CLUSTAL format seed alignment for MF_01438

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DISA_CLOAB      --MNDLRLKKDR----------KLLEILKTMAPGTDMREGLENILRAKTGGLVVLGDN-E
DISA_CLOTE      --MIKVRLQKDN----------DLMDILNIMAPGTPLRDGLENILRAKTGGLIVIGDS-E
DISA_CLOPE      -----MRTVHDD----------ELKKILKIMSPGTSLREGLDNILRAKTGGLIVLGDN-E
DISA_BACSU      --MEKEKKGAKHEL--------DLSSILQFVAPGTPLRAGMENVLRANTGGLIVVGYN-D
DISA_BACLD      --MDKDKKGAKQ----------DLSEILQFVAPGTPLREGIENVLRAKTGGLIVVGFN-D
DISA_BACAN      --MEENKQRVKS-----------MINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN-E
DISA_BACCZ      --MEENKQRVKS-----------MINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN-E
DISA_BACC1      --MEENKQRVKS-----------MINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN-E
DISA_BACHK      --MEENKQRVKS-----------MINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN-E
DISA_BACCR      --MEENKQRVKS-----------MINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN-E
DISA_HALH5      --MDSEVKERFA------------RNILKMVAPGTALRTGIDNVLRAKTGGLIVLGYN-E
DISA_ALKCK      --MEERNRTAFI------------QNLLKLVAPGTPLRAGIDNVLRAKTGGLIVLGYN-S
DISA_CARHZ      --MKDER----------------IVLALKSVAPGTPLREGLEQILRAKTGGLIVIGDT-A
DISA_SYMTH      --MEDRSG---------------FWQVLQQLAPGTALREGLESILLARTGSLIVVGDS-P
DISA_FUSNN      -------MTKQD-----------LMDIIVKVAPGSPLREGVDYILDAGIGALIIIGYD-D
DISA_THEMA      --MGVKSLVPQE-----------LIEKIKLISPGTELRKALDDIINANFGALIFLVDDPK
DISA_COREF      MSTTTDILP----------DVHTMRDTLQRLAPGTPLRDGLDRIVRGHTGALIVLGDE-E
DISA_CORGL      MTPTTTPVSNPDALSTGTQDVHTLKGTLQRLAPGTPLRDGLDRIVRGHTGALIVIGDD-E
DISA_STRAW      -MAANDRAAAPGKSGGSSGADGLMRASLSAVAPGTALRDGLERILRGNTGGLIVLGSD-K
DISA_STRCO      -MAANDRAAAPGKSGGSAGADGLMRASLSAVAPGTSLRDGLERVLRGNTGGLIVLGSD-K
DISA_FRACC      ------MAGPPG--------DDIFRATLAAVAPGTPFRDGLERILRGHTGALIVLGHD-K
DISA_MYCBO      ----MHAVTRPT-----------LREAVARLAPGTGLRDGLERILRGRTGALIVLGHD-E
DISA_MYCPA      -------MTRPT-----------LRETVARLAPGTGLRDGLERILRGRTGALIVLGND-E
DISA_CUTAK      ---------------------------MALLAPGTPIREGLDRIVNGRTGGLIVLGDG-P
                                           :  ::**: :* .:: :: .  *.*:.:     

DISA_CLOAB      EVMKLSDGGFKINSEYSASYIYELAKMDGAIILSSDLKKIVRANVQLVPDSSIPTFETGT
DISA_CLOTE      EILDIVDGGFTIDAEYSPSYVYELAKMDGAIILSGDVKRIIRANAQLMPDPSVPTFETGT
DISA_CLOPE      EILDLVDGGFNINSEYSPAYIYELAKMDGALVLTSDRKRILYANAQLMPNQSISTFETGT
DISA_BACSU      KVKEVVDGGFHINTAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATISSSETGM
DISA_BACLD      KVKEVVDGGFHINSSFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPEATIPSSETGM
DISA_BACAN      QIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIETGM
