CLUSTAL format seed alignment for MF_01440

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CHED_BACSU       ------------------------------------------------------------
CHED_BACLD       -----------------------------------------------------------M
CHED_HALH5       ------------------------------------------------------------
CHED_GEOKA       ------------------------------------------------------------
CHED_OCEIH       ------------------------------------------------------------
CHED_CALS4       ------------------------------------------------------------
CHED_DESHY       ------------------------------------------------------------
CHED_CLOAB       ------------------------------------------------------------
CHED_CLOTE       ------------------------------------------------------------
CHED_MOOTA       ------------------------------------------------------------
CHED_CARHZ       ------------------------------------------------------------
CHED1_METAC      ------------------------------------------------------------
CHED2_METMA      ------------------------------------------------------------
CHED_METBF       ------------------------------------------------------------
CHED_PYRAB       ------------------------------------------------------------
CHED_PYRHO       ------------------------------------------------------------
CHED_THEKO       ------------------------------------------------------------
CHED2_METAC      MSDDILFVSNGNGKAIFLTSRAVLVKSFCSLSKTCSFKDSCQSCEIVDAAKSYLMGKKSD
CHED1_METMA      MSSVFLFISNESGKAIFLISGDVLVKSFCSLSDTCPFQDSCRSCSLLNAAKNYLAGTAPD
CHED_ARCFU       ------------------------------------------------------------
CHED2_GEOMG      ------------------------------------------------------------
CHED3_GEOSL      ------------------------------------------------------------
CHED_THEMA       ------------------------------------------------------------
CHED_METHJ       ----------------------------------------------------------MS
CHED_SYMTH       ------------------------------------------------------------
CHED_ALKCK       ------------------------------------------------------------
CHED_HALMA       --------------------------------------------------MKVYDGSQTE
CHED_NATPD       --------------------------------------------------------MAAL
CHED_SYNC1       ------------------------------------------------------------
CHED1_SYNAS      ------------------------------------------------------------
CHED2_ANADE      ------------------------------------------------------------
CHED2_LEPIC      ------------------------------------------------------------
CHED2_LEPIN      ------------------------------------------------------------
CHED_METMP       ------------------------------------------------------------
CHED_BDEBA       ------------------------------------------------------------
CHED2_RUEST      ------------------------------------------------------------
CHED_RHIEC       ------------------------------------------------------------
CHED_RHIL3       ------------------------------------------------------------
CHED_RHIME       ------------------------------------------------------------
CHED_AGRFC       ------------------------------------------------------------
CHED_CAUVC       --------------------------------------------------------MTSF
CHED1_RUEST      ------------------------------------------------------------
CHED_CERS4       -------------------------------------------------------MTRCD
CHED_CERSP       -------------------------------------------------------MTRCD
CHED_ZYMMO       -------------------------------------------------------MAETT
CHED_JANSC       -----------------------------------------------------------M
CHED_BORBR       ----------------------------------------MPARLDARATRR--------
CHED_BORPE       ----------------------------------------MPARLDARATRR--------
CHED_BORPA       ----------------------------------------MPARLDARATRR--------
CHED_BORA1       ----------------------------------------MSVRLDARASRH--------
CHED_BURP1       ------------------------------------------MSGLPIATNL--------
CHED_BURPS       ------------------------------------------MSGLPIATNL--------
CHED_BURMA       ------------------------------------------MSGLPIATNL--------
CHED1_BURTA      ------------------------------------------MSGLPIATNL--------
CHED_BURL3       ------------------------------------------MSALPIATNR--------
CHED_PARXL       -----------------------------------------MSSALPIATNL--------
CHED_CUPPJ       --------------------------------------MRTPHLPEAIATRK--------
CHED_CUPMC       ------------------------------------MMRGTPQMPEAIATRK--------
CHED_METFK       ---------------------------------------MANPIEEQLATNL--------
CHED_THIDA       ---------------------------------------MNSAIEEQLATNL--------
CHED1_DECAR      ---------------------------------------MQHAYDEHLATNR--------
CHED1_GEOMG      -----------------------------------------MHTGRYFAKNS--------
CHED1_SHEON      -------------------------------------MVKPSLEFALNEPNR--------
CHED_RALSO       -----------MIEFGKKAVPRAAMPDTVRSDSGMTAGAMATLAQSAASTHA--------
CHED_XANAC       ----------------------------------------MSTAVQVDDVMR--------
CHED_XANC5       ----------------------------------------MSTAVQVDDVMR--------
CHED_XANOM       ----------------------------------------MSTAVQVDDVMR--------
CHED_XANOR       ----------------------------------------MSTAVQVDDVMR--------
