTLLRTGYELGKS---------
BAMA_HELPY            ----QGGGFGVNVGRMLGNRTHVSLGYNLNVTKLLGFSSPLYNRYYSSVNEVVSPRQCST
                             .                                                    

Q2RU01_RHORT          --------------------------------------NQDDKTYLSMIGHVLTYDRRDS
Q9A711_CAUVC          --------------------------------------LQRGAYITSLIGYGLRIDKRND
Q89KQ1_BRADU          AASQVPPIDL-------SSTNGLGCYSDGEASLPVRKELANGKTLTSALGYSLSYNTLDN
Q89NX1_BRADU          IKNVLGGVDPVY--SSDSSYYGYGCYGDGESSLPVRKELSDGASWTSAVGYTLTYNTLDN
A9CJ61_AGRFC          -----------------------------------QALIRGEDWTQSILSNTLNYNTLDD
Q3J2W8_RHOS4          -------------------------------SIILINEEARGALIASSVGYTYSWDSNRG
Q5GTM8_WOLTR          --------------------------------------SQQGEYQISSVGYTLAYNKLDN
A0A0H3M0B6_EHRRW      --------------------------------------EQAGKNVDSSVGYSLQFRKFDN
BAMA_ECOLI            N---------------------------------------SFKTDDFTFNYGWTYNKLDR
BAMA_SHIDS            N---------------------------------------SFKTDDFTFNYGWTYNKLDR
BAMA_SALTY            ----------------------------------------SFAADDFTFNYGWTYNKLDR
BAMA_YERPE            ----------------------------------------GFTTDDFTLNLGWTYNNLDR
Q5E3E7_ALIF1          ----------------------------------------TLIVSDFDVTLSWTRNNLNK
Q9KPW0_VIBCH          ----------------------------------------NLLTDDFDINLSWTRNNLNN
Q8EGG7_SHEON          -----------------------------------------LSFDNFELSLGWYRSTLNR
BAMA_HAEIN            -----------------------------------------IKTNDFDFSFGWNYNSLNR
BAMA_NEIMB            ----------------------------------------SFKGWLYKGTVGWGRNKTDS
Q5F5W8_NEIG1          ----------------------------------------SFKGLLYKGTVGWGRNKTDS
Q7VYC2_BORPE          -----------------------------------------NSTNALIFNTGWSKDTRDS
Q63T20_BURPS          -----------------------------------------RVSNTVPLTIGWSRDARDS
Q8PAW1_XANCP          -----------------------------------------DTFKAVRTEFGWARDTRND
Q9HXY4_PSEAE          -----------------------------------------DNFTNFKASIGWSESTLNK
Q83DT2_COXBU          ----------------------------------------SRDYNQFKLNGGWTYNGLDR
Q9ZE03_RICPR          -------------------------------------------LITSAIGHTITYDQTDN
Q5NEP7_FRATT          ----------------------------------------RNNFNEPALTAGWSYDNSNK
Q8D2H0_WIGBR          K-----------------------------------NKTSDFKSDDIFFIFNWNYNTIDK
BAMA_NEORI            -------------------------------------------KILSAVSYSLFLNKLDN
