CLUSTAL format seed alignment for MF_01443

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRPE_BACCZ      MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIV
PRPE_BACHK      MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPIHPDQRKLAFVGDITDRGPHSLRMIEIV
PRPE_BACAH      MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIV
PRPE_BACAN      MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIV
PRPE_BACC1      MKYDIIGDIHGCFQEFQDLTKKLGYNWNSDLPIHPDQRKLAFVGDITDRGPHSLRMIEIV
PRPE_BACCR      MKYDIIGDIHGCFQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIV
PRPE_GEOKA      MQVDIIGDIHGCFREFAALTETLGYHWDEGVPIHPDGRKLGFVGDLTDRGPESLNMIEIV
PRPE_GEOTN      MHIDIIGDIHGCYREFTALTEKLGYVWDKGIPIHPDGRKLGFVGDLTDRGPESLKMIDIV
PRPE_OCEIH      MKIDIIGDVHGCLEELEELLFKLGYQIKNGTYQHSNNRQIVFVGDITDRGPDSIKVIKLV
PRPE_ALKHC      MQFDIIGDVHGCYDELMELIDKLGYEYKRGSYDHPDGRLLAFVGDLTDRGPHSLEVIRLV
PRPE_BACSU      MAYDIISDIHGCYDEMTALIQKLGYTIKNGVPVHEEGRVLVFAGDLTDRGPKSIEVIRFV
PRPE_BACLD      MKYDVIGDIHGCYDEMIALIEKLGYSLTSGVPVHPENRTLVFLGDLTDRGPKSLEVVEFV
                *  *:*.*:***  *:  *  .***    .   * : * : * **:*****.*:.:: :*

PRPE_BACCZ      WELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFIT
PRPE_BACHK      WELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFIT
PRPE_BACAH      WELVIHKKEAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFIT
PRPE_BACAN      WELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFIT
PRPE_BACC1      WELVINKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHQQNMIKEKFIT
PRPE_BACCR      WELVIHKKEAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNIIKEKFIT
PRPE_GEOKA      CALV-ERNLAYYVPGNHCNKLYRFFLGRNVQIAHGLETTVAEYRTLPPSEQEMIRRKFIR
PRPE_GEOTN      CALV-DRKLAHYVPGNHCNKLYRFFLGRNVQVTHGLETTVAEYRALPPSEQEMIRRKFIR
PRPE_OCEIH      YQLV-KEKLAYYIPGNHCNKLYRFFQGNKVMEKHGLETTTAEYRSLSKEKQNNIKHKFIE
PRPE_ALKHC      SHMV-KKKTAYYVPGNHCNKLYRYMIGRKVQVKHGLETTVAELNALSEEERIEVIAQFKE
PRPE_BACSU      AGAY-EKGAVRYVPGNHCNKLYRYLKGNPVKVMHGLETTAAELEELSKDEKKSVSEQFMK
PRPE_BACLD      GRAV-EDGAVRYVPGNHCNKLYRFFKGNPVKLQHGLETTAAEYRNLPKQKQKDIRDLFMR
                     .   . * **********:: *. *   ******.** . *.  ::  :   *  

PRPE_BACCZ      LYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQ-DKKVQTFVLYGDITGEKHADGSPVRRDW
PRPE_BACHK      LYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQ-DKKVQTFVLYGDITGEKHADGSPVRRDW
PRPE_BACAH      LYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQ-DKKVQTFVLYGDITGEKHADGSPVRRDW
PRPE_BACAN      LYEQSPLYHILDEKRLLVCHAGIRQDYIGRQ-DKKVQTFVLYGDITGEKHADGSPVRRDW
PRPE_BACC1      LYEQSPLYHVLDEKRLIVCHAGIRQDYIGRQ-DKKVQTFVLYGDITGEKHADGSPVRRDW
PRPE_BACCR      LYEQSPLYHILDEKRVIVCHAGIRQDYIGRR-DKKVQTFVLYGDITGEKHADGSPVRRDW
PRPE_GEOKA      LYEQAPLYAVLDEGRLVIAHAGIRHDYIGRT-DKKVKTFVLYGDITGEMNQDGTPVRRDW
PRPE_GEOTN      LYEGAPLYAVLDEGRLVIAHAGIRHDYIGRM-DKKVKTFVLYGDITGETNPDGTPVRRDW
PRPE_OCEIH      LYERSPLYLHLKNINVIIAHAGIPEHLIGKK-DKRTKTFVLYGDITGEFDTTGKPIRRDW
PRPE_ALKHC      LYEQAPLYHSFPEDKLVITHAGIREDDIGSY-GKRVETFVLYGDITGETNPDGTPVRRDW
PRPE_BACSU      LYETAPLYDILHNGELVVAHAGIRADDIGKY-TRRVKDFVLYGDVTGETYPDGRPIRRDW
PRPE_BACLD      LYEKAPLYEILHNGELVVAHAGIKAEDIGKKPVGKVKQFVLYGDITGETLPDGRPVRRDW
                *** :***  : : .::: ****  . **     :.: ******:***    * *:****

PRPE_BACCZ      AKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVP
PRPE_BACHK      AKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVP
PRPE_BACAH      AKEYKGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVP
PRPE_BACAN      AKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVP
PRPE_BACC1      AKEYKGTAWVVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVP
PRPE_BACCR      AQEYKGQAWIVYGHTPVAEPRFVNQTVNIDTGAVFGGKLTGLRYPEMETISVPSSLPFVA
PRPE_GEOKA      AKRYHGSAWVVYGHTPVEKPRFVGRTVNIDTGCVFGGALTALRYPEMETVSVPSSMPFVP
PRPE_GEOTN      AKRYRGDAWIVYGHTPVEKPRFVGRTVNIDTGCVFGGALTALRYPEMTTVSVPSSMPHVP
PRPE_OCEIH      AKHYHGDSWIVYGHTPVLEPRVVNHTINIDTGCVFGNKLTAYRFPEKEFVSVASRQPFIA
PRPE_ALKHC      AATYQGDWWIVYGHTPVRRPRIIHRTVNIDTGCVFGGALTALRFPEIEFVSIPSRQPLVS
PRPE_BACSU      AAAYNGKAWVVYGHTPVKEPRKVNRTINIDTGCVFGNQLTGFRFPEIETVSVPSSLPYDE
PRPE_BACLD      AAHYRGEPWVVYGHTPVKNPRMIHHTINIDTGCVFGNRLTAFRFPELTTESVPSSLPYDE
                *  *.*  *:******* .** : :*:*****.***. **. *:**    *:.*  *   

PRPE_BACCZ      EKFRPIS-----
PRPE_BACHK      EKFRPIS-----
PRPE_BACAH      EKFRPIS-----
PRPE_BACAN      EKFRPIS-----
PRPE_BACC1      EKFRPIS-----
PRPE_BACCR      EKFRPIS-----
PRPE_GEOKA      EKFRTFS-----
PRPE_GEOTN      EKFRTFS-----
PRPE_OCEIH      EKFTDFNVSNEH
PRPE_ALKHC      EKFRNFPG----
PRPE_BACSU      SRFRPI------
PRPE_BACLD      SRFRMEP-----
                .:*