CHED_XANC8       ----------------------------------------MSTAVQVDDVMR--------
CHED_XANCP       ----------------------------------------MSTAVQVDDVMR--------
CHED1_ALBFT      -----------MNMFASGTAALPLRASGVVVAPTVLAGGALSRVDQLKAQIRNPGEASFF
CHED_NITEU       ------------------------------------------MVNPQFASNF--------
CHED2_CHRVO      -----------------------------------------MNHAEGMNSHQ--------
CHED_HAHCH       -------------------------------------MNSAQKKPQPPPLSLPWFQSVNR
CHED_HYDCU       ---------------------------------------------------------MQK
CHED_SACD2       -----------------------------------MLKGLTSKADARLKPALPGFTNVYR
CHED2_BURTA      -----------------------------------------------MGYHF--------
CHED2_DECAR      -----------------------------------------------MDYSK--------
CHED_VIBVU       ----------------------------------------MMLDPINHHFQAHEEAYYSR
CHED_VIBVY       ----------------------------------------MMLDPINHHFQAHEEAYYSR
CHED_VIBCH       ---------------------MLVVAVRFSIIWDILFMSDSKLATKRKLKQEEAKGQYYR
CHED_RHORT       ------------------------------------------------------------
CHED_SULDN       ------------------------------------------------------------
CHED1_ANADE      --------------------------------------------MTRTTGAAPDRAAPAA
CHED_BORBU       -----------------------------------------------------------M
CHED_BORGP       -----------------------------------------------------------M
CHED1_GEOSL      ------------------------------------------------------------
CHED2_SHEON      ------------------------------------------------------------
CHED1_CHRVO      ------------------------------------------MPHTPPAYPAASADHRPP
CHED3_DECAR      ------------------------------------------------------------
CHED_PSE14       ------------------------------------------------------------
CHED_PSEU2       ------------------------------------------------------------
CHED_PSESM       ------------------------------------------------------------
CHED2_ALBFT      ------------------------------------------------------------
CHED1_LEPIC      ------------------------------------------------------------
CHED1_LEPIN      ------------------------------------------------------------
CHED_OLEA2       --------------------------------------MSGYSAEQRAAMQCMSLARHGL
CHED_DESVH       -------------------------------------------MRDAVRAKTNRRSVAGM
CHED2_GEOSL      ------------------------------------------------------------
CHED2_SYNAS      ------------------------------------------------------------
CHED_CHLL3       -----------------------------------MKKTAKTDTEDAFKFRSTFGEHYYD
                                                                             

CHED_BACSU       -MSTTEAVVIKVGIADVKIARFP-DTIRTSGLGSCVGLVLYDKEKQTAGLVHVMLPDSTL
CHED_BACLD       KILEKETSIIRVGIADVKIVRTP-DKIRTSGLGSCVGLVLYDLEAKTAGLVHVMLPDSSL
CHED_HALH5       -----MNDVVKVGMADLNVVTPP-HTIRTAGLGSCVGVVLYDDVKKVAGMAHIMLPDSAL
CHED_GEOKA       ---MSTAQAVKIGIAEMEVVIAP-NVIRTCGLGSCVGVVIYDAGKAVAGMAHVMLPHSSM
CHED_OCEIH       -MTSIETTVVKVGIADLKIIQFP-QLIRTSGLGSCVGTVIYDDKKEIAGLSHVLLPYSQQ
CHED_CALS4       ----MESKILRVGMADAKVTKSP-GILTTIGLGSCVGIVLYDPIAKVAGLVHIMLPYSNK
CHED_DESHY       -----MSNVISVGMADLKTTKAP-NILMTAGLGSCIGICVHDPIQKVGGMAHIMLPTAGS
CHED_CLOAB       MEERENIKEIRVGIADLNTAFSP-NRIITVGLGSCIGIAIYDSKNKLGGLSHIMLPDSTQ
CHED_CLOTE       -MHTMEVKEYRVGIADLNVAKSP-DRIITVGLGSCIGIALYDRINGVGGLLHIMLPDSTQ
CHED_MOOTA       MEAIIKPQEVKVGIAEWQVLRAP-GRLITLGLGSCVGIALYDSLNRMGGLAHIMLPDSSQ
CHED_CARHZ       -------MELQVGIADYKLGSSP-VKIVTYGLGSCVGVSFYEPRLKLGALLHIMLPDSTQ
CHED1_METAC      ---MADPGIVMVGIGDCAIARCP-VKIKTSGLGSCVGVTIYDRHEKIGGLLHTMLPNIKK
CHED2_METMA      ---MVNSDIITVGIGDCAIARSP-MKIKTSGLGSCLGITLYDRQKKIGGLLHTMLPNIKD
CHED_METBF       -----------MGIGACALARSP-VKIKTFGLGSCVVITLYDRQERIGGLVHTMLPSISD
CHED_PYRAB       -----MTREIKVGIGDYAVGKGE-GIISTYGLGSCVGITLYDRVTKVGGLLHALLPEAAR
CHED_PYRHO       ------MKEVKVGIGDYAVGKGN-GIISTYGLGSCVGITLYDRVTKVGGLLHALLPEAAR
CHED_THEKO       -------MEVKVGIGDYAVAKKT-GIISTYGLGSCVGITLYDRLNRVGGLLHALLPESAR
CHED2_METAC      LNVKSLDGELSAGIGEYKIGKN--VLLKVMGLGSCIGVILSDVSTGICGIAHVLLPGASN
CHED1_METMA      SRIKTLDGELSAGIGEYKIGKN--VLLKVMGLGSCIGVILSDVSTGICGIAHVLLPGASD
CHED_ARCFU       -----MGSEILVGIGEFRVAKG--AVLKTIGLGSCVGIALYDPKLRLGGLAHVMLPQSGN
CHED2_GEOMG      -----MSKIISVGISEHKVASDP-VVLVTYGLGSCVGIALYDPEVRIGGLAHTLLPAPVR
CHED3_GEOSL      -----MSRIVSVGISEFKIASAP-TILMTYGLGSCVGIALHDPVALTGGLAHTLLPAPVR
CHED_THEMA       -------MKKVIGIGEYAVMKNPG-VIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDS--
CHED_METHJ       ETITGSDQREVIIIGIGEWSTGDT-VMTSIGLGSCIGLVIHDETRKIGGLAHVMLPKS--
CHED_SYMTH       ---MSDRRLEAVGLGELKVADRPDQVLVCYGLGSCVGLALYDPVVRIGAMVHVVLPDSSM
CHED_ALKCK       -----MTKGETISIGEWKVVKGEG-VLRTCGLGSCIGIVLYDQERVIAGMVHVMLPDST-
CHED_HALMA       SPEQSTPERIKVGIAEYKVTT-EPAMLTTSGLGSCIGIAIYDTRNTVAGLVHVMLPSAAD
CHED_NATPD       PAESDTSERIKVSIADYAVA--EAGTISTSGLGSCLGLAIYDPEAGVSALVHPMLPRRDG
CHED_SYNC1       ------MSDLILGIGEYGVSKTPGSMVKTYALGSCVAVTMYEPNLKIAGMVHVALPESKL
CHED1_SYNAS      ------MGDVIVSISDFRVSNNVGDILVTYALGSCIAVAIYDPKVKVGGLLHYMLPDSSL
CHED2_ANADE      ------MSLVTVGIGDLAVTGDPRAVIVTHGLGSCIALVAWDPGLRVGGMLHFQLPASAL
CHED2_LEPIC      -MLTKGSKVVNVGIADMQGAQSP--EILRTTLGSCIGVVFYAPDKKIGAMAHFMLSKDPS
CHED2_LEPIN      -MLTKGSKVVNVGIADMQGAQSP--EILRTTLGSCIGVVFYAPDKKIGAMAHFMLSKDPS
CHED_METMP       -------MVLKVKMGDIGVAKSP--ESIETLLGSCVAIILYDRGKKIGGVAHVMLPK--S