Q74AT3_GEOSL          ----------------------------------------------SSIYVSLTRDTTDY
BAMA_DESVH            -------------------------------------------NISSVAHVRFTRDTTDS
Q0PC08_CAMJE          --------------------------------------------IKSSITPAITFNDTDD
BAMA_HELPY            PASVIINRLSGGKTPLQPESCSSPGAITTSPEIRGIWDRDYHTPITSSFTLDVSYDNTDD
                                                                                  

Q2RU01_RHORT          KLDPKDGYVLSLGNDMAGLG------------GSEYFLRSDAKAAYYAPIGDWFDWNPTW
Q9A711_CAUVC          PINPTRGWFADLNQDLAGVG------------GDVKYLKTEADAGWY------WGFTKDL
Q89KQ1_BRADU          NKNPTDGLLVDFRQDFAGVG------------GDVTYLKSVIDAKYYTPLVSDIVAVARL
Q89NX1_BRADU          NKNPTDGLLIDWRQDFAGVG------------GNVSYLKTAVDGKYYAPLVAEIVGLLHL
A9CJ61_AGRFC          RNMPREGWQAALTNEFAGLG------------GDSEYYKIYAKARYYYTLSDEYDVIGSL
Q3J2W8_RHOS4          GLNPTGRNLLRFSQDFAGVG------------GDVEYVSTTALAMAERKVWNEEVTVRAI
Q5GTM8_WOLTR          LYAPREGYLLRLSQDISGLG------------GNMNFLKSEFLSFYTHPILSKIDDDIIL
A0A0H3M0B6_EHRRW      VSKIHDGYLLKLRQNFSGIG------------GTLHYIKTEGSVHYSKELLPKLSSDILL
BAMA_ECOLI            GYFPTDGSRVNLTGKVTIPG------------SDNEYYKVTLDTATYVPIDDDHKWVVLG
BAMA_SHIDS            GYFPTDGSRVNLTGKVTIPG------------SDNEYYKVTLDTATYVPIDDDHKWVVLG
BAMA_SALTY            GYFPTDGSRVNLTGKVTIPG------------SDNEYYKVSLDTATYVPIDNDHKWVVLG
BAMA_YERPE            GFFPTSGVKSSVNTKITVPG------------SDNEFYKVTFDTSAYQPLNEDRSWVLLG
Q5E3E7_ALIF1          GYFPTAGNYQRASYKITTPN------------SDSQFFKAQYEVRQYFPLTKKHEFALLM
Q9KPW0_VIBCH          SYFPTAGNHQRAFYKMTVPG------------SDAQYFKLQYDVRQYFPLTKKHEFTLLL
Q8EGG7_SHEON          GTFPTDGSSQRLSGKMTVPA------------SDLQYFKTDFDTNYYFPINRSQSFVLLA
BAMA_HAEIN            GYFPTKGVKASLGGRVTIPG------------SDNKYYKLSADVQGFYPLDRDHLWVVSA
BAMA_NEIMB            ALWPTRGYLTGVNAEIALPG------------SKLQYYSATHNQTWFFPLSKT--FTLML
Q5F5W8_NEIG1          ASWPTRGYLTGVNAEIALPG------------SKLQYYSATHNQTWFFPLSKT--FTLML
Q7VYC2_BORPE          ALAPTKGAYTRLKGDFSTM--------------DLKYYLLTAQQQYYLPLGRS--YTLAL
Q63T20_BURPS          ALIPSRGYFTQANAEYGVPV------------GKIQYYKMDVQGQYYYSFARG--FILGL
Q8PAW1_XANCP          FFMPTRGMYQRVGLETTLPG------------STVEYYKLNYQISNYWPIIPA--IVLNT
Q9HXY4_PSEAE          GVLATRGHSQSLTLETTLPG------------SDLSFYKIDYRGQVFAPLTDN--YTMRF
Q83DT2_COXBU          AIFPTKGLYTGIGLEIGVPV------------LKSSLGYYLATYSAKYYQPIWHGFILNL
Q9ZE03_RICPR          KIVPKNGYLVSGTQEFAGVG------------GDNKYIKHEIECKFYKSFINNKVTLKLS