DISA_BACCZ      QIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIETGM
DISA_BACC1      QIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIETGM
DISA_BACHK      QIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIETGM
DISA_BACCR      QIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPDSSIDSIETGM
DISA_HALH5      NMKGIVDGGFYLDCPFSPASLYELAKMDGAIILNEDGTKILYANTQLNPDNAISSNETGI
DISA_ALKCK      EMMNIVDGGFFINSDFSPAYLYELAKMDGAIILSEDGKRILYANTQLVPNNNISSSETGI
DISA_CARHZ      KIMEVVEGGFAINTDYSPAYLYELAKMDGAIILSEDGKKILYANAQLVPDPAIPSSETGI
DISA_SYMTH      EVLALVDGGFRLDCEFTPTRLYELAKMDGAIILTRDAQRILYANAMLVPDPSIPTSETGT
DISA_FUSNN      EVEKVRDGGFLIDCDYTPERIFELSKMDGAIILNDDCSKILYANVHVQPDNSYSTTESGT
DISA_THEMA      KYEDVIQGGFWLDTDFSAEKLYELSKMDGAIVLSEDITKIYYANVHLVPDPTIPTGETGT
DISA_COREF      NVTSICDGGFEFDVTFAATRLRELCKMDGAVVLSSDGERIKRANVQLIPSPSWPTQESGT
DISA_CORGL      NVSSICDGGFEFDVSFAATRLRELCKMDGAVILSSDLERIKRANVQLLPSPTWPTQESGT
DISA_STRAW      TVEAMCTGGFVLDVEFTATRLRELCKLDGGIVLSSDLSKILRAGVQLVPDPMIPTEETGT
DISA_STRCO      TVESMCTGGFVLDVEFTATRLRELCKLDGGIVLSSDLSKILRAGVQLLPDPTIPTEETGT
DISA_FRACC      VVEGLCTGGFELDVEFSATRLRELAKMDGAIVLSSDLQRIVRAAVHLVPDPTVPTEESGT
DISA_MYCBO      NVEAICDGGFSLDVRYAATRLRELCKMDGAVVLSTDGSRIVRANVQLVPDPSIPTDESGT
DISA_MYCPA      NVEAICDGGFALDVRYAPTRLRELAKMDGAVVLSTDGSRIVRANVQLVPDPSIATDESGT
DISA_CUTAK      EINGVCSGGFPLDVRLTPQALRELSKMDGGLVVSSDHERIKAAAVHFVPDGSLPTLETGT
                    :  *** ::   :.  : **.*:**.:::.    :*  * . . *.    : *:* 

DISA_CLOAB      RHRTAHRVAKQTGNVVVAISQRRNVITIYKDDIKYILRDSSIILARANQAIQTLEKYVAV
DISA_CLOTE      RHRTADRIAKQTGNIVIAISQRRNIITIYRNNIKYVLRDSSVILGKANQALQTLEKYVSV
DISA_CLOPE      RHRTAQRVAKQTNKIAIAISQRRNIITVYKGDIKYVLRDSAVILSKANQAIQTLEKYVAV
DISA_BACSU      RHRTAERVAKQTGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAIQTLEKYKTI
DISA_BACLD      RHRTAERVAKQTGCLIIAISERRNVITLYQENMKYILKDIGFILTKANQAIQTLEKYKLI
DISA_BACAN      RHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKYKAV
DISA_BACCZ      RHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKYKAV
DISA_BACC1      RHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKYKAV
DISA_BACHK      RHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKYKAV
DISA_BACCR      RHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKYKAV
DISA_HALH5      RHRTAERVAKQTGNLVISISQRRNVITLYHGHLRYALRDIGVILTKANQAIQTLDKYKSV
DISA_ALKCK      RHRSAERVAKQTGNLTISISQRRNVITLYQGEYRYALKDIGVILTKANQAIQTLEKYKAV
DISA_CARHZ      RHRTAERVAKQTNALVIAISQRRSVITLYQGNFKYSLSEVSVILNKANQAIATLEKYRAV
DISA_SYMTH      RHRTAERVARQTGELVISISQRRDLITLYKGPMKYILRDFAVVLTKANQALQTLEKYKLV
DISA_FUSNN      RHRTAERAAKHLKREVVAISERKKNVTLYKGNLKYRLKNFDELNIEVGQVLKTLESYRHV
DISA_THEMA      RHRTAERLAKQTGKVVIAVSRRRNIISLYYKNYKYVVNQVDFLISKVTQAISTLEKYKDN