CHED_BDEBA       ----MLPVEHHVRIGQILIAENG--EVLKTVLGSCVGIALVWRRQNKWALAHCLLPYPET
CHED2_RUEST      -MDKVEVSELHVRIGQVKIGSPG--QVLTAILGSCVGIGFFFPQRQIYGLAHCLLSQSSS
CHED_RHIEC       -MIVEGAARRVHIIQGEYKVLSDPNAVLSTILGSCVAACLRDPVAGVGGMNHFLLPGSAT
CHED_RHIL3       -MITEGAARRVHIIQGEYKVLNDPNAVLSTILGSCVAACLRDPVAGVGGMNHFLLPGSAT
CHED_RHIME       -MNTEAAGRRVHVIQGEFKVVNDPDIVLSTILGSCVAACMRDPAAGVGGMNHFLLPGSAT
CHED_AGRFC       --MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGN
CHED_CAUVC       HHDDPERAVKVHVTQGESHVTADPNVVMTTVLGSCIAACIRDPQSGVGGMNHFLLPDSGD
CHED1_RUEST      MSNVFQNTSTVTVLQGDYKVTTDPKVVFSTVLGSCIAACIYDEQVGVGGMNHFLLASSAG
CHED_CERS4       DSPSASQISITHVTQGSCVASSSPNEVYATILGSCICTCMCDPVAGVGGMNHFLLP---S
CHED_CERSP       DRPSASQISITHVTQGSCVASSSPNEVYATILGSCICTCMCDPVAGVGGMNHFLLP---S
CHED_ZYMMO       MKININNFKRIDVMQGEKQVSSEDDVVFSTVLGSCIAACLYDPIAKIGGMNHFLLAEPSG
CHED_JANSC       THLRSRSGNVTHVMQGQLYISQTPGESLTCILGSCVAACVHDPALRIGGMNHFLLP---G
CHED_BORBR       YFDSAFNSPAVKILPNEYYVTNGEDVMLSTVLGSCVAACIHDPVIGVGGMNHFMLPEG--
CHED_BORPE       YFDNAFNSPAVKILPNEYYVTNGEDVMLSTVLGSCVAACIHDPVIGVGGMNHFMLPEG--
CHED_BORPA       YFDSAFNSPAVKILPNEYYVTNGEDVMLSTVLGSCVAACIHDPVIGVGGMNHFMLPEG--
CHED_BORA1       YYDSTFERHAVKILPNEYFVTKGEDLMLSTVLGSCVAACLRDPLTGIGGMNHFMLPDG--
CHED_BURP1       YFDAHFHRHGVKLLPNEFYTT-REDMVLVTVLGSCVAACLHDPIGRIGGMNHFMLPDD-G
CHED_BURPS       YFDAHFHRHGVKLLPNEFYTT-REDMVLVTVLGSCVAACLHDPIGRIGGMNHFMLPDD-G
CHED_BURMA       YFDAHFHRHGVKLLPNEFYTT-REDMVLVTVLGSCVAACLHDPIGRIGGMNHFMLPDD-G
CHED1_BURTA      YFDAHFHRRGVKLLPNEFYTT-REDMVLVTVLGSCVAACLHDPIARIGGMNHFMLPDD-G
CHED_BURL3       YFDNHFGRPGVKLLPNEFYTT-SEDMVLMTVLGSCVAACLHDPYAGIGGMNHFMLPDD-G
CHED_PARXL       YYDNHFQRPGVKLLPNEFYTT-SEDMVLVTVLGSCVAACIQDRTAGIGGMNHFMLPDD-G
CHED_CUPPJ       YFDREFDRQAIKLLPNEYYVT-GEDVVLTTVLGSCVAACIRDEKAGVGGMNHFMLPDDEG
CHED_CUPMC       YFDREFDRQAIKLLPNEYYVT-AEDVVLTTVLGSCVSACIRDEVAGVGGMNHFMLPDDEN
CHED_METFK       YFDKTFNCEAAKILPGEYYTT-NQDIVIVTVLGSCVSACIRDKVSGIGGMNHFMLPEGNP
CHED_THIDA       YYDRNFDCETAKILPGEYYFT-AKPMLIVTVLGSCVAACIRDRVSGIGGMNHFMLPDGG-
CHED1_DECAR      YFDRKFGLEAAKILPGEYYVA-NQEALLVTVLGSCVAACIRDADSGIGGMNHFMLPDDG-
CHED1_GEOMG      YYDRTFNKQAVKILPGEYHAT-DSDTMIVTVLGSCVSVCIRDRLSGIGGMNHYMLPGEA-
CHED1_SHEON      YYDRHFERSAVKILPGEYFAT-RENTMIVTVLGSCVAVCLYDPVLKIGGMNHFLLPNDN-
CHED_RALSO       YYDTTFSRRAMKVLPGEYYVT-TEDLMLVTVLGSCVSACVRDKLLGIGGMNHFMLPSRN-
CHED_XANAC       YRDSRFQTIAAKLLPTQYLVV-DDDTALTTTLGSCVAACLRDPVLKIGGMNHFLLPEG--
CHED_XANC5       YRDSRFQTIAAKLLPTQYLVV-DDDTALTTTLGSCVAACLRDPVLKIGGMNHFLLPKG--
CHED_XANOM       YRDSRFQTIAAKLLPTQYLVV-DDDTALTTTLGSCVAACLRDPVLKIGGMNHFLLPEG--
CHED_XANOR       YRDSRFQTIAAKLLPTQYLVV-DDDTALTTTLGSCVAACLRDPVLKIGGMNHFLLPEG--
CHED_XANC8       YRDSRFQTIAAKLLPTQYLVV-DDDTALTTTLGSCVAACLRDPVLKIGGMNHFLLPEG--
CHED_XANCP       YRDSRFQTIAAKLLPTQYLVV-DDDTALTTTLGSCVAACLRDPVLKIGGMNHFLLPEG--
CHED1_ALBFT      YRDHHFQYDAVKVLPGEYFVS-AEDLVIMTVLGSCISACIWDGRVRAGGMNHFMLPDG--
CHED_NITEU       YFDQRLNTEAVKLLPGEYFVT-TRNMVLSTVLGSCVSACIYDGQSGVGGMNHFMLPRG--
CHED2_CHRVO      YYDKHFQITAVKVFPGEFHAT-NQSRLLVTLLGSCVAVCLSDRISGVAGMNHFLLPEG--
CHED_HAHCH       FWVQNQGRFMAKIMPGEYYVT-NQQELIGTVLGSCISACVRDPASGIGGMNHFMLPQNAG
CHED_HYDCU       SVDPAEGITTYKILPGEFYVT-KDNERIETVLGSCISACVRDPVTGVGGMNHFMLPVDKN
CHED_SACD2       YWDARFAKVAVKLQPGECYVT-KNDEMLVTVLGSCIAACIRDPVAGVGGMNHFMLPEQAA
CHED2_BURTA      YFDREFGRQAVRVNPG-GFAIASADVMLATVLGSCVSVCMFDSAARVGGMNHFMLPGSGN
CHED2_DECAR      LPSQEIERLARTIHPG-AWAIEP-ERPLATLLGSCVAVCLFDPQARVGGLNHFMLPNIRR
CHED_VIBVU       FFNEQRGLHMIKVLPGGVYVS-DQEELICTGLGSCVSACIWDPVKRVGGMNHFLLPFHNH
CHED_VIBVY       FFNEQRGLHMIKVLPGGVYVS-GQEELICTGLGSCVSACIWDPVKRVGGMNHFLLPFHNH
CHED_VIBCH       FNHPSDHRHWVKVMPGGVYAT-SDQEIIHTGLGSCVSACAWDIEMKVGGMNHFLLPFNNQ
CHED_RHORT       ----MVNSMPKPFLTPGTLYCGAAPAVISTVLGSCVAVCLIDRHNRAAGMNHFVLP-HNP
CHED_SULDN       ------MEYEKKYIHSSQLFVAVRPSVIQTVLGSCVAVCLYDSKMQISGMNHYLLPLWNN
CHED1_ANADE      GETPGGGGRAQVYLHAGQIAVAAEPTAIVTVLGSCVAVCLHDPVARVGGMNHFLLPLHVE
CHED_BORBU       LNHFNFKLKRDVTIIVPGEAFVSNKRVISTILGSCVAVVLCDESNNLIGMNHYVLVKSD-
CHED_BORGP       LNHFNFKLKRDVTIIVPGEAFVSNKRVISTILGSCVAVVLCDESNNLIGMNHYVLVRSD-
CHED1_GEOSL      MRHQRLEGRHIIRIAPGEYHVTTGGGVISTLLGSCVAACLFDSESGVAGMNHFLLSNHRY
CHED2_SHEON      MENMAFNQRTVVMIGPGEHYVTAKNEVIKTLLGSCVAVCLYDPKAQVIGMNHFLLAADR-
CHED1_CHRVO      SSPPAEPAGEAVFLHPGDWHFGDSQTRIRTLLGSCVSITLWHPQAKVGGMCHYLLAQRTP
CHED3_DECAR      -MSAAPSELHEVFLNPGEFHFGESNTRISTLLGSCVSITLWHPRKRIGGMCHYMLTERKR
CHED_PSE14       --MNTPVGVAEIVLGPGEVVFQTRPTRLRTLLGSCVAITFWHPWRRIGGMCHFMLPGR-I
CHED_PSEU2       --MNTPVGVAEIVLGPGEVVFQTRPTRLRTLLGSCVAITFWHPWRRIGGMCHFMLPGR-I
CHED_PSESM       --MRKPVGAIEIVLAPGEVVFETRPARLRTLLGSCVAITFWHPQQHIGGMCHFMLPHR-P
CHED2_ALBFT      --MSRKKKPIDIFLQPGEYFVADAGYQIRTMLGSCVSITLWHPATRQGAMSHFLLPTRGA
CHED1_LEPIC      -MILEPDTVIDLFLQPGGFYWGKGNIRIRTLLGSCVSICFWHPSLLYGGMAHVMLPFRPS
CHED1_LEPIN      -MILEPDTVIDLFLQPGGFYWGKGNIRIRTLLGSCVSICFWHPSLLYGGMAHVMLPFRPS
CHED_OLEA2       PHALADCGLPHVHLKIGEGIVTRRALLISTVLGSCVSVTFFSRRLQLAGIFHAMLPVITQ
CHED_DESVH       PAELMDLDLRHLHLRIGEGILAARPALIATVLGSCVSVTFHHPSTETGGIFHAMLPTVLG
CHED2_GEOSL      -MTARHPKLPHVYLKPGEFHFATKPTVVTTVLGSCVSVTMFDVFSRTAAICHALLP----
CHED2_SYNAS      MNSKAIKPSCEYFLLPGYIFMSPEPYLISTVVGSSVAVALWDADSKLGGMLSFLYPFRES
CHED_CHLL3       GYGARHETPHIVAYTGEVTAAGPGRVLISSPLGSCIAVCAYDPGTRVGGLAHVMLPGVPP
                                                :**.:            .:          

CHED_BACSU       SKTA--------------ELNRAKYADTAVQTTIDMLIEAGCRKFALKAKLAGGSEMFKF