Q5NEP7_FRATT          YIFATDGGSFNLNGSVNIPVI-----------SNINAYKIEVGGTYNIAVPNTDMSALTI
Q8D2H0_WIGBR          EYFSTSGLFNNINSKFTVPG------------SGNSYFKILINSKYFIPLSIDNKLIFMM
BAMA_NEORI            YFVPRYGYGVRFGNKFAGIG------------GDVKFLRSDFKAGGFVSVFDQSAVLSLI
Q74AT3_GEOSL          RLDPTRGMVNNLSVEFAGLG------------GTNRFLRYYGDTSVFFPTGFG--TVLSL
BAMA_DESVH            KEKPTKGTIFKTFNEFGGGPIG----------GDDDFIKPVVEFQAYHQLAPNHVLHGRT
Q0PC08_CAMJE          YYLPRSGIIASTSLEYAGLG------------GDQEFISSSSKFNFYQGLQDYIGYDLIY
BAMA_HELPY            YYFPRNGVIFSSYATMSGLPSSGTLNSWNGLGGNVRNTKVYGKFAAYHHLQKYLLIDLIA
                                                                                  

Q2RU01_RHORT          GLTVKGGAGYMFGL---------------GKD-VNINQRYNLGGTNLRGFANAGASPRD-
Q9A711_CAUVC          VFSATGSFGYIEGW---------------GGDNVRINDRFYRGGTSFRGFEIAGIGPRDI
Q89KQ1_BRADU          QSGILTKMGS----------------------DLRMLDHFQMGPNLVRGFAPNGIGPRDL
Q89NX1_BRADU          QGGVLNKVGDK---------------------DLRMLDHFQMGPNLVRGFASNGIGPRDI
A9CJ61_AGRFC          TGQAGHVMPTGD--------------------NLLVFDQFKFGGRQVRGFKNDGIGPR--
Q3J2W8_RHOS4          IEGGALSMIGDD--------------------PSRVTDRFFGNGK-IRGFEPNGIGPRDL
Q5GTM8_WOLTR          RFKMAAGYIFSYT----------------DKEL-NIGQRFFKGGNEIRGFDLSGIGPRAK
A0A0H3M0B6_EHRRW      SIKASMGYVFSYK----------------DDEIVKISQRFIIGGNEIRGFHQSGIGPRDK
BAMA_ECOLI            RTRWGYGDGLGGKE------------------MPFYENFYAGGSSTVRGFQSNTIGPKAV
BAMA_SHIDS            RTRWGYGDGLGGKE------------------MPFYENFYAGGSSTVRGFQSNTIGPKAV
BAMA_SALTY            RTRWGYGDGLGGKE------------------MPFYENFYAGGSSTVRGFQSNTIGPKAV
BAMA_YERPE            RGRLGYGDGIGSKE------------------MPFYENFYAGGSSTVRGFRSNNIGPKAA
Q5E3E7_ALIF1          RGKAGYGNGYGQTDG-------------NDNLYPFYENFYAGGFTTLRGFGSNSGGPKAV
Q9KPW0_VIBCH          RGRLGYGNGYGQTDG-------------KDNLFPFYENFYAGGFTSLRGFGSNSAGPKAV
Q8EGG7_SHEON          RGRLGYGNGYGQYND-------------NDQILPFWENYYSGGSSSLRGFKSNSVGPRSF
BAMA_HAEIN            KASAGYANGFGNKR------------------LPFYQTYTAGGIGSLRGFAYGSIGPNAI
BAMA_NEIMB            GGEVGIAGGYGRT-----------------KEIPFFENFYGGGLGSVRGYESGTLGPKVY
Q5F5W8_NEIG1          GGEVGIAGGYGRT-----------------KEIPFFENFYGGGLGSVRGYESGTLGPKVY
Q7VYC2_BORPE          NGMIDYGRSYGGL------------------DYPVIKNVYAGGIGTVRGYEGASLGPRDR
Q63T20_BURPS          NFQAGYGNGIGN-------------------PYPIFKNYYAGGIGSVRGYEPSSLGPRDT
Q8PAW1_XANCP          RFELGYGDSYGKDSSGVITNADGTTRPVTATGLPFYENFYAGGTNSVRGFEDNTLGPRSE