DISA_COREF      RHRSAERTALQTGVPVIAVSESQNTITLYVEGKSHILEEPSTLLNRANQALGTMERYRDR
DISA_CORGL      RHRSAERTALHTGVPVIAVSESQNTITLYVEGKSHMLEQPAALLNRANQALGTMERYRDR
DISA_STRAW      RHRTADRVSKQVGFPVVSVSQSMRLVALYVDGMRRVLEDSAAILSRANQALATLERYKLR
DISA_STRCO      RHRTADRVSKQVGFPVVSVSQSMRLIALYVDGQRRVLEDSAAILSRANQALATLERYKLR
DISA_FRACC      RHRTAERVAKQAEFPVISVSQSMHIIALYVAGRRYVLDGSAAILSRANQALATLERYKLR
DISA_MYCBO      RHRSAERAAIQTGYPVISVSHSMNIVTVYVRGERHVLTDSATILSRANQAIATLERYKTR
DISA_MYCPA      RHRSAERAAIQTGYPVISVSHSMNIVTVYVGGERHVVADSATILSRANQAIATLERYKIR
DISA_CUTAK      RHRTADRLSQQTGVPVVVVSASMSVMSLFLNGRRYLIERPEQLLARANQALATLASYRGR
                ***:*.* : :     : :*     ::::       :     :  .. *.: *:  *   

DISA_CLOAB      LDRVMGNLNLLEFEDLCTLHDVVAAIQRTEMVMRVVTEIDRYICELGNEGRLISMQLNEL
DISA_CLOTE      LDKVINNLNVLEFRDLVTLFDVMTAIQRTEMVMRIVWEMERYICELGNEARLISMQLNEL
DISA_CLOPE      LERVTNNLNILEFQDLATLFDVTTAIQRTEMVMRIVEEIEGYIIELGNEGRLISMQLNEL
DISA_BACSU      LDKTINALNALEFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLIKLQVIEL
DISA_BACLD      LDHAISNLNALEFEELVTFGDVISVLHRYEMVLRIKNEINMYIKELGTEGHLIRLQVSEL
DISA_BACAN      WNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQLTEL
DISA_BACCZ      WNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQLTEL
DISA_BACC1      WNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQLTEL
DISA_BACHK      WNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQLTEL
DISA_BACCR      WNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQLTEL
DISA_HALH5      LDQDITDLGALEFEELVTFHEVSQVMQRIHMVLNIKGEILNYVNELGSEGRLITMQLNEL
DISA_ALKCK      LDQGITNLGALEFEQLVTYSDVIQVIHRVQMVLRIKQEIQNFILELGDEGRLITMQLKEL
DISA_CARHZ      LDKTLMRLTNLEFDDMVTLLDVAKALQRVEMVLRIEREIERYIWELGSEGRLISMQLEEL
DISA_SYMTH      RDQAVARLSALELDDMVSALDVALVVQRTEMLLRIGKEIERYIVELGTEGRLVAMQLEEL
DISA_FUSNN      LNRSLDSLTILELDDLVTVLDVANTLQRFEMVRRISEEITRYLLELGSRGRLVNMQVSEL
DISA_THEMA      FNKLLSELEVLELENRVTLADVVRTLAKGFELLRIVEEIRPYIVELGEEGRLARMQLREL
DISA_COREF      LDQVNTRLHMAELHNYATVIDVVSVIQREEMLRRVGETIDTNVLELGREAKQIQIQLTEL
DISA_CORGL      LDQVNNRLHLAELHSYVTVIDVVSVIQREEMLRRVGEIIDGDVLELGKDAKEIQIQLSEL
DISA_STRAW      LDEVAGTLSALEIEDLVTVRDVSAVAQRLEMVRRIATEIAEYVVELGTDGRLLALQLDEL
DISA_STRCO      LDEVAGTLSALEIEDLVTVRDVSAVAQRLEMVRRIATEIAEYVVELGTDGRLLALQLDEL
DISA_FRACC      LDEVAGTLSALEIEDLVTVRDAISVSQRLEMVRRIADEIEGYVVELGTDGRLLSLQLEEL
DISA_MYCBO      LDEVSRQLSRAEIEDFVTLRDVMTVVQRLELVRRIGLVIDYDVVELGTDGRQLRLQLDEL
DISA_MYCPA      LDEVSRQLSRAEIEDFVTLRDVLTVVQRLELVRRIGQVIDNDVVELGTDGRQLRLQLDEL
DISA_CUTAK      LVDEAENLTTLEIRDQVQVRDVAAVAQRVEMWRRIDAEVRGYVSALGVEGRLVQLQRNEL
                       *   *: .     :.  .        .:   :   :  **  .:   :*  **