CHED_BACLD       SKTP--------------DINVAKYADTAVEATVKMLLEAGCRKYALKAKMAGGAEMFKF
CHED_HALH5       GKKQ--------------EFNRAKYADTALDLLLSKLEAIGAKRYSLKAKMAGGAQMFSF
CHED_GEOKA       ARGG--------------VINAAKYADTAVEALVQLVIAAGGRKGMLKAKLAGGAQMFSF
CHED_OCEIH       GKQA--------------NTNPYKYADTAISYLYNELLKRGANQSSLKAKLAGGAQMFQL
CHED_CALS4       ISD---------------NSNKLKFADTGIEILIEEMLKEGANPKRLISKLAGGAQMFSS
CHED_DESHY       APG----------------GNPAKYADTAMDLLVTEILRLGASKSRLRAKMAGGAQMFSF
CHED_CLOAB       FSK---------------VTNPYKFADLAIPILIKKMEGMGANIRNMKAKIAGGASMFNF
CHED_CLOTE       FKN---------------VSNPLKFPDLGIIIMTDKMKEKGANIRNIKAKISGGASMFNF
CHED_MOOTA       FQD---------------RSNRAKFADLAILDLVAALIGRGARRGRLVAKIAGGAQMFTS
CHED_CARHZ       FSG---------------KLKPEKFADTGIPLVVRELEKQGARKSSLEVKMVGGAQMFSG
CHED1_METAC      AGI---------------KDNPTKFTDAGIEYLVAEIIENGGSRRKLEAKLVGGSSMF--
CHED2_METMA      AKL---------------KDNPAKFTDAGIEYLVDEMIRRGGSIDKLEAKVVGGAGMF--
CHED_METBF       ARI---------------KDKPFKYTDSGIEHLATEILREGSPRKRFEAKLVGGAHMF--
CHED_PYRAB       YGH---------------RGNPAKYVDTGLQLLLKEVLKLGASKFRLEAKLFGGAQMF--
CHED_PYRHO       YGH---------------RGNPAKYVDTGLQLLLKEVIKLGASKFRLEAKLFGGAQMF--
CHED_THEKO       YGG---------------RGNPAKYVDTGLELLIKDMMKLGASPRRLEAKLFGGAHMF--
CHED2_METAC      -------------------SGEAKYAETAIENMFEDMIRMGARKNRITAKFAGGAQVFKH
CHED1_METMA      -------------------RGETKYAETAIEKMVEDMVKMGARRSRITAKFAGGAQVFKH
CHED_ARCFU       G-----------------TKRSAKYADHAVEMMTEAMERLGSDRKRIVAKMAGGAQIFKH
CHED2_GEOMG      EVQG--------------AERTAKFTCWAVDLMVEELLKCGCAPERLVAKLAGGATMFEP
CHED3_GEOSL      GMDS--------------MVKSAKFTCWAVDLMVEELIKCGCVAERLVAKLAGGATMFEP
CHED_THEMA       GGK---------------TDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFE-
CHED_METHJ       SGKP--------------NERAGKYADTAVEVLIKELTQKGSKVSNLKAKLAGGASMFQN
CHED_SYMTH       GRGR--------------EAPPGKYADTGVEAAVAALVDAGASRSRLIAKAAGGARMLRL
CHED_ALKCK       KARK--------------GANPWRYADTAIASLQAELKKQG--ARKLCAKMAGGAQMFKH
CHED_HALMA       IDG----------------GNHAKFADTGIQALIEAMADAGASTEAMEAKIAGGSDMLDF
CHED_NATPD       NDD----------------RPPERFVDSGIDVVVDALLEHGASKASLRAKIAGGAAVVDF
CHED_SYNC1       NTAKG-------------EQCPGYFADLGVPLLFKEMVRLGCHARGRGLVVKMLGGAAVM
CHED1_SYNAS      DVDKA-------------KTTPGMFADTGIPLLFKACYSLGAQKK--SMIVKVAGGASIL
CHED2_ANADE      SPERA-------------LDAPGTFADTGIPLLFHRLYARGCRKE--ALVVKAAGGGSFN
CHED2_LEPIC      GKDS--------------QKNPFKYAETAIPLLIKKMNEMGCNPGEYSVRLFGGASMFKG
CHED2_LEPIN      GKDS--------------QKNPFKYAETAIPLLIKKMNEMGCNPGEYSVRLFGGASMFKG
CHED_METMP       RNSS--------------EKNPGKYANTAIPELINRMAKLGARKDKLTTKLAGGAAMFKC
CHED_BDEBA       FKEDK----------------EARYVSQTIPRMLERMGATMADVSELEAIVAGGGRMMDG
CHED2_RUEST      QPVASSAAQTGRTREDGQLVGNGRHVDKAIESLLKMMDIQDEERRQLRVVLAGGANMSMP
CHED_RHIEC       SP--------------ASGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAK----
CHED_RHIL3       SP--------------TSGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAK----
CHED_RHIME       SP--------------SSGADATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAR----
CHED_AGRFC       ----------------VTGGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAK----
CHED_CAUVC       G---------------RRDGDAVRYGAYAMEVLINDLLKRGARRERLEAKIFGGAK----
CHED1_RUEST      S-----------------GGVSARYGVHAMELLINGIMKKGALRSNLKAKVFGGAK----
CHED_CERS4       AD--------------VEDAQHLRYGSHAMELLINALLKLGAARQRIEAKIFGGAM----
CHED_CERSP       AD--------------VEDAQHLRYGSHAMELLINALLKLGAARQRIEAKIFGGAM----
CHED_ZYMMO       SD--------------HDPNSLKRYGVYAMEVLINAMLAKGAHRNRLRARLYGGAT----
CHED_JANSC       RD--------------PHDTGSVRYGARSMEALIDALLHKGADRQRLNVWLFGGAN----
CHED_BORBR       -------------DIHSPASATMRYGAFAMEVLINELLKAGAVRERLEAKVFGGGA----
CHED_BORPE       -------------DIHSPASATMRYGAFAMEVLINELLKAGAVRERLEAKVFGGGA----
CHED_BORPA       -------------DIHSPASATMRYGAFAMEVLINELLKAGAVRERLEAKVFGGGA----
CHED_BORA1       -------------DAQSPASATMRYGAFAMEVLINELLKAGAARDRLEAKVFGGGA----
CHED_BURP1       A------------DPSAAASESMRYGAYAMEVLINELIKAGGRRERFEAKVFGGAA----
CHED_BURPS       A------------DPSAAASESMRYGAYAMEVLINELIKAGGRRERFEAKVFGGAA----
CHED_BURMA       A------------DPSAAASESMRYGAYAMEVLINELIKAGGRRERFEAKVFGGAA----
CHED1_BURTA      A------------DPSAAASESMRYGAYAMEVLINELIKAGGRRERFEAKVFGGAA----
CHED_BURL3       A------------DPGAAASESMRYGAYAMEVLINEMIKAGGRRERFEAKVFGGAA----
CHED_PARXL       A------------DVGQAASDSMRYGAYAMEVLINELIKAGGRRERFEAKVFGGGA----
CHED_CUPPJ       G------------TADRMLSASMRYGCYALEVLINELLKMGARRERLEAKVFGGGA----
CHED_CUPMC       A------------GADRMLSTSMRYGCYALEVLINELLKMGARRERLEAKVFGGGA----
CHED_METFK       A------------DANNPVSESARYGTYAMEVLINQLLKNGARRENLEAKIFGGGN----
CHED_THIDA       G------------DPGNPLSASMRYGAYAMEVLINQLLKAGARRENLEAKVFGGGN----
CHED1_DECAR      --------------GRDKVGMSARYGTYAMEVLINHLLKLGARRNRFEAKVFGGGA----
CHED1_GEOMG      G------------TDE---SPSPRYGTHAMELLIDHLIQLGGRLPYLEAKVFGAGR----
CHED1_SHEON      V------------TAPNMMTESARYGVFAMELLINHVLKLGARRNALEAKVFGGGN----
CHED_RALSO       -------------ESESILSPSMRYGTHAMEVLLNQLYRAGARREHLEIKVFGGAA----
CHED_XANAC       ---------------QVGDGAPTRYGSYAMELLINDMLKRGAHRKRIEAKVFGGAN----
CHED_XANC5       ---------------QVGDGAPTRYGSYAMELLINDMLKRGAHRKRIEAKVFGGAN----
CHED_XANOM       ---------------QIGDGAPARYGSYAMELLINDMLKRGAHRKRIEAKVFGGAN----
CHED_XANOR       ---------------QIGDGAPARYGSYAMELLINDMLKRGAHRKRIEAKVFGGAN----
CHED_XANC8       ---------------QVGDGAPARYGSYAMELLINDMLKRGAHRKRIEAKVFGGAN----