Q9HXY4_PSEAE          HTELGYGDGYG-----------------STERLPFYENYYAGGFNSVRGFKDSTLGPRST
Q83DT2_COXBU          LATVGYGDGFGHDR------------------LPFFKNFYAGGIGSVPAFSPNSLGPKNR
Q9ZE03_RICPR          AAGGDMAGLGGK--------------------MVRISDRFNLGDYSLRGFASGGVGPREK
Q5NEP7_FRATT          RAGVQYGGGYGKTK-----------------QLPFYENFYGGGWGSVRGFLQGSLGPRDI
Q8D2H0_WIGBR          KTNLGYLHKMHRKK------------------IPFYEKFYTGGYDSVRGFYHNTISPKLI
BAMA_NEORI            VRAGNIFGYSGQG----------------------VDVANRFFLNEMRGFDNLGIGPRDV
Q74AT3_GEOSL          RGTLGYIQGLGGKD------------------ISIDERFFAGGINTLRGFEGRSVSPSII
BAMA_DESVH            RGGAVLENGQGD--------------------VPVFERFYIGGIDSIRGYNSRDISPRDP
Q0PC08_CAMJE          RYKASFYKVWDEGY------------------LPINQRIYLGGIRSIRGFESRTVSPKNQ
BAMA_HELPY            RFKTQGGYIFRYNTD---------------DYLPLNSTFYMGGVTTVRGFRNGSVTPKDE
                                                                    . .:      *   

Q2RU01_RHORT          ----------------------------ADTDDALGGNWVTTGSVEVAVPL-GLPAE--L
Q9A711_CAUVC          ----------------------------SSSFNSMGAKLYAISTFELTVPT-FLPEQ--Y
Q89KQ1_BRADU          NP-----------------------F---GTQDALGGTKYWGASMELQMPFWFLPKE--V
Q89NX1_BRADU          SY-----------------------ASFGATGDALGGTKYWGASAELQMPFWFLPKE--V
A9CJ61_AGRFC          -----------------------------IGSDSIGGTTYFAASAEVTAPMPGVPED--F
Q3J2W8_RHOS4          NV-----------------------S----NEDALGGNYFAVARLEADFPL-GLPEE--Y
Q5GTM8_WOLTR          D----------------------------KNKSSLGGKTYFNLTQQVDFPLPKLYDY--V
A0A0H3M0B6_EHRRW      -----------------------------KSLDALGGKFYFSIINQVDFPI-GLPED--L
BAMA_ECOLI            YFPHQASNYDPDYDYECATQDGAKD--LCKSDDAVGGNAMAVASLEFITPTPFISDKYAN
BAMA_SHIDS            YFPHQASNYDPDYDYECATQDGAKD--LCKSDDAVGGNAMAVASLEFITPTPFISDKYAN
BAMA_SALTY            YKNGAHTSWDDNDDYEDCTQESG-----CKSDDAVGGNAMAVASLEFITPTPFISEKYAN
BAMA_YERPE            YYANGGATVT-------------------NSTDAVGGNAMAVASIELITPTPFISEKYSN
Q5E3E7_ALIF1          YAQGSNGGIGNNTSY-------------AATDDSVGGNATALASIELIVPTPFASEETRN
Q9KPW0_VIBCH          YRDYSGS---NNGSD-------------TATDDSVGGNAIALASVELIVPTPFASEEARN
Q8EGG7_SHEON          YLFRGSEPCSPDPSGDGCSLPGDPNKIQVSSGRSIGGNAIATASLELIVPTPFLDEAYTN
BAMA_HAEIN            YAEHGNGNGTFKK----------------ISSDVIGGNAITTASAELIVPTPFVSDKSQN
BAMA_NEIMB            DEYGEK--------------------------ISYGGNKKANVSAELLFPMPGAKD--AR
Q5F5W8_NEIG1          DEYGEK--------------------------ISYGGNKKANVSAELLFPMPGAKD--AR
Q7VYC2_BORPE          LTGDYI-----------------------------GGSRRMVANAQLYLPFPGASK--DR