DISA_CLOAB      VKNVEQDGMLIIRDYCQN--EMNYS---KVCETIQSMSSEEFLNSEAISKVMGYG--DVP
DISA_CLOTE      VRYVEEDEILLIRDYCET--YMDYT---EVYDEIQSMSSEELINLDQISKILGYT--GVP
DISA_CLOPE      VRSIEQDGVLLIRDYCYD--KMEYN---DVYKEIQELSAEDLLDLDIIAKELGYV--GKS
DISA_BACSU      ITDMEEEAALFIKDYVKE-KIKDPF---VLLKELQDMSSYDLLDDSIVYKLLGYP--AST
DISA_BACLD      ITDMEQEAALFVKDYVKE-KIKDPF---VLLKQLQDMSSFELLDDAILLKLLGYS--ATT
DISA_BACAN      LADLEAEAALLIKDYYQE-KTQDHH---QILKKLQELANTQLLEDSDLVKLLGYP--GQT
DISA_BACCZ      LADLEAEAALLIKDYYQE-KTQDHH---QILKKLQELANTQLLEDSDLVKLLGYP--GQT
DISA_BACC1      LADLEAEAALLIKDYYQE-KTQDHH---QILKKLQELANTQLLEDSDLVKLLGYP--GQT
DISA_BACHK      LADLEAEAALLIKDYYQE-KTQDHH---QILKKLQELANTQLLEDSDLVKLLGYP--GQT
DISA_BACCR      LADLEAEAALLIKDYHQE-KTQDHH---QILKKLQDLANTQLLEDSDLVKLLGYP--GQT
DISA_HALH5      VSNLEKEVLLLIQDYAKE-DDVDPE---DVLEQMMKCSNEELLDDSNILKLLGYH--KAF
DISA_ALKCK      VSNTEQEALYLLKDYAKE-RTQDVK---KTLKELTTLLNEDLLDEQAIIKALGYS--RTS
DISA_CARHZ      IANVEDEGLLIIQDYSLLGPEKTPE---GILSLIRTWSSEDLLDYSLIVRALGYP--GSA
DISA_SYMTH      LAGVAAEGLLIIRDYASTDDPQHAA---ALRQQMAEWTYEELQDLAAVARLLGAG--ALD
DISA_FUSNN      IWDLDEEEESFLKDYIDD--ETDTD---SVRRYLHSLSDSELLEVENVVVALGYS--KSS
DISA_THEMA      TEDVDDLLVLLIMDYSSE--EVEEE---TAQNILQDFITRREPSPISISRVLGYDVQQAA
DISA_COREF      RGDNDRERGYIIADYLVTDGIPTDETITEALEAVSGLDDKSLMKPSNIARILGLP--PTE
DISA_CORGL      RGDNDRERESIIADYLVTDGIPADEEIHAALEAISHLDDKALLNPANIARVLGLP--PTE
DISA_STRAW      IAGVEPERELVVRDYVPEPTAKRSRTVDQALYELDALTHAELLELATVAKALGYT--GSP
DISA_STRCO      IAGVEPERELVVRDYVPEPTAKRSRTVDEALAELDKLSHAELLELSTVARALGYT--GSP
DISA_FRACC      MAGVETERELTVRDYL--PIGSKAGTPAQVLGELSAMSPTDLLDLTVLARVIGFS--GGA
DISA_MYCBO      LGGNDTARELIVRDYHANPEPPSTGQINATLDELDALSDGDLLDFTALAKVFGYP--TTT
DISA_MYCPA      LGGNDNARELIVRDYHASPEQLSEAQMTATLDELDALSDTELLDFTALAKVFGYP--TTT
DISA_CUTAK      SLGVEDLGRLLTDDYRPNSVAPGG----FSLSGLQKLSWEDLLNVTMVAETINLG--PAE
                             **                  :         .   :   :.       

DISA_CLOAB      LI-DTLISPRGYRMTSKIPRIPFIVIENLVKNFKELKKILEASHEDLDKVEGIGEARARA
DISA_CLOTE      LV-DTFISPRGYRMLHRIPRIPSNVIENVVKNFKELKAVMEASYEQLDKVEGIGEARAKA
DISA_CLOPE      LI-DTLVSPRGYRISNKVPRIPSNVIENLVGHFGKLKYILEAGNEELDQVEGIGEARARA
DISA_BACSU      NL-DDYVLPRGYRLLNKIPRLPMPIVENVVEAFGVLPRIIEASAEELDEVEGIGEVRAQK
DISA_BACLD      NM-EEYVFPRGYRLLHKIPRLPMPIVENVVEAFGHLKLIIEADVKDLDEVEGIGAVRAQK
DISA_BACAN      SL-EESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKK
DISA_BACCZ      SL-EESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKK
DISA_BACC1      SL-EESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKK
DISA_BACHK      SL-EESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKK
DISA_BACCR      SL-EESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKK
DISA_HALH5      NVQEQQATPRGYRILHKIPRLPATIVRNLVHSFENINDMLRADLKELDEVEGIGEARAKL
DISA_ALKCK      NFLEQPASPRGYRILHRIPRLPSQIIENVIDEYGHLSSVMVATEDQLDEVDGIGEARAKM
DISA_CARHZ      SILDQPVSPRGYRILDKIPRLPVAVIENLVQTFGNLKNIMSASIEELDDVEGIGEVRARS
DISA_SYMTH      SP----LGARGYRMLRRIPRLPAAVIENLVARFGRLQRVLAASLEELDDVEGIGEVRARA
DISA_FUSNN      SVFDNKIAAKGYRVLEKISKLTKKDVEKIVNTYKDISEIQEVTDEDFSAIK-ISKFKIKA
DISA_THEMA      QLDDVLVSARGYRLLKTVARIPLSIGYNVVRMFKTLDQISKASVEDLKKVEGIGEKRARA
DISA_COREF      EALDEPVVPRGYRTLNRVPRVQKFLMDKLVGEFGNLHALTSASVEEISAVDGVGSLWARH
DISA_CORGL      EALDEPVTPRGYRTLNRIPRVQKFLMDKLIVEFGNLDALLNASVEDLSAVDGVGSLWARH
DISA_STRAW      EALDSAVSPRGFRLLAKVPRLPGAIIDRLVEHFGGLQKLLAASVDDLQTVDGVGEARARS
DISA_STRCO      ETLDSAVSPRGFRLLAKVPRLPGAIIDRLVEHFGGLQKLLAASVDDLQTVDGVGEARARS
DISA_FRACC      DILDRQISPRGYRMLAKVPRLPRMVVDRLVDHFGTLQKLLAAGVDDLQAVDGVGETRARA
DISA_MYCBO      EAQDSALSPRGYRAMAGIPRLQFAHADLLVRAFGTLQGLLAASAGDLQSVDGIGAMWARH
DISA_MYCPA      EAQDSAVSPRGYRALAGIPRLQFAHADLLVRSFGTLQNVLAASASDLQSIDGIGAMWARH
DISA_CUTAK      HPLDSPIRARGHRQLTLMTDLSSRTIQRIIDHFSDLQSLVSASTSELGDIKGVGLRRARE
                        .:*.*    :. :       ::  :  :  :  .   ::  :. :.    : 

DISA_CLOAB      IKSGLRKLKEQTIIRKQL---
DISA_CLOTE      IKNGLRRLKEQANIDKNIVTR
DISA_CLOPE      IKNGLRRIREQVALNKNL---
DISA_BACSU      IKKGLKRLQEKHYLDRQL---
DISA_BACLD      IKKGLKRLQEKHYTDRQL---
DISA_BACAN      IREGLKRIQEHLYMSRHN---
DISA_BACCZ      IREGLKRIQEHLYMSRHN---
DISA_BACC1      IREGLKRIQEHLYMSRHN---
DISA_BACHK      IREGLKRIQEHLYMSRHN---
DISA_BACCR      IREGLKRIQEHLYMSRHN---
DISA_HALH5      IKDGLSRIQEQLFMDRNI---
DISA_ALKCK      IKDGLNRIQEQLFVDRHI---
DISA_CARHZ      IKEGLKKLREQTNYTL-----
DISA_SYMTH      IQEGLRRMRMQFALERQL---
DISA_FUSNN      LRAGINRLKFTIEMQR-----
DISA_THEMA      ISESISSLKHRKTSE------
DISA_COREF      ITDGLARLT------------
DISA_CORGL      ITDGLGRLS------------
DISA_STRAW      VREGLSRLAESSILERYV---
DISA_STRCO      VREGLSRLAESSILERYV---
DISA_FRACC      VREGLSRLAESSILERYV---
DISA_MYCBO      VRDGLSQLAESTISDQ-----
DISA_MYCPA      VREGLSQLAESTITDSLS---
DISA_CUTAK      IRQGLESIFEGDQRTHHH---
                :  .:  :