CHED_XANCP       ---------------QVGDGAPARYGSYAMELLINDMLKRGAHRKRIEAKVFGGAN----
CHED1_ALBFT      ---------------DSVDGF-GRYGSYAMELLINELLKKGARRESMQAKVFGGAA----
CHED_NITEU       E------------DDQGLQVECARFGGYAMDILIRELLRNGAHKENLVSKVFGGGN----
CHED2_CHRVO      S------------LDLGAGTSAARFGVNAMELLITDMQKLGAMRNRLEAKIFGAGN----
CHED_HAHCH       G------------GRMDILSDAFRYGNYAMEHLINDVMKLTGKRSTLEVKIFGGAN----
CHED_HYDCU       A------------TGASELSDANRYGNYAMENLVNALLNAGARRERLEFKLFGGGR----
CHED_SACD2       GHEI---------TRNSLSNPELCYGNWAMEHLINSIIKCGGMRNRLEIKLFGGGR----
CHED2_BURTA      G--------------ARNDSLSSLYGVNAMELLINGLLRRGALKWRLRAKLFGGGCV---
CHED2_DECAR      G--------------SNDDVDSLLSGAYAMEALLNALLQRGAKKLRLQAKAFGGGTI---
CHED_VIBVU       FEEKHW-------HADELLSGASRYGSYAMEMLLNQLLSLGARRERLRMKLFGGAQ----
CHED_VIBVY       FEEKHW-------HADELLSGASRYGSYAMEMLLNQLLSLGARRERLRMKLFGGAQ----
CHED_VIBCH       FESQHW-------HPQALLSDSSRYGCYAMEVLINRLLSMGAERERLKFKLFGGAH----
CHED_RHORT       AG-----------------EDSLRYGDVALDRLHARMGELGCETKDLRAKVFGGAA----
CHED_SULDN       DG-----------------LASPKYGNIAISKLIEAMEAVGCQRRDMVAKLFGGAS----
CHED1_ANADE      R------------------EQSARFGTVAVPQLVEAVVRAGARRASLVAKVFGGAS----
CHED_BORBU       ---LD-----------ISPDQRGRYGIYAIPMLINAMLENGASKSNLKAKLFGGTN----
CHED_BORGP       ---LD-----------ISPDQRGRYGIYAIPMLINAMLENGANKSNLKAKLFGGTN----
CHED1_GEOSL      SRTMP-----------FCFTEAGRYGIHSMELLINSLMRHGARRENLRAKAFGGAS----
CHED2_SHEON      RKFTH-----------FLDSRAGYYGVHAMEILINAMLKRGAQRKYLQSKIFGGAN----
CHED1_CHRVO      HRGE---------------SLSGRYGDEAMLLLLREILDTGLPLQEFQARLIGGA-----
CHED3_DECAR      PPNA---------------ALDGRFGSEAFELFLQHVAAAGTRPGEYQAKLFGGA-----
CHED_PSE14       RRHQ---------------PLDGRYADEAMEILIRHALANGTLPEEYQVKLFGGG-----
CHED_PSEU2       RRHQ---------------PLDGRYADEAMEILIRHALANGTLPEEYQVKLFGGG-----
CHED_PSESM       HKHK---------------ALDGRYGDEALEMLIRHALANHTKPRDYQVKLFGGG-----
CHED2_ALBFT      SKPKQ--------------TLDARYGDEALKLMLIELQRLGIPSAQCQGKIFGGG-----
CHED1_LEPIC      SIHSD-----------D--SLNAKYAEDAFQLFFEKLEGFKK---QYQIKLFGGA-----
CHED1_LEPIN      SIHSD-----------D--SLNAKYAEDAFQLFFEKLEGFKK---QYQIKLFGGA-----
CHED_OLEA2       SYRPC--------------NEPCRFVDSAIEAVYGNFEKRGLHPEEVEVKLFGGAFSMGL
CHED_DESVH       AADGA--------------RTPCKYVDAAIETLLGQFARRGIAANDLVVKLFGGAFTMNP
CHED2_GEOSL      -DGPR--------------DDVFRYVDSSIIRMLEMFMSRGITPRQLQVKLFGGSDMLGA
CHED2_SYNAS      S-----------------AESTAIYGNVAITYMVRMFREEGAKKKNLRSQIFGGAESD--
CHED_CHLL3       AHAETG---------------KDRYAAHALETLFSVMQNEGADPGNLLICLIGGANVL--
                                              .                              

CHED_BACSU       KS-----------TNDLMKIGPRNVLAIKEQLSLFNIPIISEDTGGSSGRTIEFEPKSCM
CHED_BACLD       KM-----------TNDLMKVGPRNVLAIKKHLSLLNIPIVSEDTGGNSGRTIEFDPQSAE
CHED_HALH5       AS-----------NNDMMRIGQRNVEAVKKKLRELSIPILAEDVGGSNGRTIEFNPETKR
CHED_GEOKA       STV----------GGDMMRIGARNVEEVKKQLERLHIPVVAEDVGGHSGRTIEFNPQTGV
CHED_OCEIH       RT-----------GSDLMRIGPRNVESVELALAEFGIPIVSKDVGGNLGRTIEFDPRSKL
CHED_CALS4       KI-----------NSDIMNIGERNVIATKEVLKKLGIPIVAEDTGGNYGRTIEFYSEDGR
CHED_DESHY       PG-----------KPPVLKIGDRNAEQVIVELKRLGIPLLVSDVGGSFGRTIHFDVGTGD
CHED_CLOAB       SD-----------KNMNMDIGNRNGISVKKVLKELNVPLLSQDIGGNKGRTMIFNTLDGS
CHED_CLOTE       SD-----------KSMVMDIGRRNIEAVRKKLKELSIPIVAEEVGGNKGRTMTLDTSNGI
CHED_MOOTA       GDR----------HLSLLNIGQRNAAMVRQTLQELAIPLVAEDTGGNYGRTMIFDLESGD
CHED_CARHZ       PG-----------AQTVMNIGERNIEMCRKVIARMGLKLVAEDVGGNKGRTMILDTATGN
CHED1_METAC      ENS----------H---MNIGERNIKSAKETLKKLGLEIIAEDTGKNYGRTIIFDTLTGD
CHED2_METMA      ENS----------R---LNIGERNIKSARETMKKLGVSIIAEDVGKNYGRTVIFDTLTGD
CHED_METBF       ENR----------N---LNIGERNIKYAKNTLEKFEIPIISEDTGKNYGRTITLDTSTGD
CHED_PYRAB       QNI----------KSDELKIGERNVQTAKRELKKLGIRLVAEDTGGRGGRTIYLDLSTGK
CHED_PYRHO       DNI----------RSEELKIGEKNVQVAKRELRKLGIRLVAEDTGGKGGRTIYLDLSTGK
CHED_THEKO       TNV----------SNENLMVGKKNVEVAKRELKKRGIRLVAEDTGGKGGRTIYLDVSTGK
CHED2_METAC      MS-----------LDILK-IGDRNAISVEETLVKRNIPILAKDVGGEVGRNVIFNPVDGS
CHED1_METMA      MS-----------LDILK-IGDRNAISVEETLIKKNIPILAKDVGGEVGRNVIFNPADGS
CHED_ARCFU       MT-----------MDMLR-IGDRNAEAIRTILRDYGIRIVSEDLGGDEGRTVYFFTNDGR
CHED2_GEOMG      QY-----------RSAHGGIGERNVAAAREALERSGIPLVAEDTGGDYGRSLEFNTATGI
CHED3_GEOSL      QH-----------RTTHSGIGERNVTAAKEALERRGIPLVASDTGDDYGRSLEFNTVTGV
CHED_THEMA       --------------SKGMNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGK
CHED_METHJ       F-------------SGNLNIGERNAEALKAILKELSIPIVREDLGGTIGRTVTYYPKENG
CHED_SYMTH       AG-----------SNPQLDIGARNTEAVRAALARHQIRLVAEDMGGTYGRTLQLFIETGR
CHED_ALKCK       AV-----------KREFMQIGERNAAAARETLARLGITLVAEDIGGTKGRTIQYDVKTGE
CHED_HALMA       S-------------ENGSSIGSRNAKKVRETLDEHGVPVVGEDLGGDHGRSVKLEADTGN
CHED_NATPD       GS------------DDGDSIGDRNIEVAREELSDRGIELVGEEVGGDCGRTVKVDAATGD
CHED_SYNC1       AG------------NDTFNIGKRNILAVKKILWKLGMGPVAEDVGANYSRTVSLHVDTGL
CHED1_SYNAS      DD------------TNFFRIGQKNIMMARKMFWKNNVLINGEDTGSNCNRTVRLEIKTGK
CHED2_ANADE      DR------------GGAFDIGRRNHAAMWRILRHARVAVVAEDVGGSRSRTVRLFLDSGR
CHED2_LEPIC      VQ-----------SSFLQNIGEQNILTARAILEQSKIPLILEDVGGNDGRTISLYLDDGR
CHED2_LEPIN      VQ-----------SSFLQNIGEQNILTARAILEQSKIPLILEDVGGNDGRTISLYLDDGR
CHED_METMP       NS-----------NTI--DVGKKNIEASREEVKKMGLRIASEDLGGDTGRTITLSLKDGS
CHED_BDEBA       DK-----------NYIKFVVGDENLKAAKAVLEKHRIRIVAFEPGGEQGTKMRIAGD-GD