Q63T20_BURPS          KTNDPI-----------------------------GGSKMVVGNIELTFPLPGTGY--DR
Q8PAW1_XANCP          AINGFN-------------RG-----------QPLGGSLKTVGSVEMYFPKLFD----SP
Q9HXY4_PSEAE          PSVARNPDGTPMKNQGPDSKGRYTD--PDQDPEAFGGNILITGGAELLFPLPFVKD--QR
Q83DT2_COXBU          ----------------------------YNSFGAIGGNLETIFGVHLILPQFISER----
Q9ZE03_RICPR          N-----------------------------TNEGLGGERYYTFSTELNFPTPVPEEF---
Q5NEP7_FRATT          NLVNGE------------------------VGNSIGGNLNIYNNYDVLFPVPFIKDS--S
Q8D2H0_WIGBR          SEKCEKYKKCIDL----------------NDDYIIGGDILTTSNIELILPTPFIKNQYNN
BAMA_NEORI            E-----------------------------TDDALGGNFFILGTAEVQVPMRLPVEL---
Q74AT3_GEOSL          TYVPTTDPLTGLPTTN-------------PERAFVGGDKEAILNVEYTIPLLKDAG----
BAMA_DESVH            E-----------------------------SGDRIGGDRMAFVNLEYIWVFKPDLG----
Q0PC08_CAMJE          ------------------------------WGDEIGGTIAFANSVELSFPLIDRIK----
BAMA_HELPY            ------------------------------FGLWLGGDGIFTASTELSYGVLKAAKMRLA
                                                         *.        .              

Q2RU01_RHORT          GLSGRLFSDFGMIGKPDDFDEALMDGAVSP------------------------------
Q9A711_CAUVC          GIKAALFSDVGTAGLLDDVDRQRSPGVFDPN----------------------IKDNLGL
Q89KQ1_BRADU          GLKGAVYADAGGLYDYQGPTTWSATGETTTTRNSNCIPSTINPATAGTCTGLVYDDSKVI
Q89NX1_BRADU          GLKGAVYADAGSLWDYQGPTSWSATGEVNSAACPTC--------------GLQYDDSKVI
A9CJ61_AGRFC          GLRLAGFVDAGTMYGNKVSTSQTVK------------------------------DDNSI
Q3J2W8_RHOS4          GFSGGVFADAGSVWSLDDVGGGSTGDDTVD-------------------------DDFHI
Q5GTM8_WOLTR          GIKGSLFVDYATLFGLDIKKEYEGKYHDSKL----------------------------V
A0A0H3M0B6_EHRRW      GIKGSLFVDAATLFGLDYTDK---EYYESKS----------------------------L
BAMA_ECOLI            SVRTSFFWDMGTVWDTNWD--------SSQYSGYPDYS-----------------DPSNI
BAMA_SHIDS            SVRTSFFWDMGTVWDTNWD--------SSQYSGYPDYS-----------------DPSNI
BAMA_SALTY            SVRTSFFWDMGTVWDTNWDP-------SSAPSDVPDYS-----------------DPGNI
BAMA_YERPE            SVRTSIFIDSGTVWDTNWENT-----AKTRAAGIPDYG-----------------KASNI
Q5E3E7_ALIF1          QIRTSVFFDMASVWDTEFDYKEPKP-GMDGAQYYYDYS-----------------DPSNF
Q9KPW0_VIBCH          QIRTSIFYDMASVWDTEFDYRGKAD---YGNQYYYDYS-----------------DPTNY
Q8EGG7_SHEON          SVRTSFFVDAGNVWDTEFDYAKYQTLPAEEFDKLQDYS-----------------DPARI
BAMA_HAEIN            TVRTSLFVDAASVWNTKWKSDK-SGLDNNVLKSLPDYG-----------------KSSRI