CHED2_RUEST      FD-----------TPPSQLVGSVNAKFARQAIRSAGLRLLGDDLGGLNGRRISINCDSGE
CHED_RHIEC       ------------TISTFSNVGEQNAAFAMQFLRDEGIPVVGSSTGGEHGRKLEYWPVSGR
CHED_RHIL3       ------------TISTFSNVGEQNAAFAVQFLRDEGIPVVGSSTGGEHGRKLEYWPVSGR
CHED_RHIME       ------------TIARFSNVGEQNAAFARQFLMDEGIRIVGESTGGDHGRKLEYWPSSGR
CHED_AGRFC       ------------TIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEFWPVSGR
CHED_CAUVC       ------------LFDGLSDVGASNAAFAERFLRDEGIPIVSSSTGGVSARRVEFWPASGR
CHED1_RUEST      ------------MSANLSDIGANNADFVQRFLRDEGIPVISSSVGGTSARRVRFHACSGA
CHED_CERS4       ------------MTPQLGAIGQANAAFARRYLKDEGIRCTAHSLGGNRARRIRFWPKTGR
CHED_CERSP       ------------MTPQLGAIGQANAAFARRYLRDEGIRCTAHSLGGNRARRIRFWPKTGR
CHED_ZYMMO       ------------MRSGFGDIGIKNAEFARRFLQDEHILLNAEDIGGTTARRVDFCPALGL
CHED_JANSC       ------------VLGTQTGIGAANSAFAVDFTRAQGLTLRGSDLGGTRGRRVHFTPATGD
CHED_BORBR       ----------VLSAMQLMNIGERNGQFVLNYLKTEGIPVRAQDLGDVHARRINYFPRDGR
CHED_BORPE       ----------VLSAMQLMNIGERNGQFVLNYLKTEGIPVRAQDLGDVHARRINYFPRDGR
CHED_BORPA       ----------VLSAMQLMNIGERNGQFVLNYLKTEGIPVRAQDLGDVHARRINYFPRDGR
CHED_BORA1       ----------VLSAMQQMNIGERNGQFVLSYLKTENIPVRAQDLGDTHARRIHYFPFDGR
CHED_BURP1       ----------VLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGQ
CHED_BURPS       ----------VLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGQ
CHED_BURMA       ----------VLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGQ
CHED1_BURTA      ----------VLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGQ
CHED_BURL3       ----------VLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMAATGR
CHED_PARXL       ----------VLAGMTTMNIGDRNSEFVRRYLALEKIRIVAEDLQGSHPRKVAFMPRTGQ
CHED_CUPPJ       ----------VLANMTTLNIGDRNADFVLRYLKTEEIRVAAQDLRGPHARRVSYFPVTGL
CHED_CUPMC       ----------VLANMTTLNIGDRNADFVLKYLRTEEVRVAAQDLRGPHARRVSYFPRTGL
CHED_METFK       ----------VLSGFTAINIGEKNAAFVRKYLRDENIRVVGEDLNDIYPRKVYFFPRTGR
CHED_THIDA       ----------VLRGFTTMNVGERNAQFVRDFLRAENIRVVAEDLNDVHPRKVYFFPRTGR
CHED1_DECAR      ----------VLASLASSNVGARNAEFVLDFLKTEKIPVVAKDLLDSYPRKVYYFPYSGK
CHED1_GEOMG      ----------VINGVT--DVGERNAEFALRYLEEREIPVTAVDVGDIYPRKVYFAPATGR
CHED1_SHEON      ----------VLRGLTVQNIGERNAEFVLDYLQMEQIPVIAADLLDIYPRKVYFFPETGL
CHED_RALSO       ----------VLAGMSTLDVGERNGKFVLEFLRSEGLPVAAKDLFDVHPRKVYFVPSTGQ
CHED_XANAC       ----------VLKGFTSNPVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWFFATTGR
CHED_XANC5       ----------VLKGFTSNPVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWFFATTGR
CHED_XANOM       ----------VLKGFTSNPVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWFFATTGR
CHED_XANOR       ----------VLKGFTSNPVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWFFATTGR
CHED_XANC8       ----------VLKGFTSNPVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWFFPTTGR
CHED_XANCP       ----------VLKGFTSNPVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWFFPTTGR
CHED1_ALBFT      ----------VMAGFTTMNVGERNTKFVLDYLATERIPVVSQDVLDIHPRKVCFFPVTGK
CHED_NITEU       ----------VQRAMVSSMIGSQNTRFVKKYLAERGIPILAADLEGNHPRKIHFFPKNGR
CHED2_CHRVO      ----------VLDGMTVVKVGERNTNFIRSYLANEQIPILAEDLLGECARKVYFFTATGK
CHED_HAHCH       ----------VIRGMSSVGD--KNIEFVRRYLEVDGFKIASEDVGGDYPRKILYDPTNGK
CHED_HYDCU       ----------IMSSTTNIGW--YNIGFAFDYIYTEGFKIVSQDIGDVYPRKILYYPNSGR
CHED_SACD2       ----------VLANMVRMDIGQRNIEFVESFLANDELPVIAKDLGGNYPRKILYFAATGQ
CHED2_BURTA      ----------MQSL-SDTRIGERNAAFVRAYLDAEGIRSVGGDMLGTRPRRVCYFPSTGR
CHED2_DECAR      ----------INTSGPSMSIGLRNAEFTKEWLDREGIPLLASDFLGPWSRKVLFLPMTGD
CHED_VIBVU       ------------MMGFHSMIGEKNVEFVLHYAEQEGLEVVAYDLGGLEPRKIMFDPLTGK
CHED_VIBVY       ------------MMGFHSMIGEKNVEFVLHYAEQEGLEVVAYDLGGLEPRKIMFDPLTGK
CHED_VIBCH       ------------LMGYQSLVGEKNVEFVLEYAKREKLNVVAQDLGGAQPRKLLFDPQTGQ
CHED_RHORT       -----VLPFGA----TGDSVGTKNVKIAIEWLHAQGIPTLARRTGGENGLLIRFYTATGR
CHED_SULDN       -----PNNFNAQ---NGMLVGEKNIQIAHHILSEQRIKIVASDLGGTRGRKISLESNSGR
CHED1_ANADE      -----VIGAFR----GARNLGDENVQLALRLLDEARIPVLDRDVGGARGRKLIFHVDDGA
CHED_BORBU       -----FMAKGSV------KVGLENSEFAVNTLNKYRIPILAKDFDQSKSRKIFAFPENFK
CHED_BORGP       -----FMAKGSV------KVGLENSEFAVHTLNKYRIPILAKDFDQSKSRKIFAFPENFK
CHED1_GEOSL      -----ILVNRAE-VGNFSCVGSVNARFVREFLANEGIPLLSADLEGERGRVIYFDTTDFS
CHED2_SHEON      -----VLSLCADNILNHYDIGGMNIDFVRHFLQRERIPIISEDIGGHCGRVIYFDPTDYS
CHED1_CHRVO      -SMLLS-----RERKLSHDVPSRNIQQARLMVKQLGLKLLAEDLGGNCPRMVLFDVASGN
CHED3_DECAR      -NMLTG-----PTGKQMDIGP-RNVALGRQLLAANHIALMVEHVGGSGRRKLHFDVWSGD
CHED_PSE14       -EMFPAH----RHDPHMQNVADSNVHAALALAEQHRLKLMAQDLGSTGHRNIIFDLWNGN
CHED_PSEU2       -EMFPAH----RHDPHMRNVADSNVHAALALAEQNRLKLMAQDLGSTGHRSIIFDLWDGN
CHED_PSESM       -QMFPEQ----QNDSQQLNVADLNVHAALAMAERHRLQLKAQDMGRTGHRTIIFDLWDGN
CHED2_ALBFT      -NMFPG-----NLRSGALNVGQRNGEAALTLLREHGIPVMSESLFGIGHRQIVFDVSNGD
CHED1_LEPIC      -SMFSTEEEKLLELKSVRDIGMKNILSIKEHLIRNQLLISSEDLGGFSHRRIFFSLWDGE
CHED1_LEPIN      -SMFSTEEEKLLELKSVRDIGMKNILSIKEHLIRNQLLISSEDLGGFSHRRIFFSLWDGE
CHED_OLEA2       R--------EEHPDRCMIDVGGRNVLTAREVLAAKGLEIRSEQVQGTRGRKLLFNTRTGE
CHED_DESVH       E--------EKQRLRCIVDVGGRNVEVARATLQRFGIEPQSEHILGDRGRKLFFHSGTGE
CHED2_GEOSL      T--------ASR-----PGVGSRNVDIARQVLAAEGLEVAAADVGGTRGRKLFFYTHTGE
CHED2_SYNAS      -------------CCEADQIAHENVKTARSVLKKHGIKVISEDVGGRLGRKIVYNTFQNE
CHED_CHLL3       -------------RREHDTIHIDNLRSLTSLILQRNLPICRTMTGGSERMMARMETKTGR
                                        *            .                       

CHED_BACSU       LHIRTVKQGEKTI-----------------------------------------------
CHED_BACLD       LVIRTVKQGVTTI-----------------------------------------------
CHED_HALH5       LSIRTVHQGEKEI-----------------------------------------------
CHED_GEOKA       LSIRTAAQEIKEI-----------------------------------------------
CHED_OCEIH       LAVRKINQEVIMI-----------------------------------------------
CHED_CALS4       LLVKTIGHGVKYI-----------------------------------------------
CHED_DESHY       LKVRTINHGEKVI-----------------------------------------------
CHED_CLOAB       VDIRTVGMGIRKI-----------------------------------------------
CHED_CLOTE       VQIKTVGVGMKEI-----------------------------------------------
CHED_MOOTA       VLIRTIGRPLKVI-----------------------------------------------
CHED_CARHZ       VTVKIIGNIVKVI-----------------------------------------------
CHED1_METAC      LLIKTMLRGDKVI-----------------------------------------------
CHED2_METMA      LLIKTILKGDKLI-----------------------------------------------
CHED_METBF       LLIRTILRADKII-----------------------------------------------
CHED_PYRAB       VRMRKVIGGQVIEKVY--------------------------------------------
CHED_PYRHO       VRMRKVTEGKVIEKVY--------------------------------------------
CHED_THEKO       VRMRKVSNGKVIEAVF--------------------------------------------
CHED2_METAC      MIVKYT-KGEVLWL----------------------------------------------
CHED1_METMA      MIVKYTAKGEVLWL----------------------------------------------
CHED_ARCFU       MLVKYS-RGGELWI----------------------------------------------
CHED2_GEOMG      IMVRALQQPIKQL-----------------------------------------------
CHED3_GEOSL      ITVRALQRPIKRM-----------------------------------------------
CHED_THEMA       LLVRKVGGGEQLEIKEI-------------------------------------------
CHED_METHJ       RLVIRQADGTTREI----------------------------------------------
CHED_SYMTH       VLVSTVGRGEHEL-----------------------------------------------
CHED_ALKCK       LAVRTVHHGQMIL-----------------------------------------------
CHED_HALMA       FIVKSANTDSITL-----------------------------------------------
CHED_NATPD       VNVSRTDGEETTL-----------------------------------------------
CHED_SYNC1       VNVSCPGRGQWQI-----------------------------------------------
CHED1_SYNAS      VFVKSSGGPLREL-----------------------------------------------
CHED2_ANADE      VTVQSGDQVAPL------------------------------------------------
CHED2_LEPIC      VLLKKGGFEKYLYKVR--------------------------------------------
CHED2_LEPIN      VLLKKGGFEKYLYKVR--------------------------------------------
CHED_METMP       VLVRTGSELKTI------------------------------------------------
CHED_BDEBA       YSIEKLPKTA--------------------------------------------------
CHED2_RUEST      YDIQQIPRLGGTV-----------------------------------------------
CHED_RHIEC       ARQYPLT-----GAETQRTVALEQRPAAPQ------------------------------
CHED_RHIL3       ARQYPLT-----GAETQRTVALEQRPAAPQ------------------------------
CHED_RHIME       ARQYALT-----GVEAQRALQMDQRPAVP-------------------------------
CHED_AGRFC       ARQHPLS-----GAETQKTVAMETRPVPAP------------------------------
CHED_CAUVC       VRQRLVA-----VDNAPQDVRRPTPPPMPA------------------------------
CHED1_RUEST      AQQTHVADDRRLGEEERAAVARTQAAPARK------------------------------
CHED_CERS4       VQQMFLG---------SEDVVPNEQPQFRL------------------------------
CHED_CERSP       VQQMFLG---------SEDVVPNEQPQFRL------------------------------
CHED_ZYMMO       ARCRHVE---------NQRPVERLEV---V------------------------------
CHED_JANSC       PRVDYMQ-------------SDGIDDPIAG------------------------------
CHED_BORBR       VMVRKMAPHHQKAEALIAQREAAAAQTVQ-----------------------------AE
CHED_BORPE       VMVRKMAPHHQKAEALIAQREAAAAQTVQ-----------------------------AE
CHED_BORPA       VMVRKMAPHHQKAEALIAQREAAAAQTVQ-----------------------------AE
CHED_BORA1       VLVRKMAPHHAKAEEVIAHREKLAAQKAQ-----------------------------DN
CHED_BURP1       AMVKKLRVQ--APDVAAREAALAREAVDPHGERAPRVRPRVELFGT----------PAPK
CHED_BURPS       AMVKKLRVQ--APDVAAREAALAREAVDPHGERAPRVRPRVELFGT----------PAPK
CHED_BURMA       AMVKKLRVQ--APDVAAREAALAREAVDPHGERAPRVRPRVELFGT----------PAPK
CHED1_BURTA      AMVKKLRVQ--APDVAEREAALAREAAGPRGERAARARPRVELFGT----------PAPK
CHED_BURL3       AAVKKLRLQ--VPGVTEREAALAREADRA---RTARPRPQVELFAAKR--------PAAP
CHED_PARXL       VMVKKLRLQQ-EAGVAEREQALMRQNAQARAERLAAARKRVELFSSPAASKARVELFSTP
CHED_CUPPJ       ALVRRLTRQDDQVSVERDERALARAIATS-----------------------------GT
CHED_CUPMC       ALVRRLTRQDDTVGIEREERALARALSTS-----------------------------TK
CHED_METFK       VLVKKLKQMHNNTLISREESYAKRLKANK-------------------------------
CHED_THIDA       VLVKKLKQLNNYTLVKREQDYASRLKSNV-------------------------------
CHED1_DECAR      VLVKKLHRVHNDTLFSRENDYKVRLSGAP-------------------------------
CHED1_GEOMG      AFVRQIRTGSIDSLFIGESS----------------------------------------
CHED1_SHEON      VKVRKIKTIHNSTIMDRESEYRLRIKNLP-------------------------------
CHED_RALSO       IMVRKLRSQGSAAELDSEAQYASKLSRSI-------------------------------
CHED_XANAC       VVVQRLPHAHEAEVAATE-SAVRARLSKAPV-----------------------------
CHED_XANC5       VVVQRLPHAHEAEVAATE-SAVRARLSKAPV-----------------------------
CHED_XANOM       VAVQRLPHAHEAEVAATE-SAVRARLSKAPV-----------------------------
CHED_XANOR       VAVQRLPHAHEAEVAATE-SAVRARLSKAPV-----------------------------
CHED_XANC8       VVVQRLPHAHEAEVAAAE-SAVRARLSKAPV-----------------------------
CHED_XANCP       VVVQRLPHAHEAEVAAAE-SAVRARLSKAPV-----------------------------
CHED1_ALBFT      VLVKRLAHSHPETLAVEERKGNAATVAKATS-----------------------------
CHED_NITEU       VLQKKLYVSRNDTIVEREQNYSRLLLSVA-------------------------------
CHED2_CHRVO      VLIKKLKKSGAAIKQEQPYRGRIVDQGEG-------------------------------
CHED_HAHCH       VMMKRLKSLHNDTVIQREEHYMDELSHTK-------------------------------
CHED_HYDCU       VRVRRLNAMHNQSLAAEESRYINNIGSKP-------------------------------
CHED_SACD2       AKMKKMGIASDTNLVKQEKAYLDSLATKP-------------------------------
CHED2_BURTA      ALCKRLVRG-SDVADIATSERAYDGDLARRL-----------------------------
CHED2_DECAR      AFCRRMVTNMATAETIAREEKSYADTLAQKPK----------------------------
CHED_VIBVU       AWLKRIPFAEINHLRREEERYAHTLEKQT-------------------------------
CHED_VIBVY       AWLKRIPFAEINRLRREEERYAHTLEKQT-------------------------------
CHED_VIBCH       AWVKRIGFSSAHAIKQDEELYQHSIDKQI-------------------------------
CHED_RHORT       VLVRTIQSAITIDLGGISPAFDSRQSPFFQE-----------------------------
CHED_SULDN       VMLKYVQKTEF-------------------------------------------------