BAMA_NEIMB            TVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYGAGN-----------THKSTFTNEL
Q5F5W8_NEIG1          TVRLSLFADAGSVWDGRTY----TAAENGNNKSVY-SEN-----------AHKSTFTNEL
Q7VYC2_BORPE          TLRWFVFTDAGQVAAGSGMSCTAGKPDSEVE------------------------DPCGW
Q63T20_BURPS          TLRVFTFLDGGNVWGNAPGGTSTG--------------------------------ANGL
Q8PAW1_XANCP          SARISAFFDFGNVY---------SDVDAF--------------------------KANEL
Q9HXY4_PSEAE          QLRTVLFWDVGSTFDTDCPTKTTTNCDGI--------------------------KTDNL
Q83DT2_COXBU          -VRTAIVFDAGNVFQVPRFPGDIAVPARATIPDPEAATRPQIIQ-------NDRFSLKNL
Q9ZE03_RICPR          NFTGAVFIDLGSVWGVGLNKKQYKTPNGFYN-------------------------DQSL
Q5NEP7_FRATT          KMRIGAFLDIGNTYTTYNLNGVVAPQPKQETTP----------------------SFSNL
Q8D2H0_WIGBR          LIRTSLFLDLGNSWNKSSNDNFLIQNEINNVKYIK---------------------SDRI
BAMA_NEORI            DLKAAFFYEVGTLTGVDVTTEKVYD-------------------------------SHAL
Q74AT3_GEOSL          -LKGVLFFDAGNVYGENQD------------------------------------MFSSV
BAMA_DESVH            -LALVPFFDMGINYDSSAEFNW----------------------------------DDEL
Q0PC08_CAMJE          -LRGSVFFDYGMIGRKN--------------------------------------LDEIK
BAMA_HELPY            WFFDFGFLTFKTPTRGSFFYNAPVTTANFKDYGVIGAGF----------------ERATW
                                                                                  

Q2RU01_RHORT          RLSAGAGVTWVSPVG-PISVDLGYPLVKEK-----------------FDKTEVFRLSFGS
Q9A711_CAUVC          RASAGISIDWKSPMG-PIRFDISRILSKED-----------------YDRTETFRFSTST
Q89KQ1_BRADU          RSSVGVGLIWQSPFG-PLRFDYAVPLSKGK-----------------YDRTQEFRFGGGT
Q89NX1_BRADU          RSSVGVGLIWQSPFG-PLRFDYAIPLTKGK-----------------YDTVQQFRFGGGT
A9CJ61_AGRFC          RASAGIGVMWASPFG-PIRVDYAIPIAKED-----------------YDEEQRFRFGMSN
Q3J2W8_RHOS4          RSSVGVSLFWTTPIG-PLRFNFAKAIEKQD-----------------YDKEQFFDLTIST
Q5GTM8_WOLTR          RVSPGFGFSMPSPFGGRFRLDFGFPLAKEP-----------------YDIIPSSNIKFSI
A0A0H3M0B6_EHRRW      RLSAGFGFSWRSPFG-PMRLDFGFPILKED-----------------YDVV--DIIRFSM
BAMA_ECOLI            RMSAGIALQWMSPLG-PLVFSYAQPFKKYD-----------------GDKAEQFQFNIGK
BAMA_SHIDS            RMSAGIALQWMSPLG-PLVFSYAQPFKKYD-----------------GDKAEQFQFNIGK
BAMA_SALTY            RMSAGIALQWMSPLG-PLVFSYAQPFKKYD-----------------GDKAEQFQFNIGK
BAMA_YERPE            RVSAGVALQWMSPLG-PLVFSYAKPVKDYE-----------------GDKSEQFQFNIGK
Q5E3E7_ALIF1          RSSYGAAVQWMSPMG-PLVFSIAKPVKIYE-----------------GDDEEFFSFTIGR
Q9KPW0_VIBCH          RSSYGVALQWVSPMG-PLVFSLAKPIKKYE-----------------GDDEEFFTFTIGR
Q8EGG7_SHEON          RASWGVSLQWLSPMG-PMVFSLAWPVKEYE-----------------GDQTEIFSFNIGK
BAMA_HAEIN            RASTGVGFQWQSPIG-PLVFSYAKPIKKYE-----------------NDDVEQFQFSIGG
BAMA_NEIMB            RYSAGGAVTWLSPLG-PMKFSYAYPLKKKP-----------------EDEIQRFQFQLGT
Q5F5W8_NEIG1          RYSAGGAVTWLSPLG-PMKFSYAYPLKKKP-----------------EDEIQRFQFQLGT
Q7VYC2_BORPE          RFSAGIGLSWQSPLG-PLQLSYARPLNSKS-----------------GDDTQAFQFQIGT
Q63T20_BURPS          RYGYGIGLAWISPIG-PLKLSLGFPLQKHE-----------------GDQYQKFQFQIGT
Q8PAW1_XANCP          RASTGVALLWRAPVG-PISISYAFPLKKED-----------------NDEIERLQFTFGG
Q9HXY4_PSEAE          ASSVGVGLTWITALG-PLSFSLATPIKKPD-----------------NAETQVFQFSLGQ
Q83DT2_COXBU          RPSLGLAVEWYTPLA-PIDLTLAFPLNRRP-----------------GDNFQAFQFSFGV
Q9ZE03_RICPR          RASVGFGFIWVTRFA-PIRMDWGFPIKKKQ-----------------YDDTQNFHLRFST
Q5NEP7_FRATT          KYSVGVEFRWASPMG-PLAVSFAQPFNVQK-----------------GDITQVFQFSLGQ
Q8D2H0_WIGBR          RISSGIFLQWISPFG-LVSLSYAIPIKKII-----------------NDRIEPIQFNIGK
BAMA_NEORI            RSSVGAGLVWNSPFG-VLRVDVAKALVEGK-----------------GDKVKTVKFGIVS
Q74AT3_GEOSL          LMSYGAGIRWVSPMG-PLRLEYGIPLNPRDG---------------IDKSSGRFEFSIGS
BAMA_DESVH            KKSVGLEMRWRSPMG-DLRFAYGFPLDEGRD---------------GEQHSGRFEFSMGQ
Q0PC08_CAMJE          RMSTGIGIEWITPIG-PLQLVFAKPLNDKK-----------------GDDTNSFEFNLGT
BAMA_HELPY            RASTGLQIEWISPMG-PLVLIFPIAFFNQWGDGNGKKCKGLCFNPNMDDYTQHFEFSMGT
                        . *  .   : ..  . .     .                             :    

Q2RU01_RHORT          RF--
Q9A711_CAUVC          RFQ-
Q89KQ1_BRADU          SF--
Q89NX1_BRADU          SF--
A9CJ61_AGRFC          TF--
Q3J2W8_RHOS4          RF--
Q5GTM8_WOLTR          EVGI
A0A0H3M0B6_EHRRW      Q---
BAMA_ECOLI            TW--
BAMA_SHIDS            TW--
BAMA_SALTY            TW--
BAMA_YERPE            TW--
Q5E3E7_ALIF1          TF--
Q9KPW0_VIBCH          TF--
Q8EGG7_SHEON          TF--
BAMA_HAEIN            SF--
BAMA_NEIMB            TF--
Q5F5W8_NEIG1          TF--
Q7VYC2_BORPE          GF--
Q63T20_BURPS          AF--
Q8PAW1_XANCP          QF--
Q9HXY4_PSEAE          TF--
Q83DT2_COXBU          SL--
Q9ZE03_RICPR          HL--
Q5NEP7_FRATT          NF--
Q8D2H0_WIGBR          IW--
BAMA_NEORI            PF--
Q74AT3_GEOSL          FF--
BAMA_DESVH            FF--
Q0PC08_CAMJE          RF--
BAMA_HELPY            RF--