CHED1_ANADE      AWVRQL------------------------------------------------------
CHED_BORBU       VIVEYPDGTKVF------------------------------------------------
CHED_BORGP       VIVEYPDGTKVF------------------------------------------------
CHED1_GEOSL      VFVRKIRLQRSLVVAKRDRNVWEHGVQAHDVEPDSVDLWLPG------------------
CHED2_SHEON      VYRSLIEHKYEEIASLQDEEYRYFNQASEDIHSSGVPVVIWSD-----------------
CHED1_CHRVO      VWIKQSQEAELEQAPHTRTRK---------------------------------------
CHED3_DECAR      VWLAFPQGADAEIRNAHG------------------------------------------
CHED_PSE14       VWVRHQPMEAIEKDAKQKNQRIAGR-----------------------------------
CHED_PSEU2       VWVRHQPMEAMEKDAKQKNQRTAGR-----------------------------------
CHED_PSESM       VWVKHQPIEVTEKDAR--------------------------------------------
CHED2_ALBFT      VWSHQVMPIGTDSGDKGDLL----------------------------------------
CHED1_LEPIC      IYVERPEHT---------------------------------------------------
CHED1_LEPIN      IYVERPEHT---------------------------------------------------
CHED_OLEA2       VWVKLLNNAANQLARRQEEQARAQSARGCSLD----------------------------
CHED_DESVH       VWVRLLRRTEPPLPSALVCRDDLT------------------------------------
CHED2_GEOSL      VLLKRLNRTEADS-----------------------------------------------
CHED2_SYNAS      ALIYKVNTLRNSDWYPYDGQGRQA------------------------------------
CHED_CHLL3       IFQTTGNNPEEMLFDYFTHNIENPDN----------------------------------
                                                                             

CHED_BACSU       --------------------------------
CHED_BACLD       --------------------------------
CHED_HALH5       --------------------------------
CHED_GEOKA       --------------------------------
CHED_OCEIH       --------------------------------
CHED_CALS4       --------------------------------
CHED_DESHY       --------------------------------
CHED_CLOAB       --------------------------------
CHED_CLOTE       --------------------------------
CHED_MOOTA       --------------------------------
CHED_CARHZ       --------------------------------
CHED1_METAC      --------------------------------
CHED2_METMA      --------------------------------
CHED_METBF       --------------------------------
CHED_PYRAB       --------------------------------
CHED_PYRHO       --------------------------------
CHED_THEKO       --------------------------------
CHED2_METAC      --------------------------------
CHED1_METMA      --------------------------------
CHED_ARCFU       --------------------------------
CHED2_GEOMG      --------------------------------
CHED3_GEOSL      --------------------------------
CHED_THEMA       --------------------------------
CHED_METHJ       --------------------------------
CHED_SYMTH       --------------------------------
CHED_ALKCK       --------------------------------
CHED_HALMA       --------------------------------
CHED_NATPD       --------------------------------
CHED_SYNC1       --------------------------------
CHED1_SYNAS      --------------------------------
CHED2_ANADE      --------------------------------
CHED2_LEPIC      --------------------------------
CHED2_LEPIN      --------------------------------
CHED_METMP       --------------------------------
CHED_BDEBA       --------------------------------
CHED2_RUEST      --------------------------------
CHED_RHIEC       KPAETSIEFF----------------------
CHED_RHIL3       KPVETSIEFF----------------------
CHED_RHIME       KPAESPIEFF----------------------
CHED_AGRFC       KPVANDIEFF----------------------
CHED_CAUVC       VASGDVDLF-----------------------
CHED1_RUEST      PAAADNVTLF----------------------
CHED_CERS4       QGGAGDVTFFDRHNNAEMPDPIKEPR------
CHED_CERSP       QGGAGDVTFFDRHNNAEMPDPIKEPR------
CHED_ZYMMO       PDKAGDVTFF----------------------
CHED_JANSC       PLGAPGVELF----------------------
CHED_BORBR       TRAAPRVERFARPGGMRVERFDTPSRRDPVGA
CHED_BORPE       TRAAPRVERFDTP-----------SRRDPVGA
CHED_BORPA       TRAAPRVERFARP------------GGMPV--
CHED_BORA1       SRSAPRIERFDAPKMKVEMFKRPLRRTANAES
CHED_BURP1       AQAKPRIELFGMRAMQPATRKQEA--------
CHED_BURPS       AQAKPRIELFGMRAMQPATRKQEA--------
CHED_BURMA       AQAKPRIELFGMRATQPATRKQEA--------
CHED1_BURTA      AQATPRIELFGTRATQPATRKQEA--------
CHED_BURL3       PPARPRIELFGARSAAPAGGVRAANLSRKQEA
CHED_PARXL       AAARPKVELFGAGSRPINSNNARTTEEA----
CHED_CUPPJ       APSRGG-ELFTRASASRTPS------------
CHED_CUPMC       APARGAVELFTRQTTARIPT------------
CHED_METFK       --VAGEVELF----------------------
CHED_THIDA       --VAGEVDLF----------------------
CHED1_DECAR      --MDGDIELFI---------------------
CHED1_GEOMG      --------------------------------
CHED1_SHEON      --SGGDVELFGE--------------------
CHED_RALSO       --ADKPASRLQLFT------------------
CHED_XANAC       ---TGGVELFE---------------------
CHED_XANC5       ---TGGVELFE---------------------
CHED_XANOM       ---TGGVELFE---------------------
CHED_XANOR       ---TGGVELFE---------------------
CHED_XANC8       ---TGGVELFE---------------------
CHED_XANCP       ---TGGVELFE---------------------
CHED1_ALBFT      ---GGSVDLF----------------------
CHED_NITEU       ---QSAIQPGTREN------------------
CHED2_CHRVO      -AKTGDIDLFI---------------------
CHED_HAHCH       --VAGDVDLF----------------------
CHED_HYDCU       --VEGDVELF----------------------
CHED_SACD2       --SAGDVELF----------------------
CHED2_BURTA      -PVAGSVELF----------------------
CHED2_DECAR      -STEKKIELF----------------------
CHED_VIBVU       -DNDSEVELF----------------------
CHED_VIBVY       -DKGSEVELF----------------------
CHED_VIBCH       -PSD-DVELFQ---------------------
CHED_RHORT       --------------------------------
CHED_SULDN       --------------------------------
CHED1_ANADE      --------------------------------
CHED_BORBU       --------------------------------
CHED_BORGP       --------------------------------
CHED1_GEOSL      --------------------------------
CHED2_SHEON      --------------------------------
CHED1_CHRVO      --------------------------------
CHED3_DECAR      --------------------------------
CHED_PSE14       --------------------------------
CHED_PSEU2       --------------------------------
CHED_PSESM       --------------------------------
CHED2_ALBFT      --------------------------------
CHED1_LEPIC      --------------------------------
CHED1_LEPIN      --------------------------------
CHED_OLEA2       --------------------------------
CHED_DESVH       --------------------------------
CHED2_GEOSL      --------------------------------
CHED2_SYNAS      --------------------------------
CHED_CHLL3       --------------